HHsearch results for GI: 254781187 and protein with PDBid: 2chq_A

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A
Probab=95.69  E-value=0.017  Score=32.92  Aligned_cols=121  Identities=16%  Similarity=0.101  Sum_probs=64.1

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999988887512455555411247761488678899999999999970899779997153799999999999999986
Q gi|254781187|r   55 QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM  134 (367)
Q Consensus        55 q~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~~~~v~~~A~t~~Q~~~~lw~ei~k~~~~  134 (367)
                      |.++.+.+...++++..   |   .+...++-|+|||+++-.++-...+......+.....+...-.+....++..    
T Consensus        22 ~~~~~~~l~~~i~~~~~---~---~~L~~Gp~G~GKttla~~la~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----   91 (319)
T 2chq_A           22 QDEVIQRLKGYVERKNI---P---HLLFSGPPGTGKTATAIALARDLFGENWRDNFIEMNASDERGIDVVRHKIKE----   91 (319)
T ss_dssp             CHHHHHHHHTTTTTTCC---C---CEEEESSSSSSHHHHHHHHHHHHHTTCHHHHCEEEETTSTTCTTTSSHHHHH----
T ss_pred             HHHHHHHHHHHHHCCCC---C---EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHH----
T ss_conf             59999999999977999---8---7998897999999999999997344567876477535677763789999999----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             23121123333210001233322111134577612662101354455652101135862899975455998899998987
Q gi|254781187|r  135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGF  214 (367)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~ea~~g~h~~~~~l~ivDEAsgI~d~i~e~i~g~  214 (367)
                                                         +  +..      ....   +.....+++||+..+......++...
T Consensus        92 -----------------------------------~--~~~------~~~~---~~~~~~iiide~d~l~~~~q~~ll~~  125 (319)
T 2chq_A           92 -----------------------------------F--ART------APIG---GAPFKIIFLDEADALTADAQAALRRT  125 (319)
T ss_dssp             -----------------------------------H--HHS------CCSS---SCCCEEEEEETGGGSCHHHHHTTGGG
T ss_pred             -----------------------------------H--HHH------HHCC---CCCEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             -----------------------------------8--874------4406---99648999725331679999999877


Q ss_pred             HHCCCCCEEEEEEECCC
Q ss_conf             40698825899980789
Q gi|254781187|r  215 FTELNPNRFWIMTSNTR  231 (367)
Q Consensus       215 Lt~~~~~~~~i~igNP~  231 (367)
                      +.........+++.|..
T Consensus       126 le~~~~~~~~i~~~~~~  142 (319)
T 2chq_A          126 MEMYSKSCRFILSCNYV  142 (319)
T ss_dssp             TSSSSSSEEEEEEESCG
T ss_pred             HHCCCCCCEECCCCCCC
T ss_conf             61278651110256850