HHsearch alignment for GI: 254781187 and conserved domain: PRK08699

>PRK08699 DNA polymerase III subunit delta'; Validated.
Probab=96.33  E-value=0.071  Score=30.47  Aligned_cols=127  Identities=15%  Similarity=0.135  Sum_probs=61.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCE-EEEEC-CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4776148867889999999999997089977-99971-537999999999999999862312112333321000123332
Q gi|254781187|r   79 KCAISAGRGIGKTTLNAWMMLWLISTRPGMS-IICIA-NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAE  156 (367)
Q Consensus        79 ~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~-v~~~A-~t~~Q~~~~lw~ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (367)
T Consensus        23 A~L~~Gp~G~Gk~~~A~~~A~~llC~~~~~~~~~Cg~C~sC~~~~~----------g~HPD~~~i~p~~~~--~~---~g   87 (325)
T PRK08699         23 AWLFVGKKGTGKTAFARFAAKALLCETPAPGCKPCGECMSCHLFGQ----------GSHPDFYEITPLADE--PE---NG   87 (325)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHC----------CCCCCEEEEECCCCC--CC---CC
T ss_conf             7975799997899999999999828999888998988888999865----------999996885134453--00---16


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEC
Q ss_conf             2111134577612662101354455652101135862899975455998899998987406988258999807
Q gi|254781187|r  157 LLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN  229 (367)
Q Consensus       157 ~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g~Lt~~~~~~~~i~igN  229 (367)
T Consensus        88 ~~~~~I~idqi------R~l~~~--~~~~~~~~~~-kV~ii~~ae~mn~~aaNaLLK~LEEPp~~~~fiL~t~  151 (325)
T PRK08699         88 RKLLQIKIDAV------REIIDN--VYLTSVRGGL-RVILIHPAESMNVQAANSLLKVLEEPPPQVVFLLVSH  151 (325)
T ss_pred             CCCCCCCHHHH------HHHHHH--HCCCCCCCCC-EEEEECCHHHHCHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             65566769999------999999--7108656894-6999857777589999999998417888848999879