HHsearch alignment for GI: 254781187 and conserved domain: COG1203

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms].
Probab=97.46  E-value=0.0052  Score=37.46  Aligned_cols=171  Identities=13%  Similarity=0.049  Sum_probs=87.4

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHC--CCCEEEEECCCHHHHHHHHHHH
Q ss_conf             84289999999888875124555554112477614886788999999999999708--9977999715379999999999
Q gi|254781187|r   50 QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTR--PGMSIICIANSETQLKNTLWAE  127 (367)
Q Consensus        50 ~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~--~~~~v~~~A~t~~Q~~~~lw~e  127 (367)
T Consensus       195 ~~~~~~~~~~~~~~~~~~~~~--------~~vl~aPTG~GKT~asl~~a~~~~~~~~~~~~r~i~vlP~~t~ie-~~~~r  265 (733)
T COG1203         195 EGYELQEKALELILRLEKRSL--------LVVLEAPTGYGKTEASLILALALLDEKIKLKSRVIYVLPFRTIIE-DMYRR  265 (733)
T ss_pred             CHHHHHHHHHHHHHHCCCCCC--------EEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHH-HHHHH
T ss_conf             113556799999873225575--------189991688871999999999975311354562899655899999-99999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCEEE---EECCCCCCCCCCCCCCC-----CCCCCEEEE
Q ss_conf             99999862312112333321000123332--211113457761266---21013544556521011-----358628999
Q gi|254781187|r  128 VSKWLSMLPHRHWFEMQSLSLHPSGWYAE--LLEQSMGIDSKHYTI---TCRTYSEERPDTFVGPH-----NTHGMAVFN  197 (367)
Q Consensus       128 i~k~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~---~a~~~~~~~~ea~~g~h-----~~~~~l~iv  197 (367)
T Consensus       266 ~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~ds~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~~S~vIl  344 (733)
T COG1203         266 AKEIFGLFSVIGKSLHSSSKEPLLLEPDQDILLTLTTNDSYKKLLLALIVVTPIQILI-FSVKGFKFEFLALLLTSLVIL  344 (733)
T ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEEECCCCCCCCCCCEEECHHHHHH-HHHCCCCCHHHHHHHHCCEEE
T ss_conf             9875123554331001310255651701002258881242236204522206999855-740466725778876467787


Q ss_pred             ECCCCCCHH-HHHHHHHHH---HCCCCCEEEEEEECCC
Q ss_conf             754559988-999989874---0698825899980789
Q gi|254781187|r  198 DEASGTPDI-INKSILGFF---TELNPNRFWIMTSNTR  231 (367)
Q Consensus       198 DEAsgI~d~-i~e~i~g~L---t~~~~~~~~i~igNP~  231 (367)
T Consensus       345 DE~h~~~~~~~~~~l~~~i~~l~~~g~~il-l~SATlP  381 (733)
T COG1203         345 DEVHLYADETMLAALLALLEALAEAGVPVL-LMSATLP  381 (733)
T ss_pred             ECHHHCCCCCHHHHHHHHHHHHHHCCCCEE-EEECCCC
T ss_conf             427541654308999999999996899789-9927899