BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781187|ref|YP_003065600.1| putative phage terminase,
large subunit [Candidatus Liberibacter asiaticus str. psy62]
         (367 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040864|gb|ACT57660.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 367

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME
Sbjct: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL
Sbjct: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER
Sbjct: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI
Sbjct: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN
Sbjct: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG
Sbjct: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360

Query: 361 CPVGSSI 367
           CPVGSSI
Sbjct: 361 CPVGSSI 367


>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1]
 gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 511

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 252/359 (70%), Positives = 299/359 (83%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ TN +
Sbjct: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359


>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2]
 gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 516

 Score =  358 bits (918), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 257/359 (71%), Positives = 302/359 (84%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP  
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPQQ 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           YI EA+ R AI D YAPLIMGCDIAGEG DKTVVV RRGNIIE IFDWS +LI+ TN++
Sbjct: 301 YIVEALERVAIPDPYAPLIMGCDIAGEGEDKTVVVLRRGNIIERIFDWSGELIEVTNRK 359


>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 262/351 (74%), Positives = 298/351 (84%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T  + EQEL E++   +  LSF NFV+R FPW      L +FS+P RWQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           AVD  C  NV+N +P IFK A+SAGRGIGKTTLNAWMMLWLISTRPGMSI+C+ANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K+TLWAEVSKWLSMLP++HWFEMQSLSLHP+ WYAE LE++ GIDSKHYTITCRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+FNDEASGTPD+IN SILGFFTE N NRFW+MTSN RRLNGWFYDI
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLNGWFYDI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN+PLEDW+R+QIDTRTVEGID  FHE II+RYGLDSDV R+E+LGQFPQQ++N+FIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPNFHENIIARYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
            IEEA++RE I D YAPL+MGCDIAGEGGD TVVV RRG  IEHIFDWS  
Sbjct: 301 RIEEALNREPIKDPYAPLVMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGL 351


>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 264/351 (75%), Positives = 298/351 (84%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T  + EQEL E++   +  LSF NFV+R FPW      L +FS+P RWQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           AVD  C  NV+N +P IFK A+SAGRGIGKTTLNAWMMLWLISTRPGMSI+C+ANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K+TLWAEVSKWLSMLP++HWFEMQSLSLHP+ WYAE LE++ GIDSKHYTITCRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+FNDEASGTPD+IN SILGFFTE N NRFW+MTSN RRL GWFYDI
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN+PLEDW+R+QIDTRTVEGID  FHEGIISRYGLDSDV R+E+LGQFPQQ++N+FIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
            IEEA++RE I D YAPLIMGCDIAGEGGD TVVV RRG  IEHIFDWS  
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGL 351


>gi|309702815|emb|CBJ02146.1| putative terminase, large subunit [Escherichia coli ETEC H10407]
          Length = 493

 Score =  286 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 88/349 (25%), Positives = 154/349 (44%), Gaps = 18/349 (5%)

Query: 6   STDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVH 65
           +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  H
Sbjct: 4   AAMSPEEQLVEDI---AGFTYDPLGYALYAFPWGEEGTELAHATGPRKWQADAFREIRDH 60

Query: 66  CHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLW 125
             +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   W
Sbjct: 61  LQNPATRHQPIM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTW 118

Query: 126 AEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFV 185
            E+ KW ++   + WF   + +++ +    +          K +      +SE   + F 
Sbjct: 119 PEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFA 168

Query: 186 GPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
           G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F   
Sbjct: 169 GLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKY 228

Query: 245 LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE 304
              WK  QID+RTVEG +    +  +  YG DSD  ++ + G FP    N FIP    + 
Sbjct: 229 KHRWKCAQIDSRTVEGTNKEQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQP 288

Query: 305 AMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           A+ R        +A +++G D + +G D  V+  R+G   + + +W   
Sbjct: 289 AVGRVITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRT 337


>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291315400|gb|EFE55853.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 493

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 95/352 (26%), Positives = 157/352 (44%), Gaps = 18/352 (5%)

Query: 4   LISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVD 63
           +I T    EQ ++++ M         ++ +  FPWG  G  LE+ + P +WQ E +  + 
Sbjct: 1   MIDTMSPEEQLINDIGMFT---HDPLSYALYAFPWGEAGTELENANGPRQWQAEALNEIG 57

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
            H  +      P   + A ++G GIGK+   + ++ W + T     ++  AN+E QL+  
Sbjct: 58  EHLRNPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTK 115

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W E++KW  +   + WF     +++ +              +  +      +SE   + 
Sbjct: 116 TWPEIAKWQRLSITKDWFTYTKTAIYSNDPNH----------ANAWRADAVPWSENNTEA 165

Query: 184 FVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
           F G HN    + +  DEAS   D++ +   G  T+ N    WI   N  R  G F + F 
Sbjct: 166 FAGLHNQGKRIILIFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFR 225

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
                WK  QID+RTVEG +    E  I  YG+D D  ++ + G FP      FIP    
Sbjct: 226 KFKHRWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLT 285

Query: 303 EEAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
           + AM R     +  +AP+I+G D A  G D  V+  R+G   + ++  S  +
Sbjct: 286 DAAMKRTVTQAEVSHAPIIIGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTI 337


>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
 gi|212686517|gb|EEB46045.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
          Length = 493

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 96/352 (27%), Positives = 157/352 (44%), Gaps = 18/352 (5%)

Query: 4   LISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVD 63
           +I T    EQ ++++ M         ++ +  FPWG  G  LE+ S P +WQ E +  + 
Sbjct: 1   MIETMSPEEQLINDIGMFT---HDPLSYALYAFPWGEAGTELENASGPRQWQAEALNEIG 57

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
            H  +      P   + A ++G GIGK+   + ++ W + T     ++  AN+E QL+  
Sbjct: 58  EHLRNPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTK 115

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W E++KW  +   + WF     +++ +              +  +      +SE   + 
Sbjct: 116 TWPEIAKWQRLSITKDWFTCTKTAIYSNDPNH----------ANAWRADAVPWSENNTEA 165

Query: 184 FVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
           F G HN    + +  DEAS   D++ +   G  T+ N    WI   N  R  G F + F 
Sbjct: 166 FAGLHNQGKRIILVFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFR 225

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
                WK  QID+RTVEG +    E  I  YG+D D  ++ + G FP      FIP    
Sbjct: 226 KFKHRWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLT 285

Query: 303 EEAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
           + AM R     +  +AP+I+G D A  G D  V+  R+G   + ++  S  +
Sbjct: 286 DAAMKRTVTQAEVSHAPIILGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTI 337


>gi|215487825|ref|YP_002330256.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265897|emb|CAS10306.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 493

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 88/348 (25%), Positives = 152/348 (43%), Gaps = 18/348 (5%)

Query: 7   TDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHC 66
                EQ + ++   A        + +  FPWG  G  L H + P +WQ +    +  H 
Sbjct: 5   AMSPEEQLVEDI---ASFTYDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHL 61

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
            +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   W 
Sbjct: 62  QNPATRHQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWP 119

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
           E+ KW ++   + WF   + +++ +    +          K +      +SE   + F G
Sbjct: 120 EIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFAG 169

Query: 187 PHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
            HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F    
Sbjct: 170 LHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYK 229

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
             WK  QID+RTVEG +    +  +  YG DSD  ++ + G FP    N FIP    + A
Sbjct: 230 HRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPA 289

Query: 306 MSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           + R        +A +++G D + +G D  V+  R+G   + + +W   
Sbjct: 290 VGRVITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRT 337


>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861389|gb|EFL84326.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
          Length = 500

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 93/337 (27%), Positives = 147/337 (43%), Gaps = 16/337 (4%)

Query: 25  VLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISA 84
                 FV+  FPWG  G   ++   P  WQ E +  +     +  +    ++ + A+S+
Sbjct: 26  AADPLGFVLFAFPWG-GGALADYPDGPDVWQREILRGMGEQLSTGASA--ASVIREAVSS 82

Query: 85  GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQ 144
           G G+GK+ L AW++LW +ST      +  AN+E QLK   WAE++KW  +    +WF+  
Sbjct: 83  GHGVGKSALVAWIILWAMSTFSDTRGVVTANTENQLKGKTWAELAKWHRLCLCGYWFDCT 142

Query: 145 SLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG-MAVFNDEASGT 203
           + +L  +    E          K + +    +SE   + F G HN    + +  DEAS  
Sbjct: 143 ATALISTQAGHE----------KTWRVDMVAWSERNTEAFAGLHNKGRRVLLIFDEASAI 192

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDS 263
           PD I +   G  T+ +    W    N  R  G F + F      W   ++D+RT    D 
Sbjct: 193 PDAIWEVSEGALTDADTEIIWCCFGNPTRNTGRFRECFGRYAHRWNTRRVDSRTAAMTDK 252

Query: 264 GFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY--APLIMG 321
                 +  YG DSD  R+ + G+FP+     FI  + + EA  R    D Y  AP I+G
Sbjct: 253 NQLAQWVEDYGEDSDFVRVRVRGEFPRAGDRQFISSDIVHEARGRSLKPDQYSFAPRILG 312

Query: 322 CDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
            D+A  G D++V+  R+G        +          
Sbjct: 313 VDVARSGSDQSVITRRQGLACLEQRKFRGLDTVTLAG 349


>gi|323156136|gb|EFZ42295.1| terminase large subunit [Escherichia coli EPECa14]
          Length = 491

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 93/350 (26%), Positives = 155/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A+++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPATRYQPLM--LALASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        YAP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAYAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|304398406|ref|ZP_07380280.1| terminase, large subunit [Pantoea sp. aB]
 gi|304354272|gb|EFM18645.1| terminase, large subunit [Pantoea sp. aB]
          Length = 490

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 82/329 (24%), Positives = 144/329 (43%), Gaps = 15/329 (4%)

Query: 26  LSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAG 85
                + +  FPWG +G  L +   P +WQ +  + +  H  +      P +     ++G
Sbjct: 20  HDPFGYALYAFPWGEEGTDLAYSKGPRQWQEDAFKQIGAHLQNPDTRHQPLM--IGRASG 77

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
            GIGK+   + ++ W + T     ++  AN+E QL+   W E++KW  +   + WF   +
Sbjct: 78  HGIGKSAFISMLVKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQRLSITQDWFTCTA 137

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT-HGMAVFNDEASGTP 204
            +++ +              +K +      +SE   + F G HN    + +  DEAS   
Sbjct: 138 TAIYSNDPSH----------AKSWRADAIPWSENNTEAFAGLHNERKRIILIFDEASNIA 187

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG 264
           D++ +   G  T+ N    W+   N  R  G F + F      WK  QID+R+VEG +  
Sbjct: 188 DLVWEVAEGALTDENTEIIWVAFGNPTRNTGRFRECFRKLRHRWKTAQIDSRSVEGTNKE 247

Query: 265 FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIMGC 322
             +  +  YG DSD  ++ + G FP      FIP    + A+ R        +A  ++G 
Sbjct: 248 QIQKWVDDYGEDSDFVKVRVRGLFPSASEAQFIPTGLTDAAVGRVITPGQVAHAATVIGV 307

Query: 323 DIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           D A +GGD  V+  R+G   + + ++   
Sbjct: 308 DPAHQGGDPAVIYLRQGLHTKKLGEYQRT 336


>gi|300898423|ref|ZP_07116764.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300357890|gb|EFJ73760.1| conserved hypothetical protein [Escherichia coli MS 198-1]
          Length = 491

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRKWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|332344357|gb|AEE57691.1| terminase, large subunit [Escherichia coli UMNK88]
          Length = 491

 Score =  276 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 92/349 (26%), Positives = 154/349 (44%), Gaps = 18/349 (5%)

Query: 6   STDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVH 65
           +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  H
Sbjct: 4   AAMSPEEQLVEDI---ASFTYDPLGYALYAFPWGEEGTELAHATGPRKWQADAFREIRDH 60

Query: 66  CHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLW 125
             +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   W
Sbjct: 61  LQNPATRHQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTW 118

Query: 126 AEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFV 185
            E+ KW ++   + WF   + +++ +    +          K +      +SE   + F 
Sbjct: 119 PEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFA 168

Query: 186 GPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
           G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F   
Sbjct: 169 GLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKY 228

Query: 245 LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE 304
              WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +E
Sbjct: 229 KHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDE 288

Query: 305 AMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           AM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 289 AMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|327252187|gb|EGE63859.1| terminase large subunit [Escherichia coli STEC_7v]
          Length = 491

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPATRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|331648179|ref|ZP_08349269.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331043039|gb|EGI15179.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 491

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|298381721|ref|ZP_06991320.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|301019339|ref|ZP_07183525.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|298279163|gb|EFI20677.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|299882256|gb|EFI90467.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|323948690|gb|EGB44595.1| hypothetical protein ERKG_04913 [Escherichia coli H252]
          Length = 491

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|294491573|gb|ADE90329.1| putative phage terminase, large subunit [Escherichia coli IHE3034]
          Length = 491

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|324008564|gb|EGB77783.1| hypothetical protein HMPREF9532_01752 [Escherichia coli MS 57-2]
          Length = 491

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|218700994|ref|YP_002408623.1| putative phage terminase, large subunit [Escherichia coli IAI39]
 gi|218370980|emb|CAR18807.1| putative phage terminase, large subunit [Escherichia coli IAI39]
          Length = 491

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 93/351 (26%), Positives = 156/351 (44%), Gaps = 17/351 (4%)

Query: 4   LISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVD 63
           +  T    E++L + +  A        + +  FPWG +G  L H + P +WQ +    + 
Sbjct: 1   MTDTALSPEEQLIDDI--AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
            H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+  
Sbjct: 59  DHLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W E+ KW ++   + WF   + +++ +    +          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
           F G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
                WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           +EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|117624715|ref|YP_853628.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
 gi|115513839|gb|ABJ01914.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
          Length = 491

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 91/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        ++P+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHSPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|301046412|ref|ZP_07193572.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300301638|gb|EFJ58023.1| conserved hypothetical protein [Escherichia coli MS 185-1]
          Length = 491

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 154/350 (44%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
           ++     EQ + ++   A        + +  FPWG  G  L H + P +WQ +    +  
Sbjct: 3   VAAMSPEEQLVEDI---ASFTYDPLGYALYAFPWGEDGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|89152423|ref|YP_512256.1| putative terminase large subunit [Escherichia phage phiV10]
 gi|74055446|gb|AAZ95895.1| putative terminase large subunit [Escherichia phage phiV10]
          Length = 491

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 91/350 (26%), Positives = 153/350 (43%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG +G  L H + P +WQ +    +  
Sbjct: 3   DTALSPEEQLIEDI---AGFTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPETRYQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG  SD  +I + G FP      FIP    +
Sbjct: 228 YKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEGSDFVKIRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|227355862|ref|ZP_03840255.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
 gi|227164181|gb|EEI49078.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
          Length = 494

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 90/342 (26%), Positives = 147/342 (42%), Gaps = 18/342 (5%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
              EQ + ++   A        +    FPWG  G  LE ++ P +WQ E +  +  H  +
Sbjct: 8   SPEEQLIEDI---ASFTHDPLGYAYYAFPWGEAGGELEEYNGPRQWQAEALNEIGEHLRN 64

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
                 P +   A ++G GIGK+   + ++ W + T     ++  AN+E QL+   W E+
Sbjct: 65  PKTRHQPLL--LARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTWPEI 122

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
           +KW  +    +WF     +++ +              +  +      +SE   + F G H
Sbjct: 123 AKWQRLSLTNNWFTCTKTAIYSNDPNH----------ANAWRADAVPWSENNTEAFAGLH 172

Query: 189 NT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED 247
           N    + +  DEAS   D++ +   G  T+      WI   N  R  G F + F      
Sbjct: 173 NKGKRIILVFDEASNIADLVWEVAEGALTDEGTEIIWIAFGNPTRNTGRFRECFRKFKHR 232

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
           W   QID+RTVEG +    +     YG DSD  ++ + G FP      FIP    +EAM 
Sbjct: 233 WNTKQIDSRTVEGSNKEQIKNWEEDYGEDSDFFKVRVRGVFPSASELQFIPTGLTDEAMK 292

Query: 308 REA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
           R     +  +AP+I+G D A  G D  V+  R+G   + ++ 
Sbjct: 293 RIVTQAEVAHAPVIIGVDPAYSGIDDAVIYLRQGLFSKCLWT 334


>gi|30387381|ref|NP_848210.1| terminase large subunit [Enterobacteria phage epsilon15]
 gi|30266036|gb|AAO06065.1| terminase large subunit [Salmonella phage epsilon15]
          Length = 491

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 91/351 (25%), Positives = 155/351 (44%), Gaps = 17/351 (4%)

Query: 4   LISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVD 63
           + +     E++L E +  A        + +  FPWG  G  L H + P +WQ +    + 
Sbjct: 1   MTAAAISTEEQLVEDI--ASFTYDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIR 58

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
            H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+  
Sbjct: 59  DHLQNPATRHQPLM--LARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W E+ KW ++   + WF   + +++ +    +          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
           F G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
                WK  QID+RTVEG +    +  +  YG +SD  ++ + G FP      FIP    
Sbjct: 227 KYKHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEESDFVKVRVRGIFPDASELQFIPTGLT 286

Query: 303 EEAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           +EAM R        +AP+I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|262043569|ref|ZP_06016682.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039103|gb|EEW40261.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 491

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 91/350 (26%), Positives = 153/350 (43%), Gaps = 18/350 (5%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
            +     EQ + ++   A        + +  FPWG  G  L H + P +WQ +    +  
Sbjct: 3   DAALSPEEQLIDDI---ASFTHDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIRD 59

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  +      P +   A ++G GIGK+   + ++ W +ST     ++  AN++ QL+   
Sbjct: 60  HLQNPATRHQPLM--LARASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLRTKT 117

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           W E+ KW ++   + WF   + +++ +    +          K +      +SE   + F
Sbjct: 118 WPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAF 167

Query: 185 VGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
            G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F  
Sbjct: 168 AGLHNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRK 227

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
               WK  QID+RTVEG +    +  +  YG DSD  ++ + G FP      FIP    +
Sbjct: 228 YKHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLTD 287

Query: 304 EAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           EAM R    +   +AP I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 288 EAMKRVVTAVQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 337


>gi|320175050|gb|EFW50163.1| terminase B protein, putative [Shigella dysenteriae CDC 74-1112]
          Length = 480

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 89/329 (27%), Positives = 147/329 (44%), Gaps = 15/329 (4%)

Query: 26  LSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAG 85
                + +  FPWG +G  L H + P +WQ +    +  H  +      P +   A ++G
Sbjct: 10  HDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLM--LARASG 67

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
            GIGK+   + ++ W +ST     ++  AN++ QL+   W E+ KW ++   + WF   +
Sbjct: 68  HGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTA 127

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT-HGMAVFNDEASGTP 204
            +++ +    +          K +      +SE   + F G HN    + V  DEAS   
Sbjct: 128 TAMYSNDPGHD----------KRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIA 177

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG 264
           D++ +   G  T+ +    W+   N  R  G F + F      WK  QID+RTVEG +  
Sbjct: 178 DLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQ 237

Query: 265 FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA--IDDLYAPLIMGC 322
             +  +  YG DSD  +I + G FP      FIP    +EAM R        +AP+I+G 
Sbjct: 238 QLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGV 297

Query: 323 DIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           D A  G D  V+  R+G   + ++  +  
Sbjct: 298 DPAYSGVDDAVIYLRQGLHSKVLWTGNKT 326


>gi|330007152|ref|ZP_08305894.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
 gi|328535499|gb|EGF61959.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
          Length = 495

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 93/351 (26%), Positives = 154/351 (43%), Gaps = 18/351 (5%)

Query: 4   LISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVD 63
           L   +Q  EQ + ++   A        + +  FPWG  G  L H S P +WQ +    + 
Sbjct: 6   LSPEEQLKEQLIDDI---ASFTHDPLGYALYAFPWGEDGTELAHASGPRQWQADAFREIG 62

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
            H  +      P +   + ++G GIGK+   + ++ W +ST     ++  AN++ QL+  
Sbjct: 63  EHLQNPATRHQPLM--ISRASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLRTK 120

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W E+ KW ++   + WF   + +++ +    +          K +      +SE   + 
Sbjct: 121 TWPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 170

