HHsearch results for GI: 254781187 and protein with PDBid: 3fht_A

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B
Probab=97.54  E-value=0.00075  Score=41.26  Aligned_cols=68  Identities=16%  Similarity=0.162  Sum_probs=45.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHH-CCCCEEEEECCCHHHHHHH
Q ss_conf             36668428999999988887512455555411247761488678899999999999970-8997799971537999999
Q gi|254781187|r   46 EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST-RPGMSIICIANSETQLKNT  123 (367)
Q Consensus        46 ~~~~~p~~wq~~~l~~~~~~~~~~~~~~~~~~~~~~v~sgrg~GKS~~~a~~~lw~~~~-~~~~~v~~~A~t~~Q~~~~  123 (367)
                      .+|..|++.|.+++..+-....+          .+.|.|+.|+|||.+...-++-.+.. .....+++++|+...+...
T Consensus        43 ~g~~~pt~iQ~~aip~il~~~~k----------dvlv~apTGsGKTl~f~lpil~~l~~~~~~~~~lil~p~~~l~~q~  111 (412)
T 3fht_A           43 MGFNRPSKIQENALPLMLAEPPQ----------NLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQT  111 (412)
T ss_dssp             TTCCSCCHHHHHHHHHHHSSSCC----------CEEEECCTTSCHHHHHHHHHHHHCCTTSCSCCEEEECSSHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCC----------CEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHH
T ss_conf             79999999999999999759999----------8899899995789999999997441037874699990749988879