HHsearch alignment for GI: 254781187 and conserved domain: pfam02456

>pfam02456 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can interact with the adenoviral packaging signal and that this interaction involves DNA sequences that have previously been demonstrated to be required for packaging. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter.
Probab=92.88  E-value=0.21  Score=27.62  Aligned_cols=84  Identities=11%  Similarity=0.033  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCC----CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             28999999988887512455----55541124776148867889999999999997089977999715379999999999
Q gi|254781187|r   52 HRWQLEFMEAVDVHCHSNVN----NSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAE  127 (367)
Q Consensus        52 ~~wq~~~l~~~~~~~~~~~~----~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~lw~e  127 (367)
T Consensus        58 ~~~~~~~~n~~~~~L~~dG~~~SLNy~~qP~I~vVYGPTG~GKSQLlRNlis~~lI~P~PETVfFItPq~~mIp---p~E  134 (370)
T pfam02456        58 MEAVHGQLNEASRYLRPDGELPSLNYGLQPVIGVVYGPTGCGKSQLLRNLLSCQLIQPIPETVFFITPQKDMIP---PQE  134 (370)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCC---HHH
T ss_conf             99999999863154066896575546787449999889987789999998734667799972899767778679---899


Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999862312
Q gi|254781187|r  128 VSKWLSMLPHR  138 (367)
Q Consensus       128 i~k~~~~~~~~  138 (367)
T Consensus       135 ~~aWe~Ql~EG  145 (370)
T pfam02456       135 QTAWELQLCEG  145 (370)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999998735