Query: 184 FVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
           F G HN    + V  DEAS   D++ +   G  T+ +    W+   N  R  G F + F 
Sbjct: 171 FAGLHNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 230

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
                WK  QID+RTVEG +    +  +  YG DSD  ++ + G FP      FIP    
Sbjct: 231 KYKHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLT 290

Query: 303 EEAMSREA--IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           +EAM R        +AP I+G D A  G D  V+  R+G   + ++  +  
Sbjct: 291 DEAMKRVVTAAQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKT 341


>gi|282848875|ref|ZP_06258265.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282581380|gb|EFB86773.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 483

 Score =  269 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 92/330 (27%), Positives = 148/330 (44%), Gaps = 15/330 (4%)

Query: 26  LSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAG 85
                FV   +PWG  G PLE+   P  WQ++ ++ +             T  + A+++G
Sbjct: 16  HDPLAFVYFAYPWGEPGTPLENMEGPDEWQIQILKDIGEQLKKG--KDLQTAIQEAVASG 73

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
            GIGK+ L +W++ + IST      +  AN+E QL+   W E+SKW +M   +  F   +
Sbjct: 74  HGIGKSALISWLIHFAISTHENTRGVVTANTEGQLRTKTWPELSKWHNMFIAKDLFTYTA 133

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT-HGMAVFNDEASGTP 204
            ++  S    E          K + I    +S+  P++F G HN  + + V  DEAS   
Sbjct: 134 TAIFSSDKDYE----------KTWRIDAIPWSKNSPESFAGLHNQGNRILVLFDEASAID 183

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG 264
           D+I +   G  T+ N    W    N  R +G F + F    + W  YQID+RTV+  +  
Sbjct: 184 DVIWEVTEGALTDANTEIIWCAFGNPTRNSGRFRECFRKYRKFWNTYQIDSRTVKISNKT 243

Query: 265 FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL--YAPLIMGC 322
             E  +  YG DSD  ++ + G FP      FI     ++A  +        + P+I+G 
Sbjct: 244 KIEEWLEAYGEDSDFFKVRVRGVFPSASDLQFISTEIADKAQKQVYKPGQFEHLPVIIGV 303

Query: 323 DIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
           D A  G D   +V R+G  ++ +       
Sbjct: 304 DPAWTGSDSLEIVMRQGYYMKSLASIPKND 333


>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1]
 gi|166859242|gb|ABY97649.1| putative phage terminase, large subunit [Pseudomonas putida GB-1]
          Length = 499

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 99/336 (29%), Positives = 158/336 (47%), Gaps = 14/336 (4%)

Query: 12  EQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVN 71
           EQEL   +  A        +V+  FPWG  G  L + + P +WQ E +E++     +   
Sbjct: 11  EQELANDI--ASFSDDPLGYVLYAFPWGEAGGELANKTGPRKWQREVLESIGEQLRAGAK 68

Query: 72  NSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKW 131
                + + A+++G GIGK+ L +W++ W + T      +  AN+E+QL+   W EV+KW
Sbjct: 69  -DRGEVIREAVASGHGIGKSALVSWVIKWALDTEVDTRGVVTANTESQLRTKTWPEVAKW 127

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT- 190
             +    HWF++   +L  +    E            + I    +S+   + F G HN  
Sbjct: 128 NRLSITAHWFKLTGTALISTDPDHEKN----------WRIDAVPWSDTNTEAFAGLHNEG 177

Query: 191 HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKR 250
             + +  DEAS   D++ +   G  T+ +    W    N  R +G F + F      W+ 
Sbjct: 178 KRILLIFDEASAIADLVWEVAEGALTDADTEIIWAAFGNPTRNSGRFRECFTKFKHRWRH 237

Query: 251 YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            Q+D+RTV+G +       I+ YG DSD  RI + G FP+      IP +++ EAM R+ 
Sbjct: 238 RQVDSRTVDGTNKTQIAKWIADYGEDSDFVRIRVRGMFPRASDLQLIPTDWVAEAMRRDG 297

Query: 311 IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
           +  L   L+ G DIA  G D  V+ FRRG   + I 
Sbjct: 298 VYGLDDALVCGIDIARGGMDNNVIRFRRGMDAKSIK 333


>gi|290968649|ref|ZP_06560187.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781302|gb|EFD93892.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 487

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 98/349 (28%), Positives = 157/349 (44%), Gaps = 25/349 (7%)

Query: 8   DQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCH 67
            +  + EL + L           FV   F W            P  WQ++ ++ V     
Sbjct: 1   MKNEDIELLQALGS--LASDPVAFVYFAFDW---DSEELKGQNPQTWQIKTLKEVGEGL- 54

Query: 68  SNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAE 127
                S  T  + A ++G GIGK+ L AW++LW ISTRP    +  AN+ TQL+   WAE
Sbjct: 55  -----SLSTALQHATASGHGIGKSALVAWLILWAISTRPDTRGVVTANTATQLETKTWAE 109

Query: 128 VSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
           +SKW  +   + +F + S ++       E          + + I    +S +R ++F G 
Sbjct: 110 LSKWYHLFRGKKFFTLTSTAIFCRQEGHE----------RTWRIDAIPWSVDRTESFAGL 159

Query: 188 HNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE 246
           HN  + + +  DEAS   + I +   G  T+ +    W++  N  R  G F+D F+   +
Sbjct: 160 HNQGNRLLLIFDEASAIDNKIWEVAEGALTDKDTEILWLVFGNPTRSTGRFFDCFHKYKK 219

Query: 247 DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAM 306
            W   +ID+RTV+  +    +  I  YG+DSD  ++ +LG+FP      FI    +  A 
Sbjct: 220 SWITQKIDSRTVDISNKTQLQKWIQTYGIDSDFVKVRVLGEFPDTSDTQFISTAIVRTAW 279

Query: 307 SREAIDDLY---APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
            R  +       AP I+G D A  GGD TV+  R+G   E + ++    
Sbjct: 280 ERRPLRTAEYDFAPCIIGMDPAWTGGDSTVIFLRQGFFSEKLAEYKQND 328


>gi|228911519|ref|ZP_04075310.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
 gi|228848128|gb|EEM92991.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
          Length = 459

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 83/311 (26%), Positives = 138/311 (44%), Gaps = 30/311 (9%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ + +  +                K ++ +G+G+GKT L + +++W +  RP   +
Sbjct: 23  PDEWQRKVLMDLA------------QSPKVSVRSGQGVGKTGLESVVVIWFLCCRPNPKV 70

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           IC A ++ QL   LWAE++KWL     ++  +     ++  G                + 
Sbjct: 71  ICTAPTKEQLFTVLWAEIAKWLEGSAVKNLLKWTKTRVYMIGSEER------------WF 118

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
            T RT ++  P+   G H    M    DEASG  D I ++ILG  +      F     N 
Sbjct: 119 ATARTATK--PENMQGFH-EDYMLFVCDEASGIADPIMEAILGTLSGAENKLFLC--GNP 173

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
            R +G FYD  N   + +K +++ +           E +  +YG  SDV R+ +LG+FP+
Sbjct: 174 TRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPK 233

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
            E + FIP   +E+A S +        L +G D+A  G D+TV+  R GN +  + +   
Sbjct: 234 AEADAFIPLEIVEQAASCKVEPT-GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYK 292

Query: 351 KLIQETNQEGC 361
           +   ET     
Sbjct: 293 QDTMETAGHVL 303


>gi|228968731|ref|ZP_04129698.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228790961|gb|EEM38595.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 459

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 83/311 (26%), Positives = 138/311 (44%), Gaps = 30/311 (9%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ + +  +                K ++ +G+G+GKT L + +++W +  RP   +
Sbjct: 23  PDEWQRKVLMDLA------------QSPKVSVRSGQGVGKTGLESVVVIWFLCCRPNPKV 70

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           IC A ++ QL   LWAE++KWL     ++  +     ++  G                + 
Sbjct: 71  ICTAPTKEQLFTVLWAEIAKWLEGSAVKNLLKWTKTRVYMIGSEER------------WF 118

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
            T RT ++  P+   G H    M    DEASG  D I ++ILG  +      F     N 
Sbjct: 119 ATARTATK--PENMQGFH-EDYMLFVCDEASGIADPIMEAILGTLSGAENKLFLC--GNP 173

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
            R +G FYD  N   + +K +++ +           E +  +YG  SDV R+ +LG+FP+
Sbjct: 174 TRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPK 233

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
            E + FIP   +E+A S +        L +G D+A  G D+TV+  R GN +  + +   
Sbjct: 234 AEADAFIPLEIVEQAASCKVEPT-GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYK 292

Query: 351 KLIQETNQEGC 361
           +   ET     
Sbjct: 293 QDTMETAGHVL 303


>gi|332981151|ref|YP_004462592.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
 gi|332698829|gb|AEE95770.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
          Length = 461

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/310 (28%), Positives = 140/310 (45%), Gaps = 32/310 (10%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P  WQ E ++A+  +             + A+ +G G+GKT L AW +LW + TRP   
Sbjct: 26  EPDDWQAETLQALADN------------PRVAVRSGHGVGKTALEAWALLWFLFTRPYPK 73

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           I C A +  QL + LWAE SKWL   P  + +FE Q   +    +               
Sbjct: 74  IPCTAPTREQLHDILWAEASKWLERAPALKPYFEWQKTRIVQKQY------------PGR 121

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
           +  T RT    +P+   G H  H +    DEASG  D I ++I G  T  +         
Sbjct: 122 WFATARTS--NKPENMAGFHEEH-LLFIIDEASGIADNIFETIEGALTTSDAKLLMC--G 176

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           N  + +G F+D F      +   ++     + +   + E +  +Y  DSDV R+ +LG+F
Sbjct: 177 NPTKNSGVFHDAFFKDRSLYWTRKVSCLDSQRVTLEYAERLKRKYHEDSDVYRVRVLGEF 236

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
           P+ E + FI  + +E A  R+   D    L +G D+A  G D+TV+  R G  + ++  +
Sbjct: 237 PKAEPDTFISLDIVEAATMRDVEPD--GVLEIGVDVARFGDDETVLAARAGLKLVYLKAY 294

Query: 349 SAKLIQETNQ 358
           + +    T  
Sbjct: 295 TKQDTMTTAG 304


>gi|150390341|ref|YP_001320390.1| hypothetical protein Amet_2579 [Alkaliphilus metalliredigens QYMF]
 gi|149950203|gb|ABR48731.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 469

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/324 (27%), Positives = 135/324 (41%), Gaps = 32/324 (9%)

Query: 38  WGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWM 97
           W  +     +   P  WQ + +  +  H             K ++ +G+G+GKT L +  
Sbjct: 18  WFAEDMLGFY---PDPWQAKVLMDLAQH------------PKVSVRSGQGVGKTGLESIA 62

Query: 98  MLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAEL 157
           + W + TRP   +I  A +  QL + LWAE+SKWLS              ++ +G+    
Sbjct: 63  ITWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLSKSKVDKLLRWTKTKIYMNGFEER- 121

Query: 158 LEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTE 217
                      +  T RT    RP+   G H    M    DEASG  D I ++ILG  T 
Sbjct: 122 -----------WWATARTA--VRPENMQGFH-EDYMLFVVDEASGVADPIMEAILGTLTG 167

Query: 218 LNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDS 277
                      N  + +G FYD  N   + +K +++ +           E +  +YG DS
Sbjct: 168 YENKLLLC--GNPTKTSGTFYDSHNRDRDTYKSHKVSSMDSPRTSKENIEMLKKKYGADS 225

Query: 278 DVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFR 337
           DV R+ +LG FP+ E ++ I     E+A            L +G DIA  G DKT++  R
Sbjct: 226 DVFRVRVLGDFPKGEADSLISLEVTEQAAETVVDISNAYTLNIGADIARFGDDKTIIAPR 285

Query: 338 RGNIIEHIFDWSAKLIQETNQEGC 361
            GN +  +  +S K   ET     
Sbjct: 286 IGNRVLDLQQYSKKDTMETAGNIL 309


>gi|282598712|ref|YP_003358792.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300860603|ref|ZP_07106690.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307292389|ref|ZP_07572245.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|258598082|gb|ACV83339.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300849642|gb|EFK77392.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306496518|gb|EFM66079.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|315146097|gb|EFT90113.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
          Length = 484

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 141/314 (44%), Gaps = 32/314 (10%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ + ++ +                K ++ +G+G+GKT L A  +LW ++ RP   +
Sbjct: 34  PDEWQDKVLDDLAKF------------PKVSVRSGQGVGKTALEAGAILWFLTCRPYAKV 81

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           I  A +  QL + LWAEV+KWL+    +   +     ++  G            DS+ + 
Sbjct: 82  IATAPTMKQLYDVLWAEVAKWLNNSLIKDLLKWTKTKIYMVG------------DSERWF 129

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
            T RT ++  P+   G H  H M +  DEASG  D I ++ILG  +  +         N 
Sbjct: 130 ATARTATK--PENMQGFHEDH-MLIVVDEASGVADPIMEAILGTLSGFDNKLLMC--GNP 184

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
             + G FYD  N   + ++ +++ +   +  +    + +I +YG +SDVAR+ I G+FP+
Sbjct: 185 NNIEGVFYDSHNTDRDKYRTHKVSSYDSKRTNKENIQMLIDKYGENSDVARVRIYGEFPK 244

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPL---IMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +++FI    +E A      D     +    +G D+A  G D T+V  R G        
Sbjct: 245 GALDSFISLEIVEFAKDINISDSELKHVREGHIGVDVARFGDDSTIVFPRIGAKALPFEK 304

Query: 348 WSAKLIQETNQEGC 361
           +S +   +T     
Sbjct: 305 YSKQDTMQTTGRVL 318


>gi|228950291|ref|ZP_04112468.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228809453|gb|EEM55897.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 495

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 85/374 (22%), Positives = 146/374 (39%), Gaps = 60/374 (16%)

Query: 5   ISTDQKLEQELHEMLMHAEC---VLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEA 61
           +S D   E+E+ + ++       V     FV                 +P  WQ E +  
Sbjct: 3   VSNDVTTEEEVLQDIITQLLEIYVDDPVAFVEDILE-----------VEPDPWQKEVLND 51

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +  H H             ++ +G+G+GKT + +W+ +W +  RP   IIC A ++ QL 
Sbjct: 52  IANHSH------------VSVRSGQGVGKTAMESWICIWFLCCRPYPKIICTAPTKQQLY 99

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
           + LWAE++KWL+    +   +     ++  G+                       +  RP
Sbjct: 100 DVLWAEIAKWLNSSQVKDLLKWTKTKIYMKGFEDRW--------------FATAKTATRP 145

Query: 182 DTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
           +   G H    M    DEASG  D I ++ILG  +      F     N  + +G F+D  
Sbjct: 146 ENMQGFH-EDYMLFIADEASGIADDIMEAILGTLSGSENKLFMC--GNPTKTSGVFFDSH 202

Query: 242 NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
           N     +K +++ +           E +  +YG  SDV R+ + G+FP+ E + FI    
Sbjct: 203 NKDRALYKSHKVSSADSPRTSKKNIEMLKKKYGEGSDVYRVRVEGEFPRGEADAFISLET 262

Query: 302 IEEAMSREA----------------IDDLYAPLI-MGCDIAGEGGDKTVVVFRRGNIIEH 344
            E A  RE                        ++ +GCD+A  G D+T++  RRG  +  
Sbjct: 263 AEAARMREVYKVEVIENEEEESTVKEIIPDTAVVEIGCDVARFGSDETIIATRRGWKVLP 322

Query: 345 IFDWSAKLIQETNQ 358
           +     +     + 
Sbjct: 323 LQVHHQRDTMYVSG 336


>gi|150016512|ref|YP_001308766.1| hypothetical protein Cbei_1636 [Clostridium beijerinckii NCIMB
           8052]
 gi|149902977|gb|ABR33810.1| conserved hypothetical protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 470

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 85/325 (26%), Positives = 137/325 (42%), Gaps = 33/325 (10%)

Query: 38  WGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWM 97
           W  +     H     +WQ E + A+                K ++ +G+G+GKT L + +
Sbjct: 18  WFAEDMMNFHA---DKWQSEVLMALA------------QSPKVSVRSGQGVGKTGLESIV 62

Query: 98  MLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAEL 157
           + W + TRP   +I  A +  QL + LWAE+SKWL+     +  E     ++  G+    
Sbjct: 63  VTWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLASSKIENLLEWTKTKIYMKGYSER- 121

Query: 158 LEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTE 217
                      +  T +T +  RP+   G H    M    DEASG  D I ++ILG  T 
Sbjct: 122 -----------WWATAKTAT--RPENMQGFH-EDYMLFVVDEASGVADPIMEAILGTLTG 167

Query: 218 LNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDS 277
                      N  R +G FYD  N   + +K +++ +           E +  +Y   S
Sbjct: 168 YENKLLMC--GNPTRTSGTFYDSHNRDRDLYKTFKVSSLESPRTSKDNIEMLKRKYHEGS 225

Query: 278 DVARIEILGQFPQQEVNNFIPHNYIEEAMSREA-IDDLYAPLIMGCDIAGEGGDKTVVVF 336
           DV R+ + G+FP+ E ++ I   Y E A   +         L +G DIA  G D++V+  
Sbjct: 226 DVWRVRVEGEFPKGESDSLISLEYAETATITKINNIHNNFTLHIGADIARFGNDESVIAP 285

Query: 337 RRGNIIEHIFDWSAKLIQETNQEGC 361
           R GN +  +  ++ K   ET     
Sbjct: 286 RIGNKVFDLLTYTKKDTMETTGNIL 310


>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 255

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 194/255 (76%), Positives = 224/255 (87%)

Query: 88  IGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLS 147
           IGKTTLNAW++LWL+S RPGMSIIC+ANSETQLK TLWAEVSKWLS+LP++HWFEMQSLS
Sbjct: 1   IGKTTLNAWLVLWLMSIRPGMSIICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 60

Query: 148 LHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDII 207
           LHP+ WY+++L  S+GIDSKHY+  CRTYSEERPDTFVG HNT+GMA+ NDEASGTPD+I
Sbjct: 61  LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 120

Query: 208 NKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHE 267
           N  ILGF TE N NRFWIMTSN RRL+G FY+IFN PL+DWKR+QIDTRTVEGID  FHE
Sbjct: 121 NLGILGFLTEQNANRFWIMTSNPRRLSGKFYEIFNRPLDDWKRFQIDTRTVEGIDPSFHE 180

Query: 268 GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE 327
           GII+RYGLDSDV R+E+ GQFPQQ++++FIP N IEEA++RE   D YAPLIMGCDIA E
Sbjct: 181 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 240

Query: 328 GGDKTVVVFRRGNII 342
           GGD TVVV RRG +I
Sbjct: 241 GGDNTVVVLRRGPVI 255


>gi|332976102|gb|EGK12970.1| hypothetical protein HMPREF9374_1123 [Desmospora sp. 8437]
          Length = 462

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 83/314 (26%), Positives = 134/314 (42%), Gaps = 31/314 (9%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P  WQ   ++A+  +             + A+ AG G+GKT   AW +LW + TRP   
Sbjct: 32  EPDEWQDIALQALADNQ------------RVAVRAGHGVGKTATEAWAVLWFLLTRPFPK 79

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           I C A ++ QL + LW E++KWL   P    + E Q   +    +               
Sbjct: 80  IPCTAPTKPQLMDVLWPEIAKWLMNAPELAPYVEWQKTRVVMKQYEERW----------- 128

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                   +  +P+   G H  H +    DEASG  + I ++I G  T            
Sbjct: 129 ---FATARTSNKPENMAGFHEEH-LLFVIDEASGVDNAIFETIDGALTTAGSKLVM--FG 182

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           N  R NG FYD F+   + +  Y+I     +     +   +  +YG DSD+ R+ + G+F
Sbjct: 183 NPTRTNGVFYDAFHQDRDLYWTYKISCLDSKMASKDYARNMARKYGEDSDIYRVRVQGEF 242

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
           PQ + ++FIP   +E+A  R+        L +G D+A  G D+TV+  R G +   +  +
Sbjct: 243 PQGDPDSFIPLELVEDARVRDLEWIDEDELHIGVDVARFGSDETVLAARIGPVAFRLDRY 302

Query: 349 SAKL-IQETNQEGC 361
             +    ET     
Sbjct: 303 GGRTPTTETVGRVL 316


