HHsearch alignment for GI: 254781187 and conserved domain: PRK07993

>PRK07993 DNA polymerase III subunit delta'; Validated.
Probab=95.07  E-value=0.25  Score=27.17  Aligned_cols=134  Identities=13%  Similarity=0.113  Sum_probs=68.9

Q ss_pred             HHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             88887512455555411247761488678899999999999970899779997153799999999999999986231211
Q gi|254781187|r   61 AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW  140 (367)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~lw~ei~k~~~~~~~~~~  140 (367)
T Consensus        13 ~l~~~~~~~rl~H-----A~L~~G~~G~Gk~~la~~~a~~llC~~~~~~~~Cg~C~~--C~-----l~~--~~~HPD~~~   78 (334)
T PRK07993         13 KLVGSYQAGRGHH-----ALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRG--CQ-----LMQ--AGTHPDYYT   78 (334)
T ss_pred             HHHHHHHCCCCCE-----EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH--HH-----HHH--CCCCCCEEE
T ss_conf             9999998598104-----675479999889999999999981899999999999978--99-----986--689998477


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             23333210001233322111134577612662101354455652101135862899975455998899998987406988
Q gi|254781187|r  141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP  220 (367)
Q Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g~Lt~~~~  220 (367)
T Consensus        79 i~pe~------------~~~~I~IdqIR~l~------~--~~~~~~~~g~~k-V~iI~~Ae~mn~~AaNaLLKtLEEPp~  137 (334)
T PRK07993         79 LTPEK------------GKSSLGVDAVREVT------E--KLYEHARLGGAK-VVWLPDAALLTDAAANALLKTLEEPPE  137 (334)
T ss_pred             ECCCC------------CCCCCCHHHHHHHH------H--HHHHCCCCCCCE-EEEECCHHHHCHHHHHHHHHHHCCCCC
T ss_conf             53422------------34559999999999------9--984366569947-999766777599999999986127998


Q ss_pred             CEEEEEEEC
Q ss_conf             258999807
Q gi|254781187|r  221 NRFWIMTSN  229 (367)
Q Consensus       221 ~~~~i~igN  229 (367)
T Consensus       138 ~t~~iL~t~  146 (334)
T PRK07993        138 KTWFFLACR  146 (334)
T ss_pred             CEEEEEECC
T ss_conf             849998669