HHsearch alignment for GI: 254781187 and conserved domain: KOG1015

>KOG1015 consensus.
Probab=93.73  E-value=0.21  Score=27.61  Aligned_cols=160  Identities=16%  Similarity=0.127  Sum_probs=78.7

Q ss_pred             EEEECCCCCCHHHHHHHHH-HHHHHHCCC-CEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--------
Q ss_conf             7761488678899999999-999970899-779997153799999999999999986231211233332100--------
Q gi|254781187|r   80 CAISAGRGIGKTTLNAWMM-LWLISTRPG-MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLH--------  149 (367)
Q Consensus        80 ~~v~sgrg~GKS~~~a~~~-lw~~~~~~~-~~v~~~A~t~~Q~~~~lw~ei~k~~~~~~~~~~~~~~~~~~~--------  149 (367)
T Consensus       699 cILAHcMGLGKTlQVvtflhTvL~c~klg~ktaLvV~Pl-Nt~~-NW~~EFekWm~~~e~~~~leV~eL~~vkr~e~R~~  776 (1567)
T KOG1015         699 CILAHCMGLGKTLQVVTFLHTVLLCDKLGFKTALVVCPL-NTAL-NWMNEFEKWMEGLEDDEKLEVSELATVKRPEERSY  776 (1567)
T ss_pred             HHHHHHHCCCCEEHHHHHHHHHHHHHCCCCCEEEEECCH-HHHH-HHHHHHHHHCCCCCCCCCCEEEHHHHCCCHHHHHH
T ss_conf             177875045640014678889987420478568997235-9988-99999998612422246621202120267488999


Q ss_pred             -CCCCCCCCCCCCCCCCCCCEEEEECCC--CCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -012333221111345776126621013--54455652101135862899975455998899998987406988258999
Q gi|254781187|r  150 -PSGWYAELLEQSMGIDSKHYTITCRTY--SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM  226 (367)
Q Consensus       150 -~~~~~~~~~~~~~~~~~~~~~~~a~~~--~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g~Lt~~~~~~~~i~  226 (367)
T Consensus       777 ~L~~W~~~ggVmIiGYdmyRnLa~gr~vk~rk~ke~f~k~lvdpGPD~vVCDE~HiLKNeksa~Skam~~irtkRRI-~L  855 (1567)
T KOG1015         777 MLQRWQEDGGVMIIGYDMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEKSAVSKAMNSIRTKRRI-IL  855 (1567)
T ss_pred             HHHHHHHCCCEEEEEHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEEEECCHHHHCCCHHHHHHHHHHHHHHEEE-EE
T ss_conf             99999752977997368888775145603567999999860578997687242122135247899999987764047-75


Q ss_pred             EECCCCCCCHHHHHHH
Q ss_conf             8078999876887541
Q gi|254781187|r  227 TSNTRRLNGWFYDIFN  242 (367)
Q Consensus       227 igNP~r~~g~Fye~~~  242 (367)
T Consensus       856 TGTPLQNNLmEY~CMV  871 (1567)
T KOG1015         856 TGTPLQNNLMEYHCMV  871 (1567)
T ss_pred             ECCCHHHHHHHHHHHH
T ss_conf             2671133248887888