>gi|209901239|ref|YP_002290878.1| putative terminase B [Clostridium phage phiCD27]
 gi|199612120|gb|ACH91293.1| putative terminase B [Clostridium phage phiCD27]
          Length = 469

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 82/316 (25%), Positives = 135/316 (42%), Gaps = 17/316 (5%)

Query: 46  EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTR 105
            ++  P  +  + +        S+V  +     K +I +G+G+GKT L +   +W +STR
Sbjct: 11  CYWDNPVWFAEDMLNFKADKWQSDVLMALAQTPKVSIRSGQGVGKTGLESIATVWYLSTR 70

Query: 106 PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGID 165
           P   ++  A +  QL + LWAE++KWLS        E     ++  G+            
Sbjct: 71  PFPKVVATAPTRQQLYDVLWAEIAKWLSNSKVEKLLEWTKTKVYMKGFEER--------- 121

Query: 166 SKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWI 225
              +  T RT    +P+   G H    M    DEASG  D I ++ILG  +         
Sbjct: 122 ---WWATARTA--VKPENMQGFH-EDYMLFVVDEASGVADPIMEAILGTLSGAENKLLLC 175

Query: 226 MTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
              N  R +G FYD  N   + +K +++ +           E +  +Y   SD  R+ +L
Sbjct: 176 --GNPTRTSGTFYDSHNRDRDLYKTFKVSSLDSPRTSKDNIEMLKRKYHEGSDPWRVRVL 233

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHI 345
           G+FP+ E ++ I    +E +  RE        L +G DIA  G D+T++  R G  +  +
Sbjct: 234 GEFPKGESDSLISLEAVETSTIREVNISNDYILNIGADIARYGDDETIIAPRIGGKVFDL 293

Query: 346 FDWSAKLIQETNQEGC 361
             +S K   ET     
Sbjct: 294 LTYSKKDTMETVGNIL 309


>gi|54302246|ref|YP_132239.1| terminase large subunit [Photobacterium profundum SS9]
 gi|46915667|emb|CAG22439.1| hypothetical protein PBPRB0566 [Photobacterium profundum SS9]
          Length = 513

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 93/331 (28%), Positives = 142/331 (42%), Gaps = 25/331 (7%)

Query: 25  VLSFKNFVMRFFPW------GIKGKPLEHFS------QPHRWQLEFMEAVDVHCHSN--V 70
                 FVM  +PW       I   P    S       P  W  E  + +      N   
Sbjct: 21  YDDPLGFVMYAYPWDTDPDLQIVKLPEPWASKYDSVYGPDAWFCEMCDQLQEVIRKNDFN 80

Query: 71  NNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK 130
                  F  +IS+G GIGK+  ++W++ +++STRP    +  +N+  QL+   W E+ K
Sbjct: 81  GVDPVDAFLYSISSGHGIGKSCASSWLIHFVMSTRPNSKGVVTSNTSEQLRTKTWGELGK 140

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
           W   L ++HWF   +   + + ++ +         ++ + +  +T  EE  ++F G H  
Sbjct: 141 WTKKLINKHWFVYNNGKGNMNFYHKDY--------AETWRVDAQTCREENSESFAGLHCA 192

Query: 191 HGM-AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWK 249
                   DEAS  PD I +   G  T+     FW +  N  R +G F + +    + W 
Sbjct: 193 SSTPWYLFDEASAVPDKIWEVAEGGLTDG--EPFWFVFGNPTRNSGRFRECWRRFRQRWN 250

Query: 250 RYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSRE 309
           R QID+ TV+  +        S YG DSD  R+ + G FP    N  I    +E AMSR 
Sbjct: 251 RKQIDSSTVQVTNKKKISEWESDYGEDSDFYRVRVKGVFPSASSNQKISGALLEAAMSRT 310

Query: 310 AIDDLYAPLIMGCDIAGEGGDKTVVVFRRGN 340
           A     +P +M  D+A  GGD  V  FR G 
Sbjct: 311 AHVIPGSPRVMSLDVARGGGDNCVFRFRHGL 341


>gi|261208032|ref|ZP_05922709.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289567088|ref|ZP_06447483.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260077749|gb|EEW65463.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161103|gb|EFD09008.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 471

 Score =  232 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 81/311 (26%), Positives = 140/311 (45%), Gaps = 32/311 (10%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   +  +                K ++ +G+G+GKT L A  +LW ++ RP   +
Sbjct: 34  PDEWQENVLNDLAEFS------------KVSVRSGQGVGKTALEAGAILWFLTCRPYAKV 81

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           I  A +  QL + LWAEV+KWL+    ++  +     ++  G            DS+ + 
Sbjct: 82  IATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG------------DSERWF 129

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
            T RT ++  P+   G H  H M +  DEASG  D I ++ILG  +  +         N 
Sbjct: 130 ATARTATK--PENMQGFHEDH-MLIVVDEASGVSDPIMEAILGTLSGFDNKLLMC--GNP 184

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
             + G FYD  N   + ++ +++ +   +  +    E I+ +YG +SDVAR+ I G+FP+
Sbjct: 185 NNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKKYGKESDVARVRIFGEFPK 244

Query: 291 QEVNNFIPHNYIEEAMSREAI---DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +++FI    +E A  ++      +      +G D+A  G D T++  R          
Sbjct: 245 GALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGDDSTILFPRIATRALEYEK 304

Query: 348 WSAKLIQETNQ 358
           +S +   ET  
Sbjct: 305 YSKRSTMETTG 315


>gi|257883493|ref|ZP_05663146.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294614775|ref|ZP_06694675.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|294622490|ref|ZP_06701512.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|257819151|gb|EEV46479.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291592387|gb|EFF23996.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|291598037|gb|EFF29147.1| conserved hypothetical protein [Enterococcus faecium U0317]
          Length = 471

 Score =  232 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 81/311 (26%), Positives = 140/311 (45%), Gaps = 32/311 (10%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   +  +                K ++ +G+G+GKT L A  +LW ++ RP   +
Sbjct: 34  PDEWQENVLNDLAEFS------------KVSVRSGQGVGKTALEAGAILWFLTCRPYAKV 81

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           I  A +  QL + LWAEV+KWL+    ++  +     ++  G            DS+ + 
Sbjct: 82  IATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG------------DSERWF 129

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
            T RT ++  P+   G H  H M +  DEASG  D I ++ILG  +  +         N 
Sbjct: 130 ATARTATK--PENMQGFHEDH-MLIVVDEASGVSDPIMEAILGTLSGFDNKLLMC--GNP 184

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
             + G FYD  N   + ++ +++ +   +  +    E I+ +YG +SDVAR+ I G+FP+
Sbjct: 185 NNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKKYGKESDVARVRIFGEFPK 244

Query: 291 QEVNNFIPHNYIEEAMSREAI---DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +++FI    +E A  ++      +      +G D+A  G D T++  R          
Sbjct: 245 GALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGDDSTILFPRIATRALEYEK 304

Query: 348 WSAKLIQETNQ 358
           +S +   ET  
Sbjct: 305 YSKRSTMETTG 315


>gi|153810665|ref|ZP_01963333.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
 gi|149833061|gb|EDM88143.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
          Length = 469

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 88/321 (27%), Positives = 145/321 (45%), Gaps = 17/321 (5%)

Query: 45  LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST 104
           L + + P  +  + ++A        +  S       ++ +G GIGK+ + AW ++W + T
Sbjct: 8   LYYANHPVEFVQDILKADPDPEQKKILRSLVENQMTSVRSGHGIGKSAVEAWSVIWFMCT 67

Query: 105 RPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGI 164
            P   I C A ++ QL + LWAE+SKW           + S  +          +  M  
Sbjct: 68  HPYPKIPCTAPTQHQLFDILWAEISKWKRNNK-----TLDSELIWTK------EKLYMKG 116

Query: 165 DSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFW 224
            ++ +    RT S   PD   G H  H M    DEASG  D I + +LG  +        
Sbjct: 117 HAEEWFAVARTAS--TPDALQGFHAEH-MLYIIDEASGVEDKIFEPVLGALSTPGAKLLM 173

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
               N  +L+G+FYD  N   E +  + ID R    +   F + II+ YG DSDV R+ +
Sbjct: 174 C--GNPTQLSGFFYDSHNKNREQYSTFHIDGRNSTRVSQEFVQTIINMYGEDSDVFRVRV 231

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI-MGCDIAGEGGDKTVVVFRRGNIIE 343
            G FP  E + +IP   +E++++ E     +  +I +GCD+A  G DKTV+ +R    ++
Sbjct: 232 AGDFPLAEDDIYIPLPLVEKSIATEYFPRRHPQIIHIGCDVARFGTDKTVIGYRTDEKVQ 291

Query: 344 HIFDWSAKLIQETNQEGCPVG 364
                  +   +T  +   +G
Sbjct: 292 FFKKRVGQDTMKTADDIVSLG 312


>gi|255282256|ref|ZP_05346811.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267204|gb|EET60409.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 506

 Score =  225 bits (574), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 79/355 (22%), Positives = 143/355 (40%), Gaps = 38/355 (10%)

Query: 12  EQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFS----QPHRWQLEFMEAVDVHCH 67
           E+   +  +    +   + F     P   K   L        +P  WQ + +  +     
Sbjct: 8   EEMQMDKELPPNRIRR-RKFFRERIPRYRKDPVLYAREVLQFEPDEWQRDALMDLAEES- 65

Query: 68  SNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAE 127
                      + A+ +G+G+GKT + A  +LW +S      ++  A +  QL + LW+E
Sbjct: 66  -----------RVAVKSGQGVGKTGIEAVAVLWFLSCFRYARVVATAPTRQQLHDVLWSE 114

Query: 128 VSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
           ++KW    P  +         ++  G+             K +    RT ++  P+   G
Sbjct: 115 IAKWQERSPLLKAILRWTKTYVYVKGYE------------KRWFAVARTATK--PENMQG 160

Query: 187 PHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE 246
            H  + M    DEASG  D I +++LG  +  N         N  R  G FYD F     
Sbjct: 161 FHEDN-MLFIVDEASGVADPIMEAVLGTLSGGNNKLLMC--GNPTRTTGTFYDAFTKDRS 217

Query: 247 DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAM 306
            +  + + +      D    + +I +YG DS++ R+ + G FP+Q+ + FI    I++  
Sbjct: 218 IFACHTVSSLDSSRTDKNNIDALIRKYGEDSNLVRVRVKGLFPKQDDDVFISQELIDQCT 277

Query: 307 SREAIDDLY---APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
           SR+         A +I+G D+A  G D+TV+       I+ + +   + +  T  
Sbjct: 278 SRQYELPESRGMAQVILGVDVARYGNDETVIYRNFKGRIKMVRNRRGQNLMATAG 332


>gi|319956916|ref|YP_004168179.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
 gi|319419320|gb|ADV46430.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
          Length = 462

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 86/303 (28%), Positives = 138/303 (45%), Gaps = 28/303 (9%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P + Q++ + A+D               K +I +G G GKTTL AW++LW    R    I
Sbjct: 28  PTKQQMKAIRAIDQGKK-----------KISIRSGHGTGKTTLLAWIVLWWGLGREDAKI 76

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
              A +  QL + L  E+ KW   +P ++  E++             ++      +    
Sbjct: 77  PMTAPTGHQLYDLLMPEIRKWREKMPVQYQNEVE-------------VKTEKIDFANGNF 123

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
              RT  +++P+   G H T+ +A   DEASG P +I +   G  T    +   IM +N 
Sbjct: 124 AVPRTARKDQPEALQGFHATN-LAFIIDEASGIPQVIFEVAEGAMT--GESTLVIMAANP 180

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
            R  G+FYD  +     W+ +Q +    E +   + E    +YG DSDV R+ I G+FP+
Sbjct: 181 TRTEGYFYDSHHKNRWQWECFQFNAEESENVSKEWIEEKKRQYGEDSDVYRVRIKGEFPR 240

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           Q  N       +++A +RE +DD  A  + G D+A  G DK+V+  R+G     I   S 
Sbjct: 241 QSSNAVFSLQEVDDATTREIVDDSGAE-VWGLDVADFGDDKSVLAKRKGKHFHEITARSG 299

Query: 351 KLI 353
             +
Sbjct: 300 LTL 302


>gi|323486060|ref|ZP_08091391.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
 gi|323400627|gb|EGA92994.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
          Length = 476

 Score =  222 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 82/312 (26%), Positives = 137/312 (43%), Gaps = 31/312 (9%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P  WQ + +  +                K AI +G+G+GKT + A  +LW +   P   
Sbjct: 35  EPDDWQKQALMDLAE------------SPKVAIKSGQGVGKTGMEAVALLWFLCCYPYPR 82

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           I+  A ++ QL + LW+EVSKW+S  P      +     ++  G              K 
Sbjct: 83  IVATAPTKQQLHDVLWSEVSKWMSKSPLLSDILKWTKTYIYMVGNE------------KR 130

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
           +    RT ++  P+   G H  + M    DEASG  D I ++ILG  +  N         
Sbjct: 131 WFAVARTATK--PENMQGFHEDN-MLFIVDEASGVADPIMEAILGTLSGANNKLLMC--G 185

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           N  R +G FYD FN+    ++ + + +   +  +    E +I +YG DS+V  + + G+F
Sbjct: 186 NPTRTSGTFYDAFNVDRSIYRCHTVSSADSKRTNKQNIESLIRKYGKDSNVVLVRVFGEF 245

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDD-LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
           P+QE + FI  + +E     +  DD     +  G D+A  G D+TV+    G  I     
Sbjct: 246 PKQEDDVFIALSIVEHCCMLDLPDDVPIKRISFGVDVARYGSDETVIAKNVGGRITLPVS 305

Query: 348 WSAKLIQETNQE 359
           +  + +  T  +
Sbjct: 306 FRGQSLMTTVGK 317


>gi|160940775|ref|ZP_02088117.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436295|gb|EDP14062.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
          Length = 484

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 78/296 (26%), Positives = 125/296 (42%), Gaps = 19/296 (6%)

Query: 42  GKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWL 101
              L +   P  +  + + A       ++  S       ++ +G GIGK+ + AW ++W 
Sbjct: 5   DAVLFYADNPIYFVEDVIRAKPDEKQRDILRSLRDYPMTSVRSGHGIGKSAVEAWSVIWY 64

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQ 160
           + TRP   I C A +E QL + LWAE+SKW+   P  R         L+  G   E    
Sbjct: 65  MCTRPFPKIPCTAPTEHQLMDVLWAEISKWMRNNPALRDDLIWTKEKLYMQGHPEEW--- 121

Query: 161 SMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
                           +   P+   G H  H +    DEASG  D + + +LG  T  + 
Sbjct: 122 -----------FAVPRTATNPEALQGFHAEH-VLYIIDEASGVSDKVFEPVLGAMTGEDA 169

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
                   N  RL G+FYD  +   E +    +D R  + +   F + II  +G DSDV 
Sbjct: 170 KLLM--MGNPTRLAGFFYDSHHRNREQYSAIHVDGRDSQHVSRTFVQKIIDMFGEDSDVF 227

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
           R+ + GQFP+   ++ I   + EEA + +        + +G D+A  G D + +  
Sbjct: 228 RVRVAGQFPKSTPDSLIAMEWCEEAANLQV-YAPGGQIDIGVDVARYGDDSSALYP 282


>gi|289578588|ref|YP_003477215.1| hypothetical protein Thit_1395 [Thermoanaerobacter italicus Ab9]
 gi|289528301|gb|ADD02653.1| conserved hypothetical protein [Thermoanaerobacter italicus Ab9]
          Length = 460

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 78/352 (22%), Positives = 132/352 (37%), Gaps = 62/352 (17%)

Query: 22  AECVLSFKNFVMRFF---PWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
                    FV       PW                Q E ++AV  H             
Sbjct: 13  DRARNDPVFFVRCVLKGDPWEK--------------QEEILKAVRDH------------K 46

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           + A+ A  G+GKT + AW+ LW + T     +I  A +  Q++N LW E+    +     
Sbjct: 47  RVAVRACHGVGKTKVAAWVALWFLYTHHNSKVITTAPTWHQVENLLWREIHAAHAASRI- 105

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
                            ++L+  + +  +         S ++P+ F G H  H   +  D
Sbjct: 106 -------------PLGGKVLQTQIELGEQW---FALGLSTDKPERFQGFHAEHI-LLIVD 148

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTV 258
           EASG       +  GF T +       +  N  +L+G FY+ F  P   + +  I     
Sbjct: 149 EASGVEQYTFDAAEGFLTSIGAKLL--LIGNPTQLSGEFYNAFRSP--LYHKIHISAFDS 204

Query: 259 EG-----------IDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
                        +   + E    ++G DS +    +LG+FP+Q  +  IP  +IE A  
Sbjct: 205 PNLKAGKIVRPYLVTPEWVEDKRLKWGEDSPLWYSRVLGEFPEQGNDTLIPLAWIEAAQQ 264

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           R  + +   P+ +G D+A  G D TV++ RRG+  E ++    +   E   +
Sbjct: 265 RWHMTEAGEPVEIGADVARYGTDTTVIMLRRGDKAEIVYQLRGQDTMEVTGK 316


>gi|308069786|ref|YP_003871391.1| hypothetical protein PPE_03030 [Paenibacillus polymyxa E681]
 gi|305859065|gb|ADM70853.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 452

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 121/309 (39%), Gaps = 30/309 (9%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   +  +  +             + ++ +G+G+GKT L A   LW +S  P   +
Sbjct: 6   PDDWQASTLMDLANN------------PRVSVRSGQGVGKTGLEAATALWFLSCFPYPKV 53

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           IC A +  QL + LWAE++KW S  P  +   +     ++   +               +
Sbjct: 54  ICTAPTRQQLHDVLWAEINKWQSKSPVLKRILKWTKTKIYMKNYEER------------W 101

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
             T RT ++  P+   G H    M    DEASG  D I ++ILG  +            N
Sbjct: 102 FATARTATK--PENMQGLH-EDYMLFIVDEASGVADPIMEAILGTLSGEFNKILMC--GN 156

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
             + +G FYD  N    D+K  ++               +  +YG  SDV R+ + G+FP
Sbjct: 157 PTKTSGVFYDSHNKDRADYKTRKVSCLDSPRTSKDNIAMLKRKYGEGSDVWRVRVEGEFP 216

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS 349
           +   + FI     E A     ++     L +G D+A  G D+T +    G  I       
Sbjct: 217 RGGSDTFISLEVAEFAAKEVKLEPTGDMLTIGVDVARFGDDETSMFAGIGPRIVGEHHHF 276

Query: 350 AKLIQETNQ 358
            K    T  
Sbjct: 277 KKGTMVTAG 285


>gi|266623290|ref|ZP_06116225.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
 gi|288864932|gb|EFC97230.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
          Length = 484

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 71/296 (23%), Positives = 132/296 (44%), Gaps = 19/296 (6%)

Query: 42  GKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWL 101
              L +  +P  +  + +         ++  S       ++ +G G+GK+ + +W ++W 
Sbjct: 5   DAVLFYADEPIYFVEDIIRVTPDQKQRDILRSLRDYPMTSVRSGHGVGKSAVESWSVIWF 64

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQ 160
           + TRP   I C A ++ QL + LWAE+SKWL   P  ++        ++ +G+  E    
Sbjct: 65  LCTRPFPKIPCTAPTQHQLYDILWAEISKWLRNNPELKNDIIWTQQRVYMNGYPEEW--- 121

Query: 161 SMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
                           +   P+   G H  H +    DEASG  D + + +LG  T  + 
Sbjct: 122 -----------FAVPRTATNPEALQGFHAEH-VLYIIDEASGVSDKVFEPVLGAMTGEDA 169

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
                   N  RL+G+F+D  +    ++    ID R  + ++  F + II+ +G+DSDV 
Sbjct: 170 KLLM--MGNPTRLSGFFFDSHHKSRSEYSAMHIDGRDSQHVNQKFVQKIINMFGMDSDVF 227

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
           R+ + GQFP+   ++ I  ++ E A   +    +   + +G D+A  G D + +  
Sbjct: 228 RVRVAGQFPKSTPDSLIMMDWCEAATQLKPE-TVRNRVDIGVDVARYGDDSSALYP 282


>gi|253578914|ref|ZP_04856185.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849857|gb|EES77816.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 473

