HHsearch alignment for GI: 254781187 and conserved domain: PRK11057

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional.
Probab=96.13  E-value=0.021  Score=33.75  Aligned_cols=62  Identities=16%  Similarity=0.102  Sum_probs=44.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHH
Q ss_conf             3666842899999998888751245555541124776148867889999999999997089977999715379999999
Q gi|254781187|r   46 EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL  124 (367)
Q Consensus        46 ~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~l  124 (367)
T Consensus        21 FG~~~Fr~~Q~e~i~~~l~g~------------D~l~~mpTG~GKSlcyQlPal~----~-~g~tiVisPLisLm~DQv   82 (607)
T PRK11057         21 FGYQQFRPGQEEIIDTVLSGR------------DCLVVMPTGGGKSLCYQIPALV----L-DGLTLVVSPLISLMKDQV   82 (607)
T ss_pred             CCCCCCCHHHHHHHHHHHCCC------------CEEEECCCCCHHHHHHHHHHHH----C-CCCEEEECCHHHHHHHHH
T ss_conf             698434576999999998699------------8899878995597999999987----7-998899868799999999