HHsearch results for GI: 254781187 and protein with PDBid: 3bor_A

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helicase, alternative splicing, ATP-binding; 1.85A {Homo sapiens} PDB: 2g9n_A*
Probab=97.43  E-value=0.00054  Score=42.12  Aligned_cols=73  Identities=15%  Similarity=0.105  Sum_probs=51.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHH-CCCCEEEEECCCHHHHHHHH
Q ss_conf             36668428999999988887512455555411247761488678899999999999970-89977999715379999999
Q gi|254781187|r   46 EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST-RPGMSIICIANSETQLKNTL  124 (367)
Q Consensus        46 ~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~-~~~~~v~~~A~t~~Q~~~~l  124 (367)
                      .+|..|++-|.+.+..+-..            ..+.+.|..|+|||.....-++..+.. .....+++++||..-+.++ 
T Consensus        48 ~g~~~pt~IQ~~aIp~il~g------------~dvi~~A~TGSGKTlayllp~~~~~~~~~~~~~~lIl~PtreLa~Qi-  114 (237)
T 3bor_A           48 YGFEKPSAIQQRAIIPCIKG------------YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQI-  114 (237)
T ss_dssp             HTCCSCCHHHHHHHHHHHTT------------CCEEECCCSSHHHHHHHHHHHHHHCCTTSCSCCEEEECSSHHHHHHH-
T ss_pred             CCCCCCCHHHHHHHHHHHCC------------CCEEEECCCCCCCCCEEECCCCCCCCCCCCCCEEEEECCHHHHHHHH-
T ss_conf             79999999999999999779------------98899798888982168645223424445676289952718899999-


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254781187|r  125 WAEVSKW  131 (367)
Q Consensus       125 w~ei~k~  131 (367)
                      ...+++.
T Consensus       115 ~~~~~~l  121 (237)
T 3bor_A          115 QKVILAL  121 (237)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999997