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 76/313 (24%), Positives = 136/313 (43%), Gaps = 33/313 (10%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P  WQ +    +  +             K +I +G+G+GKT L A + LW ++  P   
Sbjct: 17  EPDEWQAQAARDLAAN------------PKVSIKSGQGVGKTGLEAAVFLWFVTCFPHPR 64

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           I+  A ++ QL + LW+E+SKW+S         +     ++  G            + K 
Sbjct: 65  IVATAPTKQQLHDVLWSEISKWMSKSELLSILLKWTKTYVYMVG------------EEKR 112

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
           +    RT ++  P+   G H  + M    DEASG  D I ++ILG  +  N         
Sbjct: 113 WFGVARTATK--PENMQGFHEDN-MLFIVDEASGVADPIMEAILGTLSGANNKLLLC--G 167

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           N  + +G FYD        +K + + +      +    + ++ +YG DS+V R+ + G+F
Sbjct: 168 NPTKTSGTFYDSHTRDRALYKCHTVSSMDSTRTNKENIDSLVRKYGWDSNVVRVRVRGEF 227

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAP---LIMGCDIAGEGGDKTVVVFRRGNIIEHI 345
           P QE + FIP + IE+  S+    D       + +G D+A  G D+T++        + +
Sbjct: 228 PNQEDDVFIPLSLIEQCSSKLLELDDADGMQFVSLGVDVARFGDDETIIYRNYHGHCKIV 287

Query: 346 FDWSAKLIQETNQ 358
            +   + +  T  
Sbjct: 288 RNRRGQNLMATVG 300


>gi|167767949|ref|ZP_02440002.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|167710278|gb|EDS20857.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|291560988|emb|CBL39788.1| hypothetical protein CL2_30180 [butyrate-producing bacterium SSC/2]
          Length = 473

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 80/343 (23%), Positives = 132/343 (38%), Gaps = 36/343 (10%)

Query: 20  MHAECVLSFKNFVMRFFPWGIKGKPLEH---FSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M    +  F   V     W            F  P  WQ E   A+  +           
Sbjct: 1   MDDRVLHDFL--VESIPLWQQNPVQFFEEVLFFYPDEWQKEAAFALRDNS---------- 48

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             K  I +G+G+GKT   A  +LW +S      ++  A +  QL + LWAEVSKW S  P
Sbjct: 49  --KVTIKSGQGVGKTGFEAATLLWFLSCFENARVVATAPTLHQLNDVLWAEVSKWQSKSP 106

Query: 137 -HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +   +     +                  + +    RT +   P+   G H  + M  
Sbjct: 107 LLKEILQWTKTKISM------------IGSKERWYAVARTAT--TPENMQGFHEDN-MLF 151

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT 255
             DEASG  D I ++ILG  T  N         N  + +G FYD      + +    +++
Sbjct: 152 IVDEASGVADPIMEAILGTLTGSNNKLLLC--GNPTKASGTFYDSHTSDRKLYYCITVNS 209

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
              +  +    + +I +YG +S+V R+ + G FP+Q+ + ++P   +E ++  E      
Sbjct: 210 AESKRTNKDNIDSLIRKYGEESNVVRVRVKGLFPKQDDDVYMPLEMLEASIILE-EIPPA 268

Query: 316 APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
               +G D+A  G D TV+     N I        + + +T  
Sbjct: 269 DICTLGVDVARFGDDDTVIARNMNNKITLEKIRHGQDLMKTVG 311


>gi|332980681|ref|YP_004462122.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
 gi|332698359|gb|AEE95300.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
          Length = 486

 Score =  205 bits (521), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 72/370 (19%), Positives = 123/370 (33%), Gaps = 75/370 (20%)

Query: 20  MHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTI 77
           +  +       FV+                    W  Q++ + AV  +            
Sbjct: 10  LAQKMQNDPVWFVI-------------EILGTRPWKKQIDIISAVRDN------------ 44

Query: 78  FKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            + A+ +  G GK+ +   ++LW + +     ++  A +  Q++  +W EV         
Sbjct: 45  PRTAVRSCHGAGKSFIAGQVILWFLYSFYPSIVLSTAPTWRQVEKLIWKEVRASYRRSKV 104

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                +            E                    S   PD F G H  +   V  
Sbjct: 105 PLGGNLLPKRPEIQIIQDEWY--------------AVGLSTNEPDRFQGFHEENI-LVVV 149

Query: 198 DEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRT 257
           DEA+G P+ I ++I G  T  +      +  N   + G FY+ F  P   W+   I   T
Sbjct: 150 DEAAGVPEEIFEAIEGVLTSEHARLL--LLGNPTSVGGTFYNAFRTP--GWENISISAFT 205

Query: 258 VEGID-----------------------------SGFHEGIISRYGLDSDVARIEILGQF 288
                                               +      R+G +S   +  +LGQF
Sbjct: 206 TPNFTAFGITEDDIINKTWESKITNSLPNPKLITPAWVADKYRRWGPNSPAYQARVLGQF 265

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
           P +  +  IP  +IE AM+R        P+ +G D+A  G DKTV+  RRG  +  +  +
Sbjct: 266 PSEGEDTLIPLAWIEAAMARWEDTPEGEPIEIGVDVARFGSDKTVIAARRGQKVLPLNVY 325

Query: 349 SAKLIQETNQ 358
           + +   ET  
Sbjct: 326 AKQDTMETVG 335


>gi|83593922|ref|YP_427674.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
 gi|83576836|gb|ABC23387.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
          Length = 505

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/330 (20%), Positives = 119/330 (36%), Gaps = 34/330 (10%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P   Q   + A+            P   K  + AG G+GKTT  A  + W +        
Sbjct: 21  PTAQQAGLLSAIA-----------PAGAKVTVRAGHGVGKTTATAAAIWWHLECFDYSKT 69

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLE-QSMGIDSKHY 169
            C A + +QL+  LW+E+++       R        +L     +A      +     + +
Sbjct: 70  PCTAPTASQLEQILWSELARLRRRADARAQGTGLPAALRLEALFAVSGRAIADRGTPREW 129

Query: 170 TITCRTYSEERPDTFVGPHNTHGMA------------------VFNDEASGTPDIINKSI 211
            +  RT   ++PD   G H +                         +EASG PD + +  
Sbjct: 130 FVVARTARRDQPDALQGFHASDIDLEAGAGPRLSAKSGGAALMFVIEEASGVPDAVFEVA 189

Query: 212 LGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS 271
            G  +        +   N  R  G+F          +   ++       +D G+  G++ 
Sbjct: 190 EGALSSPGARLLMV--GNPTRNTGFFARSHKRDRASFTALRLRCADSPLVDPGYRAGLVR 247

Query: 272 RYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGG 329
           +YG +S+V R+   G FP+Q+ +  I     E A++R             +G D+A  G 
Sbjct: 248 KYGAESNVVRVRADGAFPRQDDDVLIALETAEAALARPLPARMATEDERRLGVDVARFGD 307

Query: 330 DKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           D+TV + R G ++  I   + +        
Sbjct: 308 DRTVFLLRIGPVVGAIEVTAGRDTMAVAGR 337


>gi|48697461|ref|YP_024846.1| Pas60 [Actinoplanes phage phiAsp2]
 gi|47679679|gb|AAT36808.1| Pas60 [Actinoplanes phage phiAsp2]
          Length = 492

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/329 (21%), Positives = 120/329 (36%), Gaps = 32/329 (9%)

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-- 106
             P  W  + ++         + ++ P   + A+    G+GK+   A ++ W  +TR   
Sbjct: 21  DSPTAWAADCLDVRLAGYQGEILDAVPRERRVAVRGPHGLGKSFSGAILVNWFATTRDLM 80

Query: 107 --GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGI 164
                II  A++   L+  LW E+ KW           +  ++L  + +        + +
Sbjct: 81  GKDWKIITTASAWRHLEVYLWPEIHKWAGR--------INFVALGRAPYNPRTELLDLRL 132

Query: 165 DSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELN----P 220
              H   T       +P+   G H    +    DEA   P     SI G F+        
Sbjct: 133 KLTHGAATAVAS--NQPERIEGAHAEE-LLYLLDEAKIVPPATWDSIEGAFSNAGVDVAD 189

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRT---VEGIDSGFHEGIISRYGL 275
           N +    S     +G FYDI       EDW    +          I   + +   S++G 
Sbjct: 190 NAYAFAMSTPGAPSGRFYDIHRRAPGYEDWWTRHVTLEEAIASGRISRAWADQRRSQWGS 249

Query: 276 DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD------LYAPLIMGCDIAGEGG 329
           DS V    +LG+F   + ++ IP  ++E A+ R    D         PL  G D+   GG
Sbjct: 250 DSAVFHNRVLGEFHASDEDSVIPLAWLEAAIERWHEWDRQGRPSPGGPLWTGVDVGR-GG 308

Query: 330 DKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
           D+TV+  R G  +  +     +    T  
Sbjct: 309 DETVLAARDGWAVT-LETNRRRDTMATVG 336


>gi|322656964|gb|EFY53248.1| DNA packaging protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
          Length = 411

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 115/273 (42%), Gaps = 21/273 (7%)

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  +++G G GK++L A ++L  +   P   +I +AN   Q+K  ++  V ++ +    R
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
           H +      L  + +Y    +         + + C+ Y     +   G H  H + +  D
Sbjct: 116 HGWLQTYFVLSDTMFYERSRK-------GIWEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDWKRY 251
           EASG  D     + G  TE +     +M S   R +G+FYD  +        P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDSGFH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++     +   F  + ++   G DS    +++LGQFP++     +  +  + A  R+ 
Sbjct: 226 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRAARRKV 285

Query: 311 IDDLYAPLIMGCDIAGEGGDKTV--VVFRRGNI 341
           + +     +   D+ G G DK+V  +    G+ 
Sbjct: 286 LLEKNWGWVATADV-GNGRDKSVLNICKVSGHR 317


>gi|168467778|ref|ZP_02701615.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|195629119|gb|EDX48493.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
          Length = 494

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/328 (18%), Positives = 117/328 (35%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   C+   +         + W I    +     P  WQ +    +        +     
Sbjct: 1   MARSCITDPRWRELVAQYRYDW-IAAADVMFGKTPT-WQQD---QIIESVQEPGS----- 50

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             K ++S+G G GK+ + + M++  I   PG   I +AN   Q+   ++  +        
Sbjct: 51  --KTSVSSGHGTGKSDMTSIMIMLFIIMFPGARAIIVANKIQQVMTGIFKYLKI------ 102

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGI-DSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     + ++         I     +T+  + +     +   G H  H +  
Sbjct: 103 --NWSTATSRFPWLAEYFVLTDTSFYEITSKGVWTVVPKGFRLGNEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-------W 248
             DEASG  D     + G  T  +      + S   R +G+FYD  +   +        +
Sbjct: 160 IIDEASGVSDKAFGIMTGALTGKDNRIL--LLSQPTRPSGYFYDTHHKLAKRPGNPNGIY 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +   F +  +    G DS +  I++ G FP+ +    +  + +E A  
Sbjct: 218 TAITLNSEESPLVTPEFIKMKLAEYGGRDSPMYLIKVRGLFPKTQDGFLLGRDEVERASR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         I   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWIACVDVAGGTGRDKSVI 305


>gi|56266643|gb|AAV84926.1| DNA pacase B subunit [Enterobacteria phage phiW39]
          Length = 494

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/328 (18%), Positives = 118/328 (35%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ + +          + +    
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQ 48

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             K ++S+G G GK+ + + M++  I   PG   I +AN   Q+   ++  +        
Sbjct: 49  GSKTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI------ 102

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGI-DSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     + ++         I     +T+  + +     +   G H  H +  
Sbjct: 103 --NWATATSRFPWLADYFVLTETAFYEITGKGVWTVVPKGFRLGSEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-------W 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +   +        +
Sbjct: 160 IIDEASGVSDRAFGIITGALTGQDNRIL--LLSQPTRPSGYFYDTHHKLAKRPGNPDGVY 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +   F +  +    G D+ +  I++ G FP+ +    +  + +E A  
Sbjct: 218 TAITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWLACVDVAGGTGRDKSVI 305


>gi|324111095|gb|EGC05081.1| terminase B protein [Escherichia fergusonii B253]
          Length = 494

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/328 (17%), Positives = 117/328 (35%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ + +          + +    
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQ 48

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             K ++S+G G GK+ + + M++  I   PG   I +AN   Q+   ++  +        
Sbjct: 49  GSKTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI------ 102

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMG-IDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     + ++               +T+  + +     +   G H  H +  
Sbjct: 103 --NWATATSRFPWLADYFVLTETAFYEVTGKGVWTVVPKGFRLGSEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-------W 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +   +        +
Sbjct: 160 IIDEASGVSDRAFGIITGALTGQDNRIL--LLSQPTRPSGYFYDTHHKLAKRPGNPDGVY 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +   F +  +    G D+ +  I++ G FP+ +    +  + +E A  
Sbjct: 218 TAITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWLACVDVAGGTGRDKSVI 305


>gi|312964323|ref|ZP_07778627.1| terminase B protein [Escherichia coli 2362-75]
 gi|331655801|ref|ZP_08356790.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
 gi|312291036|gb|EFR18910.1| terminase B protein [Escherichia coli 2362-75]
 gi|323186470|gb|EFZ71817.1| terminase B protein [Escherichia coli 1357]
 gi|323969205|gb|EGB64507.1| terminase B protein [Escherichia coli TA007]
 gi|325495624|gb|EGC93488.1| DNA pacase B subunit [Escherichia fergusonii ECD227]
 gi|331046575|gb|EGI18664.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
          Length = 494

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/328 (17%), Positives = 117/328 (35%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ + +          + +    
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQ 48

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             K ++S+G G GK+ + + M++  I   PG   I +AN   Q+   ++  +        
Sbjct: 49  GSKTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI------ 102

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMG-IDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     + ++               +T+  + +     +   G H  H +  
Sbjct: 103 --NWATATSRFPWLADYFVLTETAFYEVTGKGVWTVVPKGFRLGSEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-------W 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +   +        +
Sbjct: 160 IIDEASGVSDRAFGIITGALTGQDNRIL--LLSQPTRPSGYFYDTHHKLAKRPGNPDGVY 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +   F +  +    G D+ +  I++ G FP+ +    +  + +E A  
Sbjct: 218 TAITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWLACVDVAGGTGRDKSVI 305


>gi|323179619|gb|EFZ65182.1| terminase B protein [Escherichia coli 1180]
          Length = 453

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 115/273 (42%), Gaps = 21/273 (7%)

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  +++G G GK++L A ++L  +   P   +I +AN   Q+K  ++  V ++ +    R
Sbjct: 7   RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 66

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
           H +      L  + +Y    +         + + C+ Y     +   G H  H + +  D
Sbjct: 67  HGWLQTYFVLSDTMFYERSRK-------GIWEVLCKGYRLGNEEALAGEHAAH-LLLILD 118

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDWKRY 251
           EASG  D     + G  TE +     +M S   R +G+FYD  +        P   W   
Sbjct: 119 EASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 176

Query: 252 QIDTRTVEGIDSGFH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++     +   F  + ++   G DS    +++LGQFP++     +  +  + A  R+ 
Sbjct: 177 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRAARRKV 236

Query: 311 IDDLYAPLIMGCDIAGEGGDKTV--VVFRRGNI 341
           + +     +   D+ G G DK+V  +    G+ 
Sbjct: 237 LLEKNWGWVATADV-GNGRDKSVLNICKVSGHR 268


>gi|56266666|gb|AAV84947.1| DNA pacase B subunit [Enterobacteria phage D6]
          Length = 502

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 115/273 (42%), Gaps = 21/273 (7%)

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  +++G G GK++L A ++L  +   P   +I +AN   Q+K  ++  V ++ +    R
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
           H +      L  + +Y    +         + + C+ Y     +   G H  H + +  D
Sbjct: 116 HGWLQTYFVLSDTMFYERSRK-------GIWEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDWKRY 251
           EASG  D     + G  TE +     +M S   R +G+FYD  +        P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDSGFH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++     +   F  + ++   G DS    +++LGQFP++     +  +  + A  R+ 
Sbjct: 226 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRAARRKV 285

Query: 311 IDDLYAPLIMGCDIAGEGGDKTV--VVFRRGNI 341
           + +     +   D+ G G DK+V  +    G+ 
Sbjct: 286 LLEKNWGWVATADV-GNGRDKSVLNICKVSGHR 317


>gi|134287454|ref|YP_001109621.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
 gi|134131876|gb|ABO60570.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
          Length = 509

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 110/300 (36%), Gaps = 22/300 (7%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           ++A   H     ++ +    + ++S+G G GKT+  A + LW +      + I  A   +
Sbjct: 34  LKAPTHHQIQMFDSVSKQGSRTSVSSGHGTGKTSGFAIIALWHLLCYYLSNTILTAPKIS 93

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA-ELLEQSMGIDSKHYTITCRTYS 177
            + + +W E +   + + +               ++  E     +     ++ +  ++  
Sbjct: 94  TVSDGVWKEFADLSTKISNGPQ-------SWIWEYFVIESERVYVRGYKLNWFVIAKSAP 146

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              P+   G H    +    DEASG PD     I G  T+        + S   R +G+F
Sbjct: 147 RGSPENLAGAHRDW-LLWLADEASGIPDDNFGVITGSLTDERNR--MCLASQPTRSSGFF 203

Query: 238 YDIFNIPL----EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           Y+  +         W     ++     + + F      +Y  +    +I++ G+FP+   
Sbjct: 204 YETHHALSRAEGGPWNNLVFNSEFSPIVSAKFIAEKKLQYTEEE--YQIKVQGRFPENSS 261

Query: 294 NNFIPHNYIEEAMSREA-IDDLYAPLIMGCDIAGEG-GDKTVVVFRRGNIIEHIFDWSAK 351
              +    IE  + R     D +   ++  D+ G G  D+TV+       +    ++   
Sbjct: 262 KYLVGPQAIEACVGRTVIKPDEHWGWLLPVDVGGGGWRDETVM---PALHVIGRGEYGMD 318


>gi|262316909|emb|CBA18135.1| putative terminase B [Paenibacillus phage phiBP]
          Length = 248

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 100/239 (41%), Gaps = 30/239 (12%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P +WQ    + +  +               ++ +G+G+GKT L A + LW +   P   +
Sbjct: 39  PDKWQESVSDDIAKY------------RFVSVRSGQGVGKTALEAAISLWFLCCFPFPRV 86

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           +C A +  QL + LWAE+SKW S  P  +   +     ++   +               +
Sbjct: 87  VCTAPTRQQLNDVLWAEISKWQSQSPILKRILKWTKTKIYMKNYEER------------W 134

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
             T RT ++  P+   G H    M    DEASG  D I  +I G  +      F     N
Sbjct: 135 FATARTATK--PENMQGFH-EDYMLFIVDEASGVDDRIMAAIFGTLSGDYNKLFMC--GN 189

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
             + +G+F+D  N     ++ +++             E + ++YG  SDV R+ +LG+F
Sbjct: 190 PTKTSGFFFDSHNRDRAIYRTHRVSCLDSPRTSKENIEMLKAKYGEGSDVWRVRVLGEF 248


>gi|323948959|gb|EGB44853.1| terminase B protein [Escherichia coli H252]
          Length = 502

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 115/273 (42%), Gaps = 21/273 (7%)

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  +++G G GK++L A ++L  +   P   +I +AN   Q+K  ++  V ++ +    R
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
           H +      L  + +Y    +         + + C+ Y     +   G H  H + +  D
Sbjct: 116 HGWLQTYFVLSDTMFYERSRK-------GIWEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDWKRY 251
           EASG  D     + G  TE +     +M S   R +G+FYD  +        P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSRAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDSGFHEG-IISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++     +   F +  ++   G DS    +++LGQFP++     +  +  + +  R+ 
Sbjct: 226 VLNSEESPFVTPQFIKEKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRSARRKV 285

Query: 311 IDDLYAPLIMGCDIAGEGGDKTV--VVFRRGNI 341
           + +     +   D+ G G DK+V  +    G+ 
Sbjct: 286 LLEKNWGWVATADV-GNGRDKSVLNICKVSGHR 317


>gi|269119479|ref|YP_003307656.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
 gi|268613357|gb|ACZ07725.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
          Length = 499

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/313 (18%), Positives = 111/313 (35%), Gaps = 40/313 (12%)

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
            + V  +     + ++ AG   GK++L   +  + + TRP   +I  A +  QLK   WA
Sbjct: 35  QTRVLQAFNEYRRLSVPAGHSTGKSSLAGGLTTYWLITRPKSRVIVTAPTYRQLKTIYWA 94

