HHsearch results for GI: 254781187 and protein with PDBid: 1vec_A

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19
Probab=97.48  E-value=0.00035  Score=43.26  Aligned_cols=73  Identities=12%  Similarity=0.039  Sum_probs=51.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCC-CCEEEEECCCHHHHHHHH
Q ss_conf             3666842899999998888751245555541124776148867889999999999997089-977999715379999999
Q gi|254781187|r   46 EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-GMSIICIANSETQLKNTL  124 (367)
Q Consensus        46 ~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~-~~~v~~~A~t~~Q~~~~l  124 (367)
                      .+|..|.+.|.+++..+-..    .        .+.+.|..|+|||.....-++..+.... +..+++..|+...+..+ 
T Consensus        21 ~g~~~pt~iQ~~aip~il~G----~--------dvi~~a~tGsGKTlayllp~l~~~~~~~~~~~~~i~~~~~~l~~~~-   87 (206)
T 1vec_A           21 MGWEKPSPIQEESIPIALSG----R--------DILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV-   87 (206)
T ss_dssp             TTCCSCCHHHHHHHHHHHTT----C--------CEEEECCSSSTTHHHHHHHHHHHCCTTSCSCCEEEECSCHHHHHHH-
T ss_pred             CCCCCCCHHHHHHHHHHHCC----C--------CEEEEECCCCCCEEEEECCHHHHCCCCCCCCCEEEEECCHHHHHHH-
T ss_conf             79999999999999999879----9--------8899930799840156434243012345786237873328899999-


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254781187|r  125 WAEVSKW  131 (367)
Q Consensus       125 w~ei~k~  131 (367)
                      ...++..
T Consensus        88 ~~~~~~~   94 (206)
T 1vec_A           88 SQICIQV   94 (206)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999876