HHsearch alignment for GI: 254781187 and conserved domain: KOG0331

>KOG0331 consensus.
Probab=95.74  E-value=0.035  Score=32.39  Aligned_cols=260  Identities=11%  Similarity=0.014  Sum_probs=118.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHH------CC-CCEEEEECCCH
Q ss_conf             436668428999999988887512455555411247761488678899999999999970------89-97799971537
Q gi|254781187|r   45 LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST------RP-GMSIICIANSE  117 (367)
Q Consensus        45 ~~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~------~~-~~~v~~~A~t~  117 (367)
T Consensus       108 ~~g~~~PtpIQaq~wp~~l~----G--------rD~v~iA~TGSGKTLay~lP~i~~l~~~~~~~~~~~~P~vLVL~PTR  175 (519)
T KOG0331         108 EQGFEKPTPIQAQGWPIALS----G--------RDLVGIARTGSGKTLAYLLPAIVHLNNEQGKLSRGDGPIVLVLAPTR  175 (519)
T ss_pred             HCCCCCCCHHHHCCCCEECC----C--------CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCH
T ss_conf             53999885344144651126----8--------86577823578620555557999987004443479998699976859


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             99999999999999986231211233332100012333221111345776126621013544556521011358628999
Q gi|254781187|r  118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN  197 (367)
Q Consensus       118 ~Q~~~~lw~ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~iv  197 (367)
T Consensus       176 ELA~QV-~~~~~~~~~~~~~~~~cvyGG~~~~~Q~~---------~l~~gvdiviaTPGRl~d~le~g~~~l~~v~ylVL  245 (519)
T KOG0331         176 ELAVQV-QAEAREFGKSLRLRSTCVYGGAPKGPQLR---------DLERGVDVVIATPGRLIDLLEEGSLNLSRVTYLVL  245 (519)
T ss_pred             HHHHHH-HHHHHHHCCCCCCCEEEEECCCCCCHHHH---------HHHCCCCEEEECCHHHHHHHHCCCCCCCCEEEEEE
T ss_conf             999999-99999970777740799868988637889---------87559818980771789999748856453039996


Q ss_pred             ECCCCCCHHHH-HHHHHHHHC---CCCCEEEEEEECCCCCCCHHHHHHHCCCCCEEEEEECCCC----CCC-------C-
Q ss_conf             75455998899-998987406---9882589998078999876887541122350467523332----888-------8-
Q gi|254781187|r  198 DEASGTPDIIN-KSILGFFTE---LNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRT----VEG-------I-  261 (367)
Q Consensus       198 DEAsgI~d~i~-e~i~g~Lt~---~~~~~~~i~igNP~r~~g~Fye~~~~~~~~w~~~~~~~~d----~p~-------~-  261 (367)
T Consensus       246 DEADrMldmGFe~qI~~Il~~i~~~~rQtlm~sa-Twp~~v~~lA~~fl~---~~~~i~ig~~~~~~a~~~i~qive~~~  321 (519)
T KOG0331         246 DEADRMLDMGFEPQIRKILSQIPRPDRQTLMFSA-TWPKEVRQLAEDFLN---NPIQINVGNKKELKANHNIRQIVEVCD  321 (519)
T ss_pred             CCHHHHHCCCCHHHHHHHHHHCCCCCCCEEEEEE-ECCHHHHHHHHHHHC---CCEEEEECCHHHHHHHCCHHHHHHHCC
T ss_conf             3477663135379999998755897522788865-464889999999845---964899612145544333146511268


Q ss_pred             ---CHHHHHHHHHHCCCCCCEEEEEEEEEECCCCC------------CEEECHHHHHHHHCC--CCCCCCCCCEEEEEEC
Q ss_conf             ---98899999962168800026888644327789------------807829998644315--7777889848999963
Q gi|254781187|r  262 ---DSGFHEGIISRYGLDSDVARIEILGQFPQQEV------------NNFIPHNYIEEAMSR--EAIDDLYAPLIMGCDI  324 (367)
Q Consensus       262 ---~~~~i~~~~~~~gedS~~~r~ev~G~Fp~~~~------------d~~ip~~~ie~a~~~--~~~~~~~~p~viGvDv  324 (367)
T Consensus       322 ~~~K~~~l~~lL~~~~~-~~~~KvIIFc~tkr~~~~l~~~l~~~~~~a~~iHGd~sQ~eR~~~L~~FreG~~~vLVATdV  400 (519)
T KOG0331         322 ETAKLRKLGKLLEDISS-DSEGKVIIFCETKRTCDELARNLRRKGWPAVAIHGDKSQSERDWVLKGFREGKSPVLVATDV  400 (519)
T ss_pred             HHHHHHHHHHHHHHHHC-CCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCCCCCCEEEECCC
T ss_conf             78898879999999735-68986899964336499999887751766155006664889999997502688546988153


Q ss_pred             CCCCCCE
Q ss_conf             8778810
Q gi|254781187|r  325 AGEGGDK  331 (367)
Q Consensus       325 Ar~G~D~  331 (367)
T Consensus       401 AaRGLDi  407 (519)
T KOG0331         401 AARGLDV  407 (519)
T ss_pred             CCCCCCC
T ss_conf             1256887