HHsearch alignment for GI: 254781187 and conserved domain: cd01130

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.
Probab=92.09  E-value=0.46  Score=25.49  Aligned_cols=51  Identities=27%  Similarity=0.330  Sum_probs=36.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCH
Q ss_conf             89999999888875124555554112477614886788999999999999708997799971537
Q gi|254781187|r   53 RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSE  117 (367)
Q Consensus        53 ~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~  117 (367)
T Consensus        12 ~~~~~~L~~~v~~~-----------~nIlIsG~tGSGKTTll~al~~~i---~~~~rivtiEd~~   62 (186)
T cd01130          12 PLQAAYLWLAVEAR-----------KNILISGGTGSGKTTLLNALLAFI---PPDERIITIEDTA   62 (186)
T ss_pred             HHHHHHHHHHHHCC-----------CCEEEECCCCCCHHHHHHHHHHHC---CCCCCEEEECCCH
T ss_conf             99999999999859-----------989998999998999999999613---3456459841535