HHsearch alignment for GI: 254781187 and conserved domain: COG4096

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].
Probab=97.43  E-value=0.0021  Score=39.85  Aligned_cols=74  Identities=15%  Similarity=0.167  Sum_probs=55.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHH
Q ss_conf             44366684289999999888875124555554112477614886788999999999999708997799971537999999
Q gi|254781187|r   44 PLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT  123 (367)
Q Consensus        44 ~~~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~  123 (367)
T Consensus       159 ~~~s~i~~RyyQ~~AI~rv~Eaf~~g~~r------aLlvM-ATGTGKTrTAiaii~rL~r~~~~KRVLFLaDR~~Lv~QA  231 (875)
T COG4096         159 DIDSAIGPRYYQIIAIRRVIEAFSKGQNR------ALLVM-ATGTGKTRTAIAIIDRLIKSGWVKRVLFLADRNALVDQA  231 (875)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCE------EEEEE-ECCCCCCEEHHHHHHHHHHCCHHHEEEEEECHHHHHHHH
T ss_conf             63223362278899999999998668744------89997-058885231999999999614143056761267899999


Q ss_pred             H
Q ss_conf             9
Q gi|254781187|r  124 L  124 (367)
Q Consensus       124 l  124 (367)
T Consensus       232 ~  232 (875)
T COG4096         232 Y  232 (875)
T ss_pred             H
T ss_conf             9