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLE--------------------------- 159
           EV+K  +    +     +           +L                             
Sbjct: 95  EVNKIYNRSKLKQLNLFEINDKIMRINDKDLKREWFALPVTASTPEGMQGQHGDKTEVIE 154

Query: 160 -------QSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSIL 212
                       D +   I  +    E+    +   +   + V  DE+SG  + I + + 
Sbjct: 155 QIMKHLGIEEIGDDETIEIVSQILRGEKQIEGLTKEDKEKLLVMVDESSGVKNEIFEVLE 214

Query: 213 GFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISR 272
           G  T+ +     ++  N  +  G+FY+    P   + +  + +     +       +   
Sbjct: 215 G--TDYDK---LVLFGNMTKNTGYFYESVYNPKSKFYKVTMSSYNSPFMKKEQIHDLEET 269

Query: 273 YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDK 331
           YG DS+V R+ + G+ P    N+    N I+ A  R      Y  + +G D+  G GGD 
Sbjct: 270 YGPDSNVVRVRLKGEAPDGNENSIFSSNKIDSAFQRSLSLSEYETIKLGVDVGKGSGGDS 329

Query: 332 TVVVFRRGNIIEH 344
           + +  ++ N +  
Sbjct: 330 STIYEKKDNRVRK 342


>gi|260871239|ref|YP_003238019.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
 gi|257767818|dbj|BAI39311.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
          Length = 494

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/328 (18%), Positives = 119/328 (36%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ +    +      + +     
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQD---EIIESTQQDGSW---- 51

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
               ++++G G GK+ + + + +  I   PG  +I +AN   Q+ + ++  +        
Sbjct: 52  ---TSVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK------- 101

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMG-IDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     S ++               +TI  ++      +   G H  H +  
Sbjct: 102 -SNWATAVSRFPWLSKYFILTETSFFEVTGKGVWTILIKSCRSGNEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDW 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +        P   +
Sbjct: 160 IIDEASGVSDKAFSVITGALTGKDNRIL--LLSQPTRPSGYFYDSHHRLAIRPGNPDGLF 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +D+ F    +    G D+ +  I++ G+FP+ +    +  + +E A  
Sbjct: 218 TAIILNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWVACVDVAGGTGRDKSVI 305


>gi|46401730|ref|YP_006576.1| PacB [Enterobacteria phage P1]
 gi|301646767|ref|ZP_07246623.1| putative terminase B protein [Escherichia coli MS 146-1]
 gi|129547|sp|P27753|TERL_BPP1 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|68597607|sp|Q5XLR0|TERL_BPP7 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|33323612|gb|AAQ07582.1|AF503408_106 PacB [Enterobacteria phage P7]
 gi|215636|gb|AAA21724.1| pacB [Enterobacteria phage P1]
 gi|33338757|gb|AAQ14080.1| PacB [Enterobacteria phage P1]
 gi|33338866|gb|AAQ14188.1| PacB [Enterobacteria phage P1]
 gi|54112354|gb|AAV28854.1| PacB [Enterobacteria phage P7]
 gi|301075042|gb|EFK89848.1| putative terminase B protein [Escherichia coli MS 146-1]
          Length = 494

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/328 (18%), Positives = 119/328 (36%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ +    +      + +     
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQD---EIIESTQQDGSW---- 51

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
               ++++G G GK+ + + + +  I   PG  +I +AN   Q+ + ++  +        
Sbjct: 52  ---TSVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK------- 101

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMG-IDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     S ++               +TI  ++      +   G H  H +  
Sbjct: 102 -SNWATAVSRFPWLSKYFILTETSFFEVTGKGVWTILIKSCRPGNEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDW 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +        P   +
Sbjct: 160 IIDEASGVSDKAFSVITGALTGKDNRIL--LLSQPTRPSGYFYDSHHRLAIRPGNPDGLF 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +D+ F    +    G D+ +  I++ G+FP+ +    +  + +E A  
Sbjct: 218 TAIILNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWVACVDVAGGTGRDKSVI 305


>gi|331649955|ref|ZP_08351031.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
 gi|331041212|gb|EGI13366.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
          Length = 494

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/328 (18%), Positives = 119/328 (36%), Gaps = 36/328 (10%)

Query: 20  MHAECVLSFKN---FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPT 76
           M   CV   +      +  + W      L   +    WQ +    +      + +     
Sbjct: 1   MARSCVTDPRWRELVALYRYDWIAAADVLFGKTP--TWQQD---EIIESTQQDGSW---- 51

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
               ++++G G GK+ + + + +  I   PG  +I +AN   Q+ + ++  +        
Sbjct: 52  ---TSVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK------- 101

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMG-IDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +W    S     S ++               +TI  ++      +   G H  H +  
Sbjct: 102 -SNWATAVSRFPWLSKYFILTETSFFEVTGKGVWTILIKSCRPGNEEALAGEHADH-LLY 159

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDW 248
             DEASG  D     I G  T  +      + S   R +G+FYD  +        P   +
Sbjct: 160 IIDEASGVSDKAFSVITGALTGKDNRIL--LLSQPTRPSGYFYDSHHRLAIRPGNPDGLF 217

Query: 249 KRYQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               +++     +D+ F    +    G D+ +  I++ G+FP+ +    +  + +E A  
Sbjct: 218 TAIILNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATR 277

Query: 308 REAIDDLYAPLIMGCDIA-GEGGDKTVV 334
           R+         +   D+A G G DK+V+
Sbjct: 278 RKVKIAKGWGWVACVDVAGGTGRDKSVI 305


>gi|307308936|ref|ZP_07588619.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
 gi|306900570|gb|EFN31183.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 64/276 (23%), Positives = 113/276 (40%), Gaps = 15/276 (5%)

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
             +    G GKT ++A  + W +     + +   A SE+ +K+ +W E+    S +    
Sbjct: 50  ITVKGSSGWGKTFISAISLWWSLIVFDPVKVTIFAPSESTIKSGIWNELQVLYSNMA--- 106

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                   L    +     +       +      R  S++      G H+ +   V  DE
Sbjct: 107 -------PLFRELFEVSATKIFRKSRGETCWAEYRLVSKDNIAAARGFHSKN-NIVIADE 158

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRT 257
           ASG  D+I    L       P    ++ SN  + +G+F+  +  P   +DW +     R 
Sbjct: 159 ASGIEDVIFTGALLNVLNDGPGAKVVLVSNPDKASGFFFKTWRDPELSKDWIKVHGSIRD 218

Query: 258 VEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAM-SREAIDDLY 315
                 G  E     YG   S      + G+FP  +V+  I   +++EA+ +++AI +  
Sbjct: 219 KPNYTPGEEERFARLYGGVTSRDYLTLVEGEFPLSDVDGLISREFLDEAVTNKDAIPNPK 278

Query: 316 APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           AP+I G D AG G DK+V+  R  N++    +W+  
Sbjct: 279 APIIWGLDPAGAGKDKSVLAIRHDNVLRGFEEWAGL 314


>gi|304399103|ref|ZP_07380971.1| DNA packaging protein [Pantoea sp. aB]
 gi|304353343|gb|EFM17722.1| DNA packaging protein [Pantoea sp. aB]
          Length = 503

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 66/318 (20%), Positives = 120/318 (37%), Gaps = 33/318 (10%)

Query: 32  VMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKT 91
           +   + W +    L     P   Q E M +V                   +++G G GK+
Sbjct: 21  IRYRYNWALAVVELFGMI-PTWQQEEIMNSVQETGSQ-----------TTVTSGHGTGKS 68

Query: 92  TLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPS 151
           +L A M+L  +   P   +I +AN   Q+K  ++  V  + +    RH +     +L  +
Sbjct: 69  SLTAMMLLIYMIMYPDARVIIVANKIGQVKTGVFKYVKTYWANAARRHPWLQNYFTLTDT 128

Query: 152 GWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSI 211
            +Y              + + C+ Y     +   G H  H   +  DEASG  D     +
Sbjct: 129 MFYE-------KSRKGIWEVLCKGYRLGNEEALAGEHAAHI-LLILDEASGISDKAIAIM 180

Query: 212 LGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDWKRYQIDTRTVEGIDSG 264
            G  TE +     +M S   R +G+FYD  +        P   W    +++     +   
Sbjct: 181 RGALTEEDNR--MLMMSQPTRPSGYFYDSHHSLARHPDNPNGFWNAIVLNSEEAPHVTLK 238

Query: 265 FH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
           F  E ++   G DS    +++LG+FP+      +  +  + A  R+   +     +   D
Sbjct: 239 FIREKLVEYGGRDSLEYMVKVLGRFPRNVSGYLLGRDECDRAARRKVYLEKGWGWVATAD 298

Query: 324 IAGEGGDKTV--VVFRRG 339
           + G G DK++  +    G
Sbjct: 299 V-GNGRDKSILNICKVSG 315


>gi|332974843|gb|EGK11758.1| hypothetical protein HMPREF9373_1714 [Psychrobacter sp. 1501(2011)]
          Length = 520

 Score =  162 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 54/293 (18%), Positives = 107/293 (36%), Gaps = 26/293 (8%)

Query: 54  WQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113
           WQ E +            +      + ++++G G GK+     + LW +   P   ++  
Sbjct: 42  WQQELL----------FKSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLFT 91

Query: 114 ANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITC 173
           A    QL+  +W E++  L  L +       +  +          +  +      + +  
Sbjct: 92  APQIGQLRTVVWKEINICLQRLRNNKALGWLADYV-----VVLAEKIYIKGFKDTWFVFA 146

Query: 174 RTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRL 233
           +T  + +P    G H  H M V+ DEA G  D + +  +G  T  N     ++TS   + 
Sbjct: 147 KTAPKHQPTNIAGQHGDHYM-VWADEACGIDDAVMEVAIGALTHENNRA--VLTSQPAKN 203

Query: 234 NGWFYDIFNIPLE----DWKRYQIDTRTVEGIDSG-FHEGIISRYGLDSDVARIEILGQF 288
            G+FYD  +         W   + +      +      E +      +S    I I G+F
Sbjct: 204 TGFFYDTHHKLSHYNGGKWIALEFNGEMSPIVSKEKLIEALYQYGSRNSPGYLIRIRGKF 263

Query: 289 PQQEVNNFIPHNYIE--EAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVFRR 338
           P+ +    +     E  +A      +     +I+  D+ G+ G D +V+   +
Sbjct: 264 PELKGEYLLTRTDYENMKAHPCVIKEGDKWGIIVTVDVGGDVGRDSSVISVLQ 316


>gi|148653111|ref|YP_001280204.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
 gi|148572195|gb|ABQ94254.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
          Length = 520

 Score =  162 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/293 (18%), Positives = 106/293 (36%), Gaps = 26/293 (8%)

Query: 54  WQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113
           WQ E +            +      + ++++G G GK+     + LW +   P   ++  
Sbjct: 42  WQQELL----------FKSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLFT 91

Query: 114 ANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITC 173
           A    QL+  +W E++  L  L +       +  +          +  +      + +  
Sbjct: 92  APQIGQLRTVVWKEINICLQRLRNNKALGWLADYV-----VVLAEKIYIKGFKDTWFVFA 146

Query: 174 RTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRL 233
           +T  + +P    G H  H M V+ DEA G  D + +  +G  T  N     ++TS   + 
Sbjct: 147 KTAPKHQPTNIAGQHGDHYM-VWADEACGIDDAVMEVAIGALTHENNRA--VLTSQPAKN 203

Query: 234 NGWFYDIFNIPLED----WKRYQIDTRTVEGIDSG-FHEGIISRYGLDSDVARIEILGQF 288
            G+FYD  +         W   + +      +      E +      +S    I I G+F
Sbjct: 204 TGFFYDTHHKLSHHNGGKWTALEFNGEMSPIVSKDKLIEALYQYGSRNSPGYLIRIRGKF 263

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPL--IMGCDIAGE-GGDKTVVVFRR 338
           P+ +    +     E    +  + +       I+  D+ G+ G D +V+   +
Sbjct: 264 PELKGEYLLTRTDYENMKQQPCVIEEGDKWGIIVAVDVGGDVGRDSSVISVMQ 316


>gi|161789175|ref|YP_001595730.1| PacB [Vibrio sp. 0908]
 gi|161761461|gb|ABX77106.1| PacB [Vibrio sp. 0908]
          Length = 572

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/286 (21%), Positives = 107/286 (37%), Gaps = 25/286 (8%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK-WLS 133
           P   + ++++G G GK+ L A + L  I T P    +  ANS  Q+ N +++ + + W+ 
Sbjct: 58  PVGARVSVASGHGTGKSHLTAALCLHFIITHPESLCMLTANSLDQVTNVVFSYIKRCWVK 117

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
           +   + W E          +               + I  +T S+   +   G H    M
Sbjct: 118 ICQRQPWLE--------QYFVITAKSFYAKGYKGVWQIFGKTCSKGNEEGLAGQHRRDYM 169

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED--WKRY 251
            V  DEASG  D   + + G  TE N     ++ S   R  G F D      E   +   
Sbjct: 170 -VVVDEASGVSDRAFEVLRGALTEDNNK--MLLISQFTRPTGHFADSQMELAEQGLYTAI 226

Query: 252 QIDTRTVEGIDSGFH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++     ++  F  E  I   G+ S    I +LG  P       I  + +++      
Sbjct: 227 TLNSEMSPFVNLKFIREKRIEYGGVTSPEYGIRVLGVCPDDASGFLISRSLVDKGFEAVI 286

Query: 311 IDDLYAPLIMGCDIA-GEGGDKTVVVF---------RRGNIIEHIF 346
                   +   D+A GEG D +V+           R+  +++ I 
Sbjct: 287 EFADEWGWVAVADVAGGEGRDSSVLKIGKVCGFGSERQVEVVKAIE 332


>gi|256392042|ref|YP_003113606.1| hypothetical protein Caci_2856 [Catenulispora acidiphila DSM 44928]
 gi|256358268|gb|ACU71765.1| conserved hypothetical protein [Catenulispora acidiphila DSM 44928]
          Length = 484

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/312 (17%), Positives = 104/312 (33%), Gaps = 37/312 (11%)

Query: 47  HFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP 106
           + + P RW  + +         ++  S       A+ +  G GK+ + + +  W + T P
Sbjct: 24  YLADPARWVDDKLGEYLWSRQVDIATSVRDQRLTAVQSCHGTGKSFVASRLTAWWLDTHP 83

Query: 107 GMS--IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGI 164
                ++  A +  Q+K  LWAE++K  +    R            +     + E     
Sbjct: 84  PGEAFVVTTAPTGDQVKAILWAEINKAFAKAEARG-----------TPLPGRINETDWKY 132

Query: 165 DSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFW 224
           D K      R  S+  P  F G H  + + V  DEA G       + L   T ++     
Sbjct: 133 D-KFLVAFGRKPSDYNPHAFQGIHAKY-VLVILDEACGISKQFWTAALAIATGVHCRIL- 189

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG--------------FHEGII 270
               N       F  +     + W   +I  R                      +   + 
Sbjct: 190 -AIGNPDDPGSHFAQVC--KSDRWNMIKIAARDTPNFTGEEVPDDLADMLVSQAYVLDMA 246

Query: 271 SRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA---PLIMGCDIAGE 327
             +G +S +   ++  +FP    +  +  + +                 P+ +G D+ G 
Sbjct: 247 EEFGPESPIYLSKVDAEFPSDASDGVVRLSKLMACTREPVHPYAPDRLVPVELGVDL-GA 305

Query: 328 GGDKTVVVFRRG 339
           GGD+T +  RRG
Sbjct: 306 GGDETCIRERRG 317


>gi|292670767|ref|ZP_06604193.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292647388|gb|EFF65360.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 442

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/289 (16%), Positives = 92/289 (31%), Gaps = 28/289 (9%)

Query: 79  KCAISAG-RGIGKTTLNAWMMLWLISTRPGM--SIICIANSETQLKNTLWAEVSKWLSML 135
           + A+    R  GKT      M+               +A    Q K   W  +  + + +
Sbjct: 26  RFAVLVCHRRFGKTVGTVNEMIRKAILNDKKAPVYAYVAPYRNQAKRVAWEYLKYYTNPI 85

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P R                    E  + + ++H             D        +   V
Sbjct: 86  PGR---------------VVNESELYIELPTRHARSPGARLYIIGADHPDALRGIYLDGV 130

Query: 196 FNDEASGTPDIINK-SILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE--DWKRYQ 252
             DE +     +    I     +      W +   T +    FY+++    +   W    
Sbjct: 131 ILDEYADIKPELWGGVIRPALADRQG---WAVFIGTPKGQNQFYEMYQHAEKSAGWYSCI 187

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
             T     + +   + + ++        R E+L  F     +  IP + +  A +R   D
Sbjct: 188 YRTDETGVLPAEELKDMQAQMTE--MEIRQELLCDFTASASDVVIPIDLVTAAANRLLKD 245

Query: 313 DL--YAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           D     P+I+G D+A  G D+TV+  R+G  ++ +  ++     ET   
Sbjct: 246 DDVLGQPVILGVDVARFGDDRTVLCVRQGLWLKEVRTFTGLSTMETASR 294


>gi|216906085|ref|YP_002333619.1| terminase [Abalone shriveling syndrome-associated virus]
 gi|216263178|gb|ACJ72002.1| terminase [Abalone shriveling syndrome-associated virus]
          Length = 507

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 62/308 (20%), Positives = 114/308 (37%), Gaps = 21/308 (6%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIIC 112
            WQLE ++ +      N +  +  +   A+S G G GKT L+  + +W     PG     
Sbjct: 50  DWQLEIVDYIAKFFRKNSDEKH-FVCAIAVSGGNGTGKTKLSKALNIWRFCCHPGSRQFI 108

Query: 113 IANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTIT 172
           + NSE Q K T +  + + +S L         +     + +Y+  +     + +      
Sbjct: 109 LTNSERQTKRTGFTMLVRRISKL-----LSCIAALESSAYYYSPAVADKPEVRTNDMWDV 163

Query: 173 CRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR- 231
                        G H+   M    DE++   D + +++   +T+         T N   
Sbjct: 164 TYLLQSSTEAALSGLHHP-MMTFSFDESTYFNDHVWQALENMWTQG--QVLCFCTGNPSH 220

Query: 232 RLNGWFYDIF----NIPLEDWKRYQIDTRTVE--GIDSGFHEGIISRYGLDSDVARIEIL 285
             N +F  +F    +     W    +    +     +      I   YG         +L
Sbjct: 221 DNNNYFARLFNKSLHKKDSLWLTRCVSLLELPLKYRNDARARYIEEHYGKTHPRYIASVL 280

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDD-LYAPLIMGCDI---AGEGGDKTVVVFRRGNI 341
           GQFP++   N      I EAM RE  ++ ++ P+IMG D+   A  G   + +  R G  
Sbjct: 281 GQFPKKNTCNPFDITAISEAMEREVREEFIHHPVIMGIDVSISANNGS-ASAICVREGTA 339

Query: 342 IEHIFDWS 349
           +  + ++ 
Sbjct: 340 VRVLREYR 347


>gi|255929035|ref|YP_003097347.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
 gi|255705321|emb|CAR63310.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
          Length = 550

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 51/374 (13%), Positives = 104/374 (27%), Gaps = 64/374 (17%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
           Q  ++++ E +   +C      F M +       + L  F     +Q E +         
Sbjct: 22  QFTKKQIDEWI---KCKNDPIYFAMNYIQIISLDEGLVPFKMYD-FQKEILRD------- 70

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
                +   F  A    R  GK+T     +L+       ++I  +AN  +  +  L    
Sbjct: 71  ----FHENRFNIA-KLPRQTGKSTTVVAYLLYYAIFYDSVNIGILANKASTARELLGRL- 124

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
                          ++L            + ++ +++    +   T       +     
Sbjct: 125 -----------QLAYENLPKWMQHGILVWNKGNVELENGSKILAAST-------SASAVR 166

Query: 189 NTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
                 +F DE +  P    +    S+    T        ++  +T      FY ++   
Sbjct: 167 GMSFNILFLDEFAFVPNHVAEQFFASVYPTITSG--KSTKVIIISTPNGMNHFYKMWEDA 224

