HHsearch alignment for GI: 254781187 and conserved domain: PRK06871

>PRK06871 DNA polymerase III subunit delta'; Validated.
Probab=97.05  E-value=0.02  Score=33.91  Aligned_cols=140  Identities=16%  Similarity=0.288  Sum_probs=72.8

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999998888751245555541124776148867889999999999997089977999715379999999999999998
Q gi|254781187|r   54 WQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS  133 (367)
Q Consensus        54 wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~lw~ei~k~~~  133 (367)
T Consensus         5 Wl~~~~~~l~~~~~~~r~~H-----A~L~~G~~G~Gk~~la~~~a~~llC~~~~~~~~Cg~C~sC~l-------~~--~g   70 (324)
T PRK06871          5 WLQPIYQQITQTFLQGRGHH-----ALLFKADSGLGTEQLIRALAQWLMCQAPGDEQPCGQCHSCHL-------FQ--AG   70 (324)
T ss_pred             CCHHHHHHHHHHHHCCCCCE-----EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH-------HH--CC
T ss_conf             65799999999998699543-----787689999789999999999982899999998888989999-------97--38


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             62312112333321000123332211113457761266210135445565210113586289997545599889999898
Q gi|254781187|r  134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILG  213 (367)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g  213 (367)
T Consensus        71 ~HPD~~~i~~~~-------------~k~I~vd~IR~l~~-----~~~~~~~~g---~~-KV~iI~~ae~m~~~AaNALLK  128 (324)
T PRK06871         71 NHPDFHILEPID-------------GKDIGVDQVREINE-----KVSQFAQQG---GN-KVVYIQGAERLTEAAANALLK  128 (324)
T ss_pred             CCCCEEEEECCC-------------CCCCCHHHHHHHHH-----HHHHCCCCC---CC-EEEEECCHHHHHHHHHHHHHH
T ss_conf             999879984678-------------88788999999999-----986462205---96-699975888857999999999


Q ss_pred             HHHCCCCCEEEEEEEC
Q ss_conf             7406988258999807
Q gi|254781187|r  214 FFTELNPNRFWIMTSN  229 (367)
Q Consensus       214 ~Lt~~~~~~~~i~igN  229 (367)
T Consensus       129 tLEEPp~~~~fiL~t~  144 (324)
T PRK06871        129 TLEEPRPNTYFLLQAD  144 (324)
T ss_pred             HHCCCCCCEEEEEEEC
T ss_conf             8338987838999878