HHsearch alignment for GI: 254781187 and conserved domain: PRK13894

>PRK13894 conjugal transfer ATPase TrbB; Provisional.
Probab=94.95  E-value=0.077  Score=30.25  Aligned_cols=55  Identities=22%  Similarity=0.171  Sum_probs=41.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHH
Q ss_conf             899999998888751245555541124776148867889999999999997089977999715379
Q gi|254781187|r   53 RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET  118 (367)
Q Consensus        53 ~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~  118 (367)
T Consensus       136 ~~~a~~L~~~V~~-----------r~nilI~G~TgsGKTTll~all~~i~~~~p~eRivtIED~~E  190 (320)
T PRK13894        136 AEQREAIIAAVRA-----------HRNILVIGGTGSGKTTLVNAIINEMVIQDPTERVFIIEDTGE  190 (320)
T ss_pred             HHHHHHHHHHHHC-----------CCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHH
T ss_conf             9999999999972-----------875899858886568999999863202695201775258788