Query: 245 L---EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
                D+   ++    V G D+ + E  I            E    F         P   
Sbjct: 225 RRGKNDYVTNEVHWSQVPGRDAKWKEETIKNTS--PRQFAQEFECDFLGSADTLISPAKL 282

Query: 302 --------IEEAMSREAID--DLYAPLIMGCDIAGE-GGDKTVVVFRRGNIIEHIFDWSA 350
                   I+     +  +        I+  D+A   GGD +  +         I     
Sbjct: 283 QNIPFHDPIQSNAGLDVYERVQKDHEYIITVDVARGIGGDYSAFIVFD------ITTMPY 336

Query: 351 KLIQETNQEGC-PV 363
           K++ +       PV
Sbjct: 337 KIVAKYRNNEIKPV 350


>gi|326781864|ref|YP_004322266.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM2]
 gi|310003054|gb|ADO97452.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM2]
          Length = 549

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/369 (14%), Positives = 109/369 (29%), Gaps = 63/369 (17%)

Query: 11  LEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNV 70
            E+++ E L   +C      F   +       + L  F  P+ +Q + +           
Sbjct: 22  TEEQVIEFL---KCKEDPVYFANNYIKIVSLDEGLTQF-HPYHFQEKLI----------- 66

Query: 71  NNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK 130
           NN +   F       R  GK+T     +L        ++I  +AN     +  L      
Sbjct: 67  NNFHNNRFNIC-KMPRQTGKSTTVVSYLLHYAVFNDSVNIGILANKAATARELLGRL--- 122

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
                        ++L            + S+ +++    +   T       +       
Sbjct: 123 ---------QTAYENLPRWMQQGIIAWNKGSLELENGSKILAAST-------SASAVRGM 166

Query: 191 HGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE 246
               +F DE +  P    D    S+    T     +  ++  +T      FY +++   +
Sbjct: 167 SFNILFLDEFAFVPNHVADSFFASVYPTITSGKNTK--VIIVSTPHGMNHFYRMWHDAEK 224

Query: 247 DWKRYQID---TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY-- 301
               Y         V G D  + E  I+         ++E   +F         P     
Sbjct: 225 RKNEYIPTDVHWSEVPGRDDKWKETTIANTSEQQ--FKVEFECEFLGSVDTLIAPSKLRT 282

Query: 302 --IEEAMSREAIDDLYAP------LIMGCDIAGE-GGDKTVVVFRRGNIIEHIFDWSAKL 352
              +  + R A  D+Y P       +M  D+A   G D +        +   I ++  ++
Sbjct: 283 LIYDNPIQRNAGLDVYEPPKDKHDYVMTVDVARGVGEDYSAF------VCVDITEFPHRI 336

Query: 353 IQETNQEGC 361
           + +      
Sbjct: 337 VAKYRNNDI 345


>gi|61806000|ref|YP_214360.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|61374509|gb|AAX44506.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|265525210|gb|ACY76007.1| terminase large subunit gp17 [Prochlorococcus phage P-SSM2]
          Length = 547

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/376 (13%), Positives = 101/376 (26%), Gaps = 60/376 (15%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEA 61
           P L   +  +E     +    +C      F   +       + L  F             
Sbjct: 9   PNLKKANTPIEFSKDNIREFLKCKEDPVYFTRNYIKIVSLDEGLVPF------------N 56

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +       +   +   F       R  GK+T     +L        +++  +AN  +  +
Sbjct: 57  MYDFQEKLITRFHENRFNIC-KMPRQTGKSTTCISYLLHYAVFNDNVNVAVLANKASTAR 115

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
           + L                   ++L            + S+ +++        T S    
Sbjct: 116 DLLGRL------------QLAYENLPRWMQQGIISWNKGSLELENGSKISANSTSS---- 159

Query: 182 DTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
                        +F DE +  P    D    S+    T     +  ++  +T R    F
Sbjct: 160 ---SAVRGGSYNVIFLDEFAFIPNHIADDFFASVYPTITSGQSTK--VIIVSTPRGMNHF 214

Query: 238 YDIFNI---PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
           Y +++       ++    +    V G D  + E  I+         +IE   +F      
Sbjct: 215 YRMWHDSEKGKSEYVATDVHWSEVPGRDEEWKEQTIANTSEQQ--FKIEFECEFLGSVNT 272

Query: 295 NFIPHNY----IEEAMSREAI------DDLYAPLIMGCDIAGE-GGDKTVVVFRRGNIIE 343
              P        E   +R A              I+  D+A   G D +  +        
Sbjct: 273 LINPAKLRNLVYEAPKTRNAGLDIYETPVKEHNYIITVDVARGLGNDYSAFIVFD----- 327

Query: 344 HIFDWSAKLIQETNQE 359
              ++  K++ +    
Sbjct: 328 -TTEFPYKVVAKYRNN 342


>gi|111222161|ref|YP_712955.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
 gi|111149693|emb|CAJ61385.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
          Length = 535

 Score =  147 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/326 (19%), Positives = 110/326 (33%), Gaps = 44/326 (13%)

Query: 46  EHFSQPHRWQLEFMEAVDVHC-HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST 104
            +  +P RW  + +  V +      + N+     K A+ +    GK+ + A  +   + T
Sbjct: 51  FYRDEPVRWARDRLGGVHLWSKQQEIINALRVHRKVAVPSCHDAGKSFVAAAAVAHWLDT 110

Query: 105 RPGMS--IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSM 162
            P  S   I  A +  Q++  LW E+ +   +                +     + +   
Sbjct: 111 HPPGSAFAITTAPTFPQVRAILWREIRRLSRL---------------MNPPLGRVNQTEW 155

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNR 222
            ID        R  ++     F G H  +   V  DEA G P  +  +     T  N   
Sbjct: 156 LIDD-DLVAFGRKPADHDEGGFQGIHAQYP-LVVLDEAGGIPQQLWIAADSIATNENARI 213

Query: 223 FWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG--------------FHEG 268
                 N      +F  +  +P   W    I                         + E 
Sbjct: 214 L--AIGNPDDPTSYFAQVCELPS--WHVITIPAAETPAFTGEQIPDDLRQALLSRAWAEE 269

Query: 269 IISRYGLDSDVARIEILGQFPQQEVNNFI-PHNYIEEAMSREAIDDLYA--PLIMGCDIA 325
               +G D+ V   ++L QFP+      I   +  +  + R+         P+ +G D+ 
Sbjct: 270 KRREWGEDNPVYISKVLAQFPKDVAWKVIKASDVAKRRIGRDEPWPASKLRPVCLGVDV- 328

Query: 326 GEGGDKTVVVFRRGNIIEHIFDWSAK 351
           GEG D TVV  RRG  ++   +W A+
Sbjct: 329 GEGRDWTVVRERRG--VQAGREWQAR 352


>gi|326782863|ref|YP_004323261.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
 gi|310004122|gb|ADO98516.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
          Length = 547

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 45/355 (12%), Positives = 97/355 (27%), Gaps = 54/355 (15%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEA 61
           P L   +  ++ +  E+    +C      F+  +       + L  F             
Sbjct: 9   PNLKKVNTSIDFKPEEVAEVLKCQDDPIYFIKNYIKIVSLDEGLVPF------------N 56

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +       V+  +   F  A    R  GK+T+    +LW +     +++  +AN     +
Sbjct: 57  MYHFQEEMVSKFHDHRFNIA-KLPRQSGKSTIVTAYLLWYVLFNANVNVAILANKAATAR 115

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
             L                   ++L         +    S+ +++    +   T      
Sbjct: 116 EMLQRL------------QLSYENLPNWMQQGILQWNRGSLELENGSKIMAAST------ 157

Query: 182 DTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
            +           +F DE +  P    D    S+    +        ++  +T      F
Sbjct: 158 -SASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSG--KSTKVIIISTPHGMNMF 214

Query: 238 YDIFNIPL---EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
           Y +++       ++   ++    V G D  + E  I          R+E   +F      
Sbjct: 215 YKLWHDAERGTNEYVPTEVHWSEVPGRDDVWKEQTIKNTSESQ--FRVEFECEFLGSVDT 272

Query: 295 NFIPHNY--------IEEAMSREAIDD--LYAPLIMGCDIAGE-GGDKTVVVFRR 338
              P           I         +        I+  D++   G D +      
Sbjct: 273 LIAPSKLRIMPYHDPITSNRGLAVYEQVIPEHNYIITVDVSRGVGNDYSAFCVID 327


>gi|153806881|ref|ZP_01959549.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
 gi|149131558|gb|EDM22764.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
          Length = 513

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/361 (15%), Positives = 115/361 (31%), Gaps = 67/361 (18%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP------ 106
           ++  + + A        +  S       A+++G   GK  + A   L  +   P      
Sbjct: 24  KFVRDALCARLDREQQAIIESVQHNPMTAVASGTARGKDFVAACASLCFMYLTPRFNEKG 83

Query: 107 ----GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSM 162
                  +   A +  Q+KN +  E+ + +     +  F               L+   +
Sbjct: 84  VLVGNTKVAMTAPTGRQVKNIMTPEIRRLIRAARTKFPFCC----------PGRLVADDI 133

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNR 222
             D + + +T     +   +++ G H  + M V   EASG  +I+  +I G     +   
Sbjct: 134 RTDYEEWFLTGFKADDNATESWSGFHAANTMFVI-TEASGISEIVYNAIEGNLQGNSR-- 190

Query: 223 FWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGI-----------DSGFHEG--- 268
             ++  N     G+         + + ++++ +   E +           D  + +    
Sbjct: 191 -MLIVFNPNITTGYAARAM--KSDRFAKFRLSSLNAENVVKKQIVIPGQVDYEWVKDKVI 247

Query: 269 -------------------IISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSRE 309
                                 +    +D+ R+++LG FP+   +  IP+ +IE A    
Sbjct: 248 NWCSPIQQTDFNEGEGDFNWEGKLYRPNDLFRVKVLGMFPKVSEDVLIPYEWIEIANRNW 307

Query: 310 AIDD-----LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS---AKLIQETNQEGC 361
                          +G D+AG G D +V+  R GN +                      
Sbjct: 308 QELQASGFIPAKSCKLGVDVAGMGRDNSVLCPRYGNYVPQFDVHQSAGRADHMHVVGMTI 367

Query: 362 P 362
           P
Sbjct: 368 P 368


>gi|261402679|ref|YP_003246903.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
 gi|261369672|gb|ACX72421.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
          Length = 437

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 53/324 (16%), Positives = 103/324 (31%), Gaps = 50/324 (15%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +    F+ FV         G  L      H+ Q E ++A            +       +
Sbjct: 12  KLRTDFEFFVKTV-----LGAEL------HKAQKEIVKAF----------FSGKYKTIIV 50

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFE 142
           +AGR  GK+ L  +++++L  T+       IA      +  ++ E+  ++         +
Sbjct: 51  AAGRRFGKSKLMCFLLIFLSCTQKDKKFAVIAPYYANAR-IIFKELRTYIEKNKT---LQ 106

Query: 143 MQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG 202
                +  S +     +    ID +              D            V  DEA+ 
Sbjct: 107 KLVKRITESPYMVIEFKTGCIIDFRS------------ADNPTSIRGESYHLVILDEAAF 154

Query: 203 TPDI-INKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF---NIPLEDWKRYQIDTRTV 258
             D  +   I     + +     I   +T   +  FY+ F            ++  T + 
Sbjct: 155 IKDDVVKYVIKPLLIDYDAPLIEI---STPNGHNHFYESFLMGENRQNRHISFRFPTWSN 211

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID----DL 314
             +     E I   +G DS V + E   +F   + +      YI++ +          + 
Sbjct: 212 PFLPKSVIEEIKREFGEDSLVWKQEFCAEFID-DQDAVFKWEYIQQCIDSNIELLTVGEK 270

Query: 315 YAPLIMGCDIAGEGGDKTVVVFRR 338
               +MG D+A    D TV++   
Sbjct: 271 GHRYVMGVDLAKY-QDYTVIIILD 293


>gi|299769795|ref|YP_003731821.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
 gi|298699883|gb|ADI90448.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
          Length = 668

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     E    +YG  D    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSKQSLEEQRQKYGSRDDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           I+  D+ G  G D +V+V 
Sbjct: 438 IITVDVGGGVGRDDSVIVI 456


>gi|323516996|gb|ADX91377.1| hypothetical protein ABTW07_0941 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|323518424|gb|ADX92805.1| hypothetical protein ABTW07_2381 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 663

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/259 (20%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     E    +YG  +    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSKQSLEEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           ++  D+ G  G D +V+V 
Sbjct: 438 VITVDVGGGVGRDDSVIVV 456


>gi|61806303|ref|YP_214662.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
 gi|61563847|gb|AAX46902.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
          Length = 550

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/371 (11%), Positives = 105/371 (28%), Gaps = 59/371 (15%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + +   + Q  ++++ E +  A+       F+ ++       + +  F            
Sbjct: 14  LKKANVSTQFTKKQVAEYMKCAQ---DPVYFIRKYIRIVSLDEGVIPFD----------- 59

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +       V   +   F  A    R  GK+T+    +LW +     +++  +AN     
Sbjct: 60  -MYNFQEDMVTKFHQHRFNIA-KLPRQSGKSTIVTAYLLWYVLFNANVNVAILANKAPTA 117

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  L                   ++L            + S+ +++    +   T     
Sbjct: 118 REMLGRL------------QLSYENLPKWMQQGILGWNKGSLELENGSKILASST----- 160

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +           +F DE +  P    +    S+    +        ++  +T      
Sbjct: 161 --SASAVRGMSFNIIFLDEFAFVPNHIAEQFFASVYPTISSG--KSTKVIIISTPHGMNQ 216

Query: 237 FYDIFNIP---LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           FY +++       ++   ++    V G D  + +  I          R+E   +F     
Sbjct: 217 FYKLWHDAERGANNYVATEVHWSQVPGRDDKWKQQTIENTSE--AQFRVEFECEFLGSVD 274

Query: 294 NNFIPHNY--------IEEAMSREAIDD--LYAPLIMGCDIAGE-GGDKTVVVFRRGNII 342
               P           I+E       +        I+  D++   G D +         +
Sbjct: 275 TLITPSKLRIMPYKDPIQENRGLAVYEHVQENHNYIITVDVSRGVGNDYSAFCVIDTTTV 334

Query: 343 --EHIFDWSAK 351
             + +  +   
Sbjct: 335 PYKVVARYKNN 345


>gi|332852816|ref|ZP_08434408.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332871045|ref|ZP_08439658.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
 gi|332729027|gb|EGJ60377.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332731805|gb|EGJ63085.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
          Length = 663

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     +    +YG  +    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           ++  D+ G  G D +V+V 
Sbjct: 438 VITVDVGGGVGRDDSVIVV 456


>gi|260551382|ref|ZP_05825582.1| phage terminase [Acinetobacter sp. RUH2624]
 gi|260405545|gb|EEW99037.1| phage terminase [Acinetobacter sp. RUH2624]
          Length = 663

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     +    +YG  +    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           ++  D+ G  G D +V+V 
Sbjct: 438 VITVDVGGGVGRDDSVIVV 456


>gi|213156231|ref|YP_002318651.1| phage terminase [Acinetobacter baumannii AB0057]
 gi|301346399|ref|ZP_07227140.1| phage terminase [Acinetobacter baumannii AB056]
 gi|301594275|ref|ZP_07239283.1| phage terminase [Acinetobacter baumannii AB059]
 gi|213055391|gb|ACJ40293.1| phage terminase [Acinetobacter baumannii AB0057]
          Length = 663

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     +    +YG  +    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           ++  D+ G  G D +V+V 
Sbjct: 438 VITVDVGGGVGRDDSVIVV 456


>gi|184158505|ref|YP_001846844.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
 gi|183210099|gb|ACC57497.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
          Length = 663

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 90/259 (34%), Gaps = 18/259 (6%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L          
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLA---- 263

Query: 146 LSLHPSGWY-AELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP 204
                + +   +     +    + + +  +T  + +P    G H  + M V+ DEASG  
Sbjct: 264 ---WLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYM-VWVDEASGVD 319

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQIDTRTVEG 260
           D +     G  T  +       TS   R  G FY+  +         W     +      
Sbjct: 320 DAVLDVAFGALTHEDNRAVM--TSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPL 377

Query: 261 IDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEA-MSREAIDDLYAPL 318
           +     +    +YG  +    +I +LG+FP       I     EE  +     DD     
Sbjct: 378 VSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGY 437

Query: 319 IMGCDIAGE-GGDKTVVVF 336
           ++  D+ G  G D +V+V 
Sbjct: 438 VITVDVGGGVGRDDSVIVV 456


>gi|326782611|ref|YP_004323017.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
 gi|310002825|gb|ADO97224.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
          Length = 549

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/356 (12%), Positives = 97/356 (27%), Gaps = 57/356 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + +  +       E+ E++   +C      F+ ++       K L  F            
Sbjct: 13  LKKANTALDFTPDEVQEVI---KCSEDPVYFIKKYIKIVSLDKGLIPFD----------- 58

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +       V   +   F  A    R  GK+T+    +LW +     +++  +AN     
Sbjct: 59  -MYHFQEEMVQKFHDNRFNIA-KLPRQSGKSTIVTSYLLWYVLFNDNVNVAILANKAATA 116

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  L                   ++L         +    S+ +++    +   T     
Sbjct: 117 REMLQRL------------QLSYENLPKWLQQGILQWNRGSLELENGSKIMAAST----- 159

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +           +F DE +  P    D    S+    +        ++  +T      
Sbjct: 160 --SASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSG--KSTKVIIISTPHGMNM 215

Query: 237 FYDIFNIPL---EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           FY +++       ++   ++    V G D  + E  I          R+E   +F     
Sbjct: 216 FYKLWHDAERGTNEYIPTEVHWSEVPGRDDVWKEQTIKNTSEQQ--FRVEFECEFLGSVD 273

Query: 294 NNFIPHNYIEEAMSREAIDD----------LYAPLIMGCDIAGE-GGDKTVVVFRR 338
               P             ++               ++  D++   G D +      
Sbjct: 274 TLISPSKLRIMPYHDPMKENRGLAIFEQSIPDHNYVITVDVSRGVGNDYSAFCVMD 329


>gi|326782381|ref|YP_004322781.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
 gi|310003329|gb|ADO97726.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
          Length = 362

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/378 (12%), Positives = 103/378 (27%), Gaps = 60/378 (15%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEA 61
           P L   +  +E    ++   A+C      F+  +         L  F             
Sbjct: 11  PNLKKANTSIEFTNDQISEFAKCYNDPVYFIKNYVKIVSLDAGLIPFD------------ 58

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +       V   +   F  A    R  GK+T+    +LW +     +++  +AN     +
Sbjct: 59  MYHFQEEMVQKFHDNRFNIA-KLPRQSGKSTIVTSYLLWYVIFNDNVNVAILANKAATSR 117

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
             L                   ++L         +    S+ +++    +   T S    
Sbjct: 118 EMLQRLQR------------SYENLPKWLQQGIVQWNRGSLELENGSKIMAASTSS---- 161

Query: 182 DTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
                        +F DE +  P    D    S+    +        ++  +T      F
Sbjct: 162 ---SAVRGMSFNVIFLDEFAFVPNHIADEFFSSVYPTISSG--KSTKVIIISTPHGMNMF 216

Query: 238 YDIFN---IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
           Y +++       ++   ++    V G D+ +    I+         ++E   +F      
Sbjct: 217 YKLWHDSERKKNEYISTEVHWSEVPGRDAKWKAQTIANTSEQQ--FKVEFECEFLGSVDT 274

Query: 295 NFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNIIE 343
              P               + +S           ++  D+A    GD +        ++ 
Sbjct: 275 LISPSKLRTMVYNDPLVQNKGLSIYEHVQKDHNYVITVDVARGVSGDFSAF------VVI 328

Query: 344 HIFDWSAKLIQETNQEGC 361
                  KL+ +      
Sbjct: 329 DTTTIPYKLVAKYKNNTI 346


>gi|326784324|ref|YP_004324722.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
 gi|310003555|gb|ADO97951.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
          Length = 549

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 46/356 (12%), Positives = 99/356 (27%), Gaps = 57/356 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + +  +       E+ E+L  +E       F+  +       K L  F            
Sbjct: 13  LKKANTAIDFTPDEVAEVLRCSE---DPVYFIKNYIKIVSLDKGLIPFD----------- 58

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +       V+  +   F  A    R  GK+T+    +LW +   P +++  +AN     
Sbjct: 59  -MYHFQEEMVSKFHAERFNIA-KLPRQSGKSTIVTSYLLWYVLFNPNVNVAILANKAATA 116

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  L                   ++L         +    S+ +++    +   T     
Sbjct: 117 REMLQRL------------QLSYENLPKWLQQGILQWNRGSLELENGSKIMAAST----- 159

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +           +F DE +  P    D    S+    +        ++  +T      
Sbjct: 160 --SASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSG--KSTKVIIISTPHGMNM 215

Query: 237 FYDIFNIP---LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           FY +++       ++   ++    V G D  + E  I          R+E   +F     
Sbjct: 216 FYKLWHDAERGSNEYVPTEVHWSEVPGRDEVWKEQTIKNTSEQQ--FRVEFECEFLGSVD 273

Query: 294 NNFIPHNY--------IEEAMSREAIDD--LYAPLIMGCDIAGE-GGDKTVVVFRR 338
               P           + +       +        I+  D++   G D +      
Sbjct: 274 TLISPSKLRIMPYHEPMNQNRGLAVFEQAIPEHNYILTVDVSRGVGNDYSAFTVMD 329


>gi|303243859|ref|ZP_07330199.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
 gi|302485795|gb|EFL48719.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
          Length = 445

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 51/291 (17%), Positives = 96/291 (32%), Gaps = 30/291 (10%)

Query: 60  EAVDVHCHSNVNNSNPTIFK-CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           E +       ++      +K   ++AGR  GK+ L A+++++L ST+       IA    
Sbjct: 33  EKLHSAQQKIIDAYISKKYKTIIVAAGRRFGKSKLMAFLLIFLCSTQKNKKYAVIAPFYA 92

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  ++ E+ K++      +        +  S + A   +    ID +           
Sbjct: 93  NAR-IIFRELKKYIEK---SNVLSRLVKRMVESPYMAIEFKTGCTIDFRS---------- 138

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPDI-INKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              D            V  DEA+   D  +   I     + +     I   +T   +  F
Sbjct: 139 --ADNPTSIRGESYHLVILDEAAFIKDDVVKYVIKPLLLDYDAPLIEI---STPNGHNHF 193

Query: 238 YDIF---NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
           Y+ F            ++  T T   +     E I    G DS V + E   +F      
Sbjct: 194 YESFLMGKNKQNRHISFRFPTWTNPFLPKNAIEEIKQEVGEDSPVWKQEYCAEFIDNNE- 252

Query: 295 NFIPHNYIEEAMSREAID----DLYAPLIMGCDIAGEGGDKTVVVFRRGNI 341
                 YI++ +          +     +MG D+A    D TV+     ++
Sbjct: 253 AVFNWEYIQQCIDGTIKLLKSGESGHQYVMGVDLAKF-EDYTVITVLDVSV 302


>gi|326783331|ref|YP_004323723.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
 gi|310005278|gb|ADO99667.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
          Length = 549

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/370 (12%), Positives = 105/370 (28%), Gaps = 56/370 (15%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEA 61
           P L   +   E    E+  + +C     +F++ +       + +  F+            
Sbjct: 11  PNLKKANIAQEFSPEEVQEYLKCADDPVHFILNYIKIVSLDEGVIPFT------------ 58

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +       V + +   F  A    R  GK+T+    +LW +   P +++  +AN     +
Sbjct: 59  MYDFQVDMVKSFHDNRFNIA-KLPRQSGKSTIVTAYLLWYVLFNPNVNVAILANKAATAR 117

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
             L                   ++L         +    S+ +++    +   T      
Sbjct: 118 EMLGRL------------QLSYENLPKWLQQGILQWNRGSLELENGSKILAAST------ 159

Query: 182 DTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
            +           +F DE +  P    D    S+    +        ++  +T      F
Sbjct: 160 -SASAVRGMSFNVIFLDEFAFVPNHIADQFFSSVYPTVSSG--KSTKVIIISTPHGMNMF 216

Query: 238 YDIFNIP---LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
           Y +++       ++   ++    V G D+ + E  I          ++E   +F      
Sbjct: 217 YKLWHDAEQGKNEYLPTEVHWSQVPGRDAAWKEQTIKNTSEQQ--FKVEFECEFLGSVDT 274

Query: 295 NFIPHNYIEEAMSREA----------IDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNII- 342
              P                        +     I+  D++   G D +  V      + 
Sbjct: 275 LISPSKLRTMPYVDPVAQNKGLAIYERVEAEHNYIITVDVSRGIGNDYSAFVVVDTTTMP 334

Query: 343 -EHIFDWSAK 351
            + +  +   
Sbjct: 335 YKVVARYRNN 344


>gi|189460514|ref|ZP_03009299.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
 gi|189432758|gb|EDV01743.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
          Length = 556

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 60/362 (16%), Positives = 124/362 (34%), Gaps = 72/362 (19%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP------ 106
           R+  E +          + +S     + ++++G   GK  + A   +  +   P      
Sbjct: 54  RFVREALGVTLDKEQQEILSSVQYNRRTSVASGTARGKDFVAACAAICFLYLTPRWRKNS 113

Query: 107 --------GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELL 158
                      +   A ++ Q+KN +  E+S+  +    R    +  L+ +         
Sbjct: 114 LGEIELVENTKVALTAPTDRQVKNIMMPEISRLFNRAKARGVELIGKLNAY--------- 164

Query: 159 EQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTEL 218
              +  ++  + +T     E   + + G H  H M     EA+G  D    +I G     
Sbjct: 165 --DIRTNNDEWFLTGFKADEHNHEAWSGFHAVHTMF-VVTEATGIGDDTFAAIEGNLQGD 221

Query: 219 NPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEG-----------IDSGFHE 267
           +     ++  N  +  G+     +   + W +Y++++ T              +D  +  
Sbjct: 222 SR---ILLVFNPNKTVGYAAK--SQKGDRWHKYRLNSLTAPNIASKKIIIPGQVDYDWVL 276

Query: 268 GIIS----------------------RYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
             +                       ++    D+ R ++LG FP+ + +  IP  ++EEA
Sbjct: 277 DKLENWCEKISPDEIISEMDDFEFEGQWYRPEDLFRKKVLGLFPKVDEDTLIPRQWLEEA 336

Query: 306 MSREAIDDLYAPL-----IMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA---KLIQETN 357
             R        PL     I+G D+AG G D T  V RR N +      ++       +  
Sbjct: 337 HERWKQAKGREPLRADLNILGVDVAGMGRDATCYVLRRDNWVASFDTHNSGGVADHMKVA 396

Query: 358 QE 359
            +
Sbjct: 397 GK 398


>gi|284162607|ref|YP_003401230.1| hypothetical protein Arcpr_1511 [Archaeoglobus profundus DSM 5631]
 gi|284012604|gb|ADB58557.1| protein of unknown function DUF264 [Archaeoglobus profundus DSM
           5631]
          Length = 435

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 62/355 (17%), Positives = 116/355 (32%), Gaps = 68/355 (19%)

Query: 10  KLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSN 69
           K ++EL + ++          F   F  WG            H  Q + +          
Sbjct: 2   KTDKELKKKVLS-----DPVTFAKVFLDWGA-----------HPAQAQILRDRHQF---- 41

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVS 129
                       + AGR  GKT   A   ++   T PG     IA S  Q  N ++ ++ 
Sbjct: 42  ----------ITVVAGRRFGKTECMAVSAIYYALTNPGSIQFVIAPSYDQ-SNIMFGQIV 90

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
           ++LS              ++ + ++  + +    I ++                      
Sbjct: 91  QFLSKSILGCMIR----RIYKTPFHHIIFKNDSVIHARS------------ASKPEFLRG 134

Query: 190 THGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE-- 246
                +  DEA+  PD +    I     + N +  WI           FYD +       
Sbjct: 135 HKAHRIILDEAAFIPDDVISNIIEPMLADYNGS--WIKIGTP-FGKNHFYDTYLKGQSPD 191

Query: 247 --DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE 304
             D+  Y+  +     I   F E     YG +S + R E L +F + + N       I++
Sbjct: 192 FPDYSSYRFPSTVNPHISHEFIEKKKREYGENSIIFRTEYLAEFVE-DQNAVFRWADIQK 250

Query: 305 AMSREAI-----DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQ 354
            +          +++    ++GCD+A    D TV+      ++  + +   KL+ 
Sbjct: 251 NVDNSIELIDSAENVSKQYVIGCDLAKY-QDYTVI------VVLDVTEKPYKLVH 298


>gi|326784094|ref|YP_004324487.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
 gi|310004826|gb|ADO99217.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
          Length = 550

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 103/367 (28%), Gaps = 63/367 (17%)

Query: 11  LEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNV 70
             +++ E +   +C      F   +       + L  F             +       +
Sbjct: 23  TPEQVKEFI---KCKNDPIYFTKTYVQIVSLDEGLVPFK------------MWDFQEELI 67

Query: 71  NNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK 130
              + + F  A    R  GK+T     +L  +     +++  +AN  +  ++ L    + 
Sbjct: 68  RKFHKSRFNIA-KLPRQTGKSTTVVSYLLHYLIFNDSVNVGILANKASTARDLLARLAT- 125

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
                        ++L            + ++ +++    +   T       +       
Sbjct: 126 -----------AYENLPKWIQQGVVVWNKGNIELENGSKILAAST-------SASAVRGM 167

Query: 191 HGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP-- 244
               +F DE +  P    D    S+    T        ++  +T +    FY ++     
Sbjct: 168 SFNIIFLDEFAFVPNHIADSFFASVYPTITSG--KSTKVIIISTPQGMNHFYKMWQDAVN 225

Query: 245 -LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY-- 301
              D+  +++    V G D+ + E  I            E   +F               
Sbjct: 226 GRNDYTYHEVHWSQVPGRDAKWKEETIKNTS--QRQFTQEFECEFLGSVDTLISASKLKA 283

Query: 302 --IEEAMSRE------AIDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNIIEHIFDWSAKL 352
              +E ++R                ++  D++   GGD +  +         I     K+
Sbjct: 284 LAFDEPITRNKGLDIYEKPKDKNEYLLTVDVSRGIGGDYSAFIVYD------ITTVPYKI 337

Query: 353 IQETNQE 359
           + +    
Sbjct: 338 VGKYRNN 344


>gi|326783550|ref|YP_004323947.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
 gi|310005053|gb|ADO99443.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
          Length = 549

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/349 (12%), Positives = 93/349 (26%), Gaps = 56/349 (16%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +C      F+  +       K L  F             +       V   +   F  A 
Sbjct: 32  KCSEDPVYFIKTYIKIVSLDKGLIPFD------------MYHFQEEMVEKFHDNRFNIA- 78

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFE 142
              R  GK+T+    +LW +     +++  +AN     +  L                  
Sbjct: 79  KLPRQSGKSTIVTSYLLWYVLFNQNVNVAILANKAATSREMLQRL------------QLS 126

Query: 143 MQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG 202
            ++L         +    S+ +++    +   T S                 +F DE + 
Sbjct: 127 YENLPKWLQQGILQWNRGSLELENGSKIMAASTSS-------SAVRGMSFNVIFLDEFAF 179

Query: 203 TP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP---LEDWKRYQIDT 255
            P    D    S+    +     +  ++  +T      FY +++       ++   ++  
Sbjct: 180 VPNHIADQFFSSVYPTISSGQSTK--VIIISTPHGMNMFYKLWHDAERSKNEYIPTEVHW 237

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--- 312
             V G D+ + E  I+         ++E   +F         P                 
Sbjct: 238 SEVPGRDAKWKEQTIANTSEQQ--FKVEFECEFLGSVDTLISPSKLRVMPYHDPIAQNKG 295

Query: 313 -------DLYAPLIMGCDIAG-EGGDKTVVVFRRGNII--EHIFDWSAK 351
                  +     I+  D+A     D +         +  E +  +   
Sbjct: 296 LAVYKRAEPDHNYIITVDVARGTSNDYSAFCVMDTTTVPYEMVARYRNN 344


>gi|58532911|ref|YP_195134.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
 gi|58331378|emb|CAF34164.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
          Length = 548

 Score =  140 bits (352), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/350 (11%), Positives = 98/350 (28%), Gaps = 58/350 (16%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +C      F   +       + L  F             +       +   +   F  A 
Sbjct: 32  KCANDPVYFTKNYVKIVSLDEGLVPFK------------MWDFQEELIMKFHKNRFNIA- 78

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFE 142
              R  GK+T     +L  +     ++I  +AN  +  ++ L    +             
Sbjct: 79  KLPRQTGKSTTVVSYLLHYLIFNDNVNIGILANKASTARDLLARLAT------------A 126

Query: 143 MQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG 202
            ++L            + ++ +++    +   T       +           +F DE + 
Sbjct: 127 YENLPKWIQQGVVVWNKGNIELENGSKILAAST-------SASAVRGMSFNIIFLDEFAF 179

Query: 203 TP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF---NIPLEDWKRYQIDT 255
            P    D    S+    T        ++  +T +    FY ++         +  +++  
Sbjct: 180 VPNHIADSFFASVYPTITSG--KSTKVIIISTPQGMNHFYKMWVDATNGRNGYTFHEVHW 237

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----- 310
             V G D  + E  I            E   +F    V+  I  + ++  +  +      
Sbjct: 238 SQVPGRDEKWKEETIKNTSERQ--FTQEFECEFL-GSVDTLIAASKLKALVFNDPIKRNK 294

Query: 311 ------IDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNII--EHIFDWSAK 351
                      +  +M  D++   GGD +  +      +  + +  +   
Sbjct: 295 GLDIYEEPKEKSEYLMTVDVSRGIGGDYSAFIIFDITTVPYKVVGKYRNN 344


>gi|298387330|ref|ZP_06996883.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259999|gb|EFI02870.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 500

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 61/339 (17%), Positives = 111/339 (32%), Gaps = 67/339 (19%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP---------- 106
           + + A        V  S       A+++G   GK  + A   L  +   P          
Sbjct: 22  DVLRANLDEEQKAVLRSVQKNPMTALASGTSRGKDFVAACAALCFMYLTPEWDDDGNLIR 81

Query: 107 GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I   A S+ Q++N +  EV +                          L+   +  D 
Sbjct: 82  NTKIALSAPSQRQVENIMTPEVRRLFRNAG---------------ILPGRLVANDIRTDY 126

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM 226
           + Y +T      +  + + G H  + M V   EASG  + I  +I G     +       
Sbjct: 127 EEYFLTGFKADNKNQEVWSGFHAANVMFVI-TEASGVSETIFSAIEGNLQGNSRLLLVF- 184

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGI-----------DSGFHEGIISRY-- 273
             N     G  Y    +  + + ++++D+     +           +  + E  +  +  
Sbjct: 185 --NPNITTG--YAANAMKSDRFAKFRLDSLNATNVTAKREIIPGQVNYEWVEDKVKHWCT 240

Query: 274 --------------------GLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                                  +D+ RI++ G FP+   +  IP+ +IE A  R   + 
Sbjct: 241 PITKEEYNEGEGDFLFENNLYRPNDLFRIKVRGMFPKVAEDVLIPYEWIEIANKRWQENH 300

Query: 314 LYAP---LIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS 349
            Y P     +G D+AG G D +V   R GN +     + 
Sbjct: 301 PYRPRKSCKLGVDVAGMGRDNSVFCPRYGNYVSQFDVFQ 339


>gi|291336011|gb|ADD95601.1| large terminase protein [uncultured phage MedDCM-OCT-S09-C7]
          Length = 526

 Score =  139 bits (349), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/358 (13%), Positives = 108/358 (30%), Gaps = 54/358 (15%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
           +  +QE+ E +   +C     +F+  +       + +  F     +Q + +E        
Sbjct: 23  KYTDQEMQEYV---KCSQDPCHFIENYTQIISLDEGMVPFK-LRGYQDKLIE-------- 70

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
              + N   F   + A R  GK+  +   +LW +   P +++  +AN     +  +   V
Sbjct: 71  ---HYNSNRFNI-VLASRQSGKSITSCAYLLWFLLFNPEVTVAVLANKGAIAREMIARMV 126

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
           +             ++S+          L + S+   +    +   T S           
Sbjct: 127 T------------MLESVPFFLQPGVKILNKGSIEFANDSKVVAAATSS-------SSIR 167

Query: 189 NTHGMAVFNDEASGTPD-IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED 247
                 ++ DE +   D     +          +   I+TS    +   FY I+   + D
Sbjct: 168 GLSINLLYLDEFAFVDDAETFYTATYPVVTSGKDSKVIITSTANGVGNMFYKIYESAVHD 227

Query: 248 ---WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP------ 298
              +K + I+   V G D  + +  I+           E    F                
Sbjct: 228 QSEYKHFLINWFDVPGRDEEWKKETIANTSE--AQFEQEYGNSFLGTGNTLINSNTLLGL 285

Query: 299 ----HNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVVFRRGNI--IEHIFDWS 349
                ++ ++ +            I   D++ G G D +       ++     +  + 
Sbjct: 286 MSKEPDWNKDGVKVYEKPKEGHTYITTVDVSKGRGIDYSTFTIMDISVKPFRQVCTYR 343


>gi|319775727|ref|YP_004138215.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319896735|ref|YP_004134928.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|317432237|emb|CBY80589.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317450318|emb|CBY86534.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
          Length = 449

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 99/289 (34%), Gaps = 24/289 (8%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K     GRG GK+   A +++  I+ R  + + C    +  + +++   ++  +  
Sbjct: 15  PCRYKILY-GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIED 72

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           L +   FE+Q  +++     +E +   +  +                             
Sbjct: 73  LGYLEDFEVQRNAIYCLKTGSEFMFYGIKNNPN-----------------KIKSLEGIDL 115

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQI 253
           V+ +EA    +     ++    +     +  +T N + +    Y  F I P ++    +I
Sbjct: 116 VWIEEAENVSNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKI 173

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
           +              +      D ++ R   LG+         I   +IE A+       
Sbjct: 174 NYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLG 233

Query: 314 --LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                  I+G D+A +G D     F  G+++  + +W  + +  +    
Sbjct: 234 FLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRT 282


>gi|159897183|ref|YP_001543430.1| hypothetical protein Haur_0654 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890222|gb|ABX03302.1| conserved hypothetical protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 472

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 54/352 (15%), Positives = 98/352 (27%), Gaps = 63/352 (17%)

Query: 45  LEHFSQPHRWQLEFMEAVDVHCHSNVNNSN-PTIFKCAISAGRGIGKTTLNAWMMLWLIS 103
           L +   P  +  E +  V       +  S     ++  + A   +GKT L   ++ W   
Sbjct: 2   LPYAHDPVAYAREVLGEVWWTKQELIARSLLTPPYRTLVKACHKVGKTHLGGGLVNWWYD 61

Query: 104 TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMG 163
           +     ++  A ++ Q+++ LW EV                         +       + 
Sbjct: 62  SFDPGLVLTTAPTDRQVRDLLWKEVRMQRRG----------------RAGFTGPKSPRLE 105

Query: 164 IDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRF 223
                       ++ +  D+F G H+ H      DEA G   +  ++    F E      
Sbjct: 106 STPD---HFAHGFTAKDGDSFQGHHSPH-TLFIFDEAVGVASVFWETAESMFNEGGA--- 158

Query: 224 WIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF------------------ 265
           W+   N    +   Y         W    +       I +                    
Sbjct: 159 WLAIFNPTDTSSQAYA--EELSGGWHVISMSVLEHPNILAELQGLPPPFPSAIRLSRVDT 216

Query: 266 ------------------HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
                                    +     +A   +LG++P Q  NN       + A  
Sbjct: 217 LLKKWCRALSPEEPKRATDIHWRDAWYRPGPIAEARLLGRWPSQATNNVWSDGAFQVA-E 275

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
              +     P  +GCD+A  G D T +  RRG    +    +     ET   
Sbjct: 276 SLLLPASDEPCELGCDVARYGDDFTEIHVRRGGHSLYHEAANGWSTVETAGR 327


>gi|326784562|ref|YP_004324947.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
 gi|310004595|gb|ADO98987.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
          Length = 550

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/351 (12%), Positives = 95/351 (27%), Gaps = 56/351 (15%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +C      F+  +       + L  F            A+       V   +   F  A 
Sbjct: 33  KCSEDPVYFIQTYIKIVSLDRGLIPF------------AMYDFQSEMVEKFHDNRFNIA- 79

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFE 142
              R  GK+T+    +LW +  +  +++  +AN     +  L                  
Sbjct: 80  KLPRQTGKSTIVTSYLLWYVLFKANVNVAILANKAATSREMLQRL------------QLS 127

Query: 143 MQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG 202
            ++L         +    S+ +++    +   T S                 +F DE + 
Sbjct: 128 YENLPKWLQQGILQWNRGSLELENGSKIMAASTSS-------SAVRGMSFNVIFLDEFAF 180

Query: 203 TP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP---LEDWKRYQIDT 255
            P    D    S+    +        ++  +T      FY +++       ++   ++  
Sbjct: 181 VPNHIADQFFSSVYPTISSG--KSTKVIIISTPHGMNMFYKLWHDAERGKNEYIPTEVHW 238

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----- 310
             V G D+ + +  I+         ++E   +F         P                 
Sbjct: 239 SAVPGRDAAWKDQTIANTSEQQ--FKVEFECEFLGSVDTLISPSKLRTMPYEDPIIQNRG 296

Query: 311 -----IDDLYAPLIMGCDIAGEGG-DKTVVVFRRGNII--EHIFDWSAKLI 353
                  +     I+  D+A     D +         +  E +  +    I
Sbjct: 297 LAVYKQVEKDHNYIVTVDVARGVSQDYSAFCIIDTTTVPYELVAKYRNNDI 347


>gi|145629819|ref|ZP_01785613.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148827544|ref|YP_001292297.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
 gi|144977965|gb|EDJ87753.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148718786|gb|ABQ99913.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
          Length = 449

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 99/289 (34%), Gaps = 24/289 (8%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K     GRG GK+   A +++  I+ R  + + C    +  + +++   ++  +  
Sbjct: 15  PCRYKILY-GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIED 72

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           L +   FE+Q  +++     +E +   +  +                             
Sbjct: 73  LGYLEEFEVQRNAIYCLKTGSEFMFYGIKNNPN-----------------KIKSLEGIDL 115

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQI 253
           V+ +EA    +     ++    +     +  +T N + +    Y  F I P ++    +I
Sbjct: 116 VWIEEAENVSNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKI 173

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
           +              +      D ++ R   LG+         I   +IE A+       
Sbjct: 174 NYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLG 233

Query: 314 --LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                  I+G D+A +G D     F  G+++  + +W  + +  +    
Sbjct: 234 FLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRT 282


>gi|260583110|ref|ZP_05850891.1| phage terminase large subunit [Haemophilus influenzae NT127]
 gi|260093822|gb|EEW77729.1| phage terminase large subunit [Haemophilus influenzae NT127]
          Length = 445

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 99/289 (34%), Gaps = 24/289 (8%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K     GRG GK+   A +++  I+ R  + + C    +  + +++   ++  +  
Sbjct: 11  PCRYKILY-GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIED 68

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           L +   FE+Q  +++     +E +   +  +                             
Sbjct: 69  LGYLEEFEVQRNAIYCLKTGSEFMFYGIKNNPN-----------------KIKSLEGIDL 111

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQI 253
           V+ +EA    +     ++    +     +  +T N + +    Y  F I P ++    +I
Sbjct: 112 VWIEEAENVSNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKI 169

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
           +              +      D ++ R   LG+         I   +IE A+       
Sbjct: 170 NYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLG 229

Query: 314 --LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                  I+G D+A +G D     F  G+++  + +W  + +  +    
Sbjct: 230 FLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRT 278


>gi|68249883|ref|YP_248995.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058082|gb|AAX88335.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 438

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 95/280 (33%), Gaps = 23/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A +++ +   R  + + C    +  + +++   ++  +  L +   FE+
Sbjct: 12  GGRGSGKSWGVAQLLIEIA-VRTKVRVFCGRELQNSMSDSVIKLIADTIEDLGYLEEFEV 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q  +++     +E +   +  +                             V+ +EA   
Sbjct: 71  QRNAIYCLKTGSEFMFYGIKNNPN-----------------KIKSLEGIDLVWIEEAENV 113

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQIDTRTVEGID 262
            +     ++    +     +  +T N + +    Y  F I P ++    +I+        
Sbjct: 114 SNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKINYDENPYFP 171

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIM 320
                 +      D ++ R   LG+         I   +IE A+              I+
Sbjct: 172 ETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKIV 231

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A +G D     F  G+++  + +W  + +  +    
Sbjct: 232 GFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRT 271


>gi|329122215|ref|ZP_08250807.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|327474100|gb|EGF19511.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 452

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 93/280 (33%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++    T+P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +I+ A+              I+
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  + +W  + +  +    
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWRGEDVIGSADRT 285


>gi|168704975|ref|ZP_02737252.1| hypothetical protein GobsU_35915 [Gemmata obscuriglobus UQM 2246]
          Length = 519

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/322 (14%), Positives = 87/322 (27%), Gaps = 63/322 (19%)

Query: 78  FKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
           ++  + A   +GK+ L   ++ W   TR     +  A ++ Q+K+ LW EV +       
Sbjct: 62  YRVLVKASHSVGKSHLAGGLVNWWYDTRFPGVCLTTAPTDRQVKDVLWKEVRRQRRK--- 118

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                           +       +  D    T     ++     +F G H    + +  
Sbjct: 119 -------------RPGFVGPKMPRLESDP---THFAHGFTARDATSFQGQH-EASILLIF 161

Query: 198 DEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRT 257
           DEA G      ++             W+   N        Y         W    I    
Sbjct: 162 DEAVGIDGDFWEAAESMC--QGAEYGWLAIFNPTDTTSRAYLE-EQAGSRWTVIDIPATE 218

Query: 258 VEGIDSG---------------FHEGIISRYG---LDSDVARIEILGQFPQQEVNNFIPH 299
              I +                +    + ++       D    +I    P      + P 
Sbjct: 219 HPNIAAELVARPPEYPSAVRLNWLRDRLEQWAERIEPGDATPTDIQFPNPDGSPQWWRPG 278

Query: 300 NYIEE----------------AMSREAIDDLYAPL------IMGCDIAGEGGDKTVVVFR 337
              +                  + R        P+       +GCD+A  G D T +  R
Sbjct: 279 PLADARLLARWPASGCGVWSDPVWRSVERAAPDPVPERWLPQIGCDVARFGEDWTELHVR 338

Query: 338 RGNIIEHIFDWSAKLIQETNQE 359
            GN+  H    +    + T + 
Sbjct: 339 CGNVSLHHEAHNGWDTKRTTER 360


>gi|228924410|ref|ZP_04087639.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228835241|gb|EEM80653.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 293

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 1/138 (0%)

Query: 224 WIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE 283
             +  N  R +G FYD  N   + +K +++ +           E +  +YG  SDV R+ 
Sbjct: 1   MFLCGNPTRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVR 60

Query: 284 ILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIE 343
           +LG+FP+ E + FIP   +E+A S +        L +G D+A  G D+TV+  R GN + 
Sbjct: 61  VLGEFPKAEADAFIPLEIVEQAASCKVEPT-GETLDLGVDVARFGDDETVIAPRIGNKVF 119

Query: 344 HIFDWSAKLIQETNQEGC 361
            + +   +   ET     
Sbjct: 120 KLLNHYKQDTMETAGHVL 137


>gi|229844502|ref|ZP_04464642.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
 gi|229812751|gb|EEP48440.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
          Length = 452

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 94/280 (33%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++    T+P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E ++     D ++ R    G+         I   +I+ A+              I+
Sbjct: 186 KELMEDMVQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  + +W  + +  +    
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWHGEDVIGSADRT 285


>gi|326783799|ref|YP_004324193.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
 gi|310003811|gb|ADO98206.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
          Length = 552

 Score =  136 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 47/380 (12%), Positives = 96/380 (25%), Gaps = 64/380 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + +        ++++ E L  A+       F   +       + L  F            
Sbjct: 14  LKKANVAQNFTKKQVAEFLKCAQ---DPVYFAKNYVQIINLDEGLVPF------------ 58

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +       VNN +   F       R  GK+T     +L        ++I  +AN     
Sbjct: 59  EMYDFQEKLVNNFHNNRFNIC-KMPRQSGKSTTVVSYLLHYAIFNDSVTIGILANKAQTA 117

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           ++ L                   ++L            + SM +++K   I   T     
Sbjct: 118 RDLLGRL------------QIAYENLPKWMQQGIIAWNKGSMELENKSKIIAAST----- 160

Query: 181 PDTFVGPHNTHGMAVFNDEASGT----PDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +           +F DE +       D    S+    +        ++  +T R    
Sbjct: 161 --SASAVRGMSFNIIFLDEFAFVANHLADDFFSSVYPTISSG--KSTKVIIVSTPRGMNH 216

Query: 237 FYDIFNIP---LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           FY +++       ++    +    V G D  + E  I          R+E   +F     
Sbjct: 217 FYRLWHDAELGRNEYVTTDVHWSEVPGRDEAWKEQTIKNTSE--AQFRVEFECEFLGSVD 274

Query: 294 NNFIPHNYIEEAMSREA-----------IDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNI 341
               P                                +  D+A     D +  +      
Sbjct: 275 TLIAPSKLKTMVYDEPINTGKRGGEIYQNPIEKHNYSITVDVARGVEKDYSAFIVFD--- 331

Query: 342 IEHIFDWSAKLIQETNQEGC 361
                 +  K++ +      
Sbjct: 332 ---TTTFPYKVVAKYRNNTI 348


>gi|326782137|ref|YP_004322538.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM1]
 gi|310004344|gb|ADO98737.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM1]
          Length = 560

 Score =  136 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/366 (12%), Positives = 97/366 (26%), Gaps = 61/366 (16%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
           Q  ++++ E L   +C      F   +          E       W              
Sbjct: 20  QFSKEQIQEYL---KCKEDPVYFARNYIKIISLD---EGIVPFDMW---------DFQEE 64

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
            + + +   F  A    R  GK+T     +L  I     +++  +AN  +  ++ L    
Sbjct: 65  LIESFHENRFNIA-KLPRQTGKSTTCVSYLLHYILFNDNVNVGILANKLSTARDLLGRL- 122

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
                          + L L          + SM +++    +   T       +     
Sbjct: 123 -----------QLAYEQLPLWLQQGIVVYNKGSMELENGSKILAAST-------SASAVR 164

Query: 189 NTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--- 241
                 +F DE +  P    +    S+    T     +  ++  +T      FY ++   
Sbjct: 165 GMSFNIIFLDEFAFIPNHIAEQFFSSVYPTITSGTSTK--VIIISTPNGMNHFYKLWVDA 222

Query: 242 NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
                 +   ++    V G D+ + E  I+           E   +F    V+  I    
Sbjct: 223 QKGRNGYAWSEVHWSKVPGRDAKWKEQTIANTSERQ--FTQEFDCEFL-GSVDTLITAAK 279

Query: 302 IEEAMSREA-----------IDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNII--EHIFD 347
           +      +                    I+  D++     D +  V           +  
Sbjct: 280 LRTLTYDDPLTTNGSLDVYENPVRDHDYIICVDVSRGLAQDYSAFVVIDITHAPWRLVAK 339

Query: 348 WSAKLI 353
           +    +
Sbjct: 340 YRDHDV 345


>gi|257459276|ref|ZP_05624390.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
 gi|257443289|gb|EEV18418.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
          Length = 431

 Score =  136 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 58/308 (18%), Positives = 96/308 (31%), Gaps = 27/308 (8%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
           E    +                 C I  GR  G T   A   +  +    G  I+ +   
Sbjct: 3   ELALDLRYTPQQKAVFFQNDARFCTIEKGRRFGFTKGTANACIEWLL--EGQKILWVDTI 60

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
              LK          L  LP   W                    +     K   I     
Sbjct: 61  AANLKRYFERYFLPELRQLPKELW--------------------NWNAQDKQLKICGGYL 100

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
                +            V  +EA        +  + +      NPN    +    +  N
Sbjct: 101 DFRSAERPENIEGFGYDTVILNEAGIILKDPYLWDNAISPMLLDNPNSRAFIGGVPKGKN 160

Query: 235 GWFYDIFNIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQ 291
            +F         +  W+ +Q  +     +     + +++  G  DSDVAR EI G+F   
Sbjct: 161 KFFDLAQRGMRNEKGWRNFQFSSYDNPLLQKEEIDRLVAELGGADSDVARQEIFGEFLDT 220

Query: 292 EVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
             N+      IE A  ++   D  AP+I   D+A EG D++V+  R+G+ +E +  +   
Sbjct: 221 TSNSVFSLAAIEAAFRKQRYFDAGAPVIWALDVAREGDDESVLCKRQGDSVEPLKPYRIA 280

Query: 352 LIQETNQE 359
              E  +E
Sbjct: 281 STSELARE 288


>gi|282880015|ref|ZP_06288737.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
 gi|281306129|gb|EFA98167.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
          Length = 459

 Score =  136 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 52/333 (15%), Positives = 104/333 (31%), Gaps = 72/333 (21%)

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRP----------GMSIICIANSETQLKNTLWAEVS 129
            A+++G   GK  + A   +  +   P             I   A +  Q  N +  EV+
Sbjct: 2   VAVASGTSRGKDFVAACAAMCFMYLTPRWNINHRLIQNTKIAMTAPTGRQCINIMIPEVA 61

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
           +            +                  +  ++  + +T    S++  + + G H 
Sbjct: 62  RLFRNASVLPGRMLSDG---------------IRTNNAEWFLTAFKASDDNTEAWSGFHA 106

Query: 190 THGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWK 249
            + M     EASG  +    +I G     +         N     G+           +K
Sbjct: 107 VNTMF-VVTEASGVSETTFNAIEGNLQGNSRLLLVF---NPNVTTGYAAKAM--KSSRFK 160

Query: 250 RYQIDTRTVEGI-----------DSGFHEGIISRY----------------------GLD 276
           ++++++   E +           D  + +  +  +                         
Sbjct: 161 KFRLNSLNAENVIKKKNVIPGQVDYEWVKDKVHNWCELIQKEDFNNGEGDFMFEDSFYRP 220

Query: 277 SDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPL-----IMGCDIAGEGGDK 331
           +D+ RI++LG FP+   +  IP  ++E A  R    +    +      +G D+AG G D 
Sbjct: 221 NDLFRIKVLGLFPKASEDTLIPFEWLELAHDRWKKLNAEDFVPRKYARVGIDVAGMGRDS 280

Query: 332 TVVVFRRGNIIEHIFDWS---AKLIQETNQEGC 361
           +  V R GN +  I            +   E  
Sbjct: 281 SCFVLRYGNYVPEIKIHQSGGKADHMKVAGEAV 313


>gi|315649222|ref|ZP_07902312.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
 gi|315275441|gb|EFU38799.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
          Length = 189

 Score =  135 bits (340), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 50/223 (22%), Positives = 81/223 (36%), Gaps = 45/223 (20%)

Query: 15  LHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSN 74
           L ++            F                   P  WQ + M  V            
Sbjct: 11  LLDLYW-----DDPVAFA-----------EDMMGFDPDDWQCDVMMDVTQF--------- 45

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
               + ++ +G+G+GKT L A +++W +  RP   ++C A ++ QL + LW EVSKWL  
Sbjct: 46  ---PRTSVRSGQGVGKTGLEAALVIWFLCCRPNPKVVCTAPTKQQLHDVLWTEVSKWLEN 102

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
              ++  +     ++                 + +  T RT    +P+   G H    M 
Sbjct: 103 SMVKNLLKWTKTKVYM------------IGHEQRWFATARTA--NKPENMQGFH-EDYML 147

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              DEASG  D I ++ILG  +            N  R +G F
Sbjct: 148 FIVDEASGVSDPIMEAILGTLSGAENKLLMC--GNPTRTSGVF 188


>gi|113200627|ref|YP_717790.1| terminase large subunit [Synechococcus phage syn9]
 gi|76574526|gb|ABA47091.1| terminase large subunit [Synechococcus phage syn9]
          Length = 549

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/374 (12%), Positives = 109/374 (29%), Gaps = 61/374 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + +   + +    ++ E++   +C  +   F+  +       K L  F            
Sbjct: 13  LKKANVSQEFTPDQVAEVI---KCSENPVYFIKNYIKIVSLDKGLIPFD----------- 58

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +       V   +   F  A    R  GK+T+    +LW +     +++  +AN     
Sbjct: 59  -MYYFQEEMVQKFHDNRFNIA-KLPRQSGKSTIVTSYLLWYVLFNANVNVAILANKAATA 116

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  L                   ++L         +    S+ +++    +   T     
Sbjct: 117 REMLQRL------------QLSYENLPKWLQQGILQWNRGSLELENGSKILAAST----- 159

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +           +F DE +  P    D    S+    +        ++  +T      
Sbjct: 160 --SASAVRGMSFNVIFLDEFAFVPNHVADQFFSSVYPTISSG--KSTKVIIISTPHGMNM 215

Query: 237 FYDIFNIP---LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           FY +++       ++   ++    V G D+ + E  I          R+E   +F    V
Sbjct: 216 FYKLWHDAERKANEYIPTEVHWSEVPGRDAAWKEQTIKNTSEQQ--FRVEFECEFL-GSV 272

Query: 294 NNFIPHNYIEEAMSREA-----------IDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNI 341
           +  I  + +   +  +                    ++  D++    GD +  +      
Sbjct: 273 DTLISPSKLRTMVYGDPIAEKNGLSMYEKTIQGHTYVITADVSRGVSGDYSAFLVIDTTT 332

Query: 342 I--EHIFDWSAKLI 353
           I  + +  +    I
Sbjct: 333 IPYKLVAKYRNNDI 346


>gi|326783087|ref|YP_004323484.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
 gi|310005505|gb|ADO99893.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
          Length = 560

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/365 (12%), Positives = 96/365 (26%), Gaps = 59/365 (16%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
           Q  + ++ E L   +C      F M +          E       W              
Sbjct: 20  QFTKHQIQEYL---KCKEDPVYFAMNYIKIISLD---EGIVPFKMW---------DFQQE 64

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
            + + +   F  A    R  GK+T     +L  I     +++  +AN  +  ++ L    
Sbjct: 65  LIESFHEHRFNIA-KLPRQTGKSTTCVSYLLHYILFNDNVNVGILANKLSTARDLL---- 119

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
                    R     + L L          + SM +++    +   T       +     
Sbjct: 120 --------SRLQLAYEQLPLWIQQGIVVYNKGSMELENGSKILAAST-------SASAVR 164

Query: 189 NTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--- 241
                 +F DE +  P    +    S+    T     +  ++  +T      FY ++   
Sbjct: 165 GMSFNIIFLDEFAFIPNHIAEQFFSSVYPTITSGTSTK--VIIISTPNGMNHFYKLWVDA 222

Query: 242 NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
                 +   ++    V G D+ + E  I+           E   +F             
Sbjct: 223 QKGRNGYAWNEVHWSKVPGRDAKWKEQTIANTSERQ--FTQEFDCEFLGSVDTLITASKL 280

Query: 302 ----------IEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVFRRGNII--EHIFDW 348
                        ++            I+  D++     D +  V           +  +
Sbjct: 281 RVLTYDDVMTTNGSLDIYEKPIDKHEYIITVDVSRGLAQDYSAFVVIDITHAPWRLVAKY 340

Query: 349 SAKLI 353
             K +
Sbjct: 341 RDKDV 345


>gi|294789575|ref|ZP_06754810.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
 gi|294482512|gb|EFG30204.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
          Length = 516

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/332 (16%), Positives = 111/332 (33%), Gaps = 43/332 (12%)

Query: 24  CVLSFKNFV----MRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFK 79
            + +    V        P G       +   P   Q + + A+                K
Sbjct: 3   ILNNPLYHVFVKRYANDPVGFVLGVCGNSVSPD--QEKLLNAIID-----------PTAK 49

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRP----------GMSIICIANSETQLKNTLWAEVS 129
            ++ +G G GKT     + LW +   P          G +    A +  Q+ + +W E++
Sbjct: 50  VSVVSGTGTGKTMSFGRIALWHLLCFPVAKYDGKIEIGSNTYIGAPAIKQVGDGVWKEIT 109

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
             +  +         +  +       +     +      + IT     + +  +  G H 
Sbjct: 110 DAVQAMRANRATAWLAEYI-----VVQAERVYIIDYKATWFITKFAMQQGