HHsearch alignment for GI: 254781187 and conserved domain: PRK08451

>PRK08451 DNA polymerase III subunits gamma and tau; Validated.
Probab=97.19  E-value=0.016  Score=34.37  Aligned_cols=136  Identities=15%  Similarity=0.082  Sum_probs=69.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999988887512455555411247761488678899999999999970899779997153799999999999999986
Q gi|254781187|r   55 QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM  134 (367)
Q Consensus        55 q~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~lw~ei~k~~~~  134 (367)
T Consensus        19 Qe~iv~~L~nAi~~~Rl~-H----AYLFsGPrGvGKTt~ArifAkaLnC~~~~~~~PCg~--C~----sC-~~i~~--g~   84 (523)
T PRK08451         19 QESVSKTLSLALDNNRLA-H----AYLFSGLRGSGKTSSARIFSRALVCEQGPSSTPCGT--CA----QC-QAALE--GR   84 (523)
T ss_pred             CHHHHHHHHHHHHCCCCC-C----EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC--CH----HH-HHHHC--CC
T ss_conf             499999999999859967-1----587578998688999999999975999999898887--88----89-99864--89


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             23121123333210001233322111134577612662101354455652101135862899975455998899998987
Q gi|254781187|r  135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGF  214 (367)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g~  214 (367)
T Consensus        85 hpD--ViEiDaa-------------------sn~gID~IReLie~--~~~~P~~gryK-V~IIDEah~Lt~~A~NALLKT  140 (523)
T PRK08451         85 HID--IIEMDAA-------------------SNRGIDDIRNLIEQ--TKYKPSMARFK-IFIIDEVHMLTKEAFNALLKT  140 (523)
T ss_pred             CCC--EEEECCC-------------------CCCCHHHHHHHHHH--HCCCCCCCCEE-EEEEECCCCCCHHHHHHHHHH
T ss_conf             998--5510553-------------------33689999999997--23588679727-999826030489999999997


Q ss_pred             HHCCCCCEEEEEEE
Q ss_conf             40698825899980
Q gi|254781187|r  215 FTELNPNRFWIMTS  228 (367)
Q Consensus       215 Lt~~~~~~~~i~ig  228 (367)
T Consensus       141 LEEPP~~vvFILaT  154 (523)
T PRK08451        141 LEEPPSYVKFILAT  154 (523)
T ss_pred             CCCCCCCCEEEEEC
T ss_conf             03898783799975