HHsearch alignment for GI: 254781187 and conserved domain: COG1484

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair].
Probab=97.18  E-value=0.0083  Score=36.18  Aligned_cols=71  Identities=20%  Similarity=0.129  Sum_probs=52.8

Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             3014668884436668428999999988887512455555411247761488678899999999999970899779997
Q gi|254781187|r   35 FFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI  113 (367)
Q Consensus        35 ~~~w~~~~~~~~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~  113 (367)
T Consensus        69 ~~p~~-k~~~~~d~~~~~~~~~~~l~~~~~~~~~~~-----~~~nl~l~G~~G~GKthLa~Ai~~~l~--~~g~sv~f~  139 (254)
T COG1484          69 SFPAK-KTFEEFDFEFQPGIDKKALEDLASLVEFFE-----RGENLVLLGPPGVGKTHLAIAIGNELL--KAGISVLFI  139 (254)
T ss_pred             CCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-----CCCCEEEECCCCCCHHHHHHHHHHHHH--HCCCEEEEE
T ss_conf             68755-785430235885566999999999998732-----588289989999879999999999999--839849998