HHsearch results for GI: 254781187 and protein with PDBid: 3ber_A

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural genomics consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}
Probab=98.07  E-value=3.3e-05  Score=49.59  Aligned_cols=79  Identities=15%  Similarity=0.072  Sum_probs=58.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCC-CCEEEEECCCHHHHHHH
Q ss_conf             43666842899999998888751245555541124776148867889999999999997089-97799971537999999
Q gi|254781187|r   45 LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-GMSIICIANSETQLKNT  123 (367)
Q Consensus        45 ~~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~~~-~~~v~~~A~t~~Q~~~~  123 (367)
                      -.+|..|++.|.+.+..+-+.    .        .+.|.|..|+|||.....-++..+...+ ..++++++||..-+.++
T Consensus        60 ~~G~~~pt~IQ~~aip~il~g----~--------dvlv~A~TGSGKTla~~lp~l~~~~~~~~~~~~lil~PtreLa~q~  127 (249)
T 3ber_A           60 QLGWTKPTKIQIEAIPLALQG----R--------DIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQI  127 (249)
T ss_dssp             HTTCCSCCHHHHHHHHHHHTT----C--------CEEEECCTTSCHHHHHHHHHHHHHHHSCCSSCEEEECSSHHHHHHH
T ss_pred             HCCCCCCCHHHHHHHHHHHCC----C--------CEEEECCCCCCCCEEEECCCCCCCCCCCCCCEEEEECCCHHHHHHH
T ss_conf             879999999999999999779----9--------9899827999661389712222324467774499977758987666


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999998623
Q gi|254781187|r  124 LWAEVSKWLSMLP  136 (367)
Q Consensus       124 lw~ei~k~~~~~~  136 (367)
                       ...++++.....
T Consensus       128 -~~~~~~l~~~~~  139 (249)
T 3ber_A          128 -SEQFEALGSSIG  139 (249)
T ss_dssp             -HHHHHHHHGGGT
T ss_pred             -HHHHHHHCCCCC
T ss_conf             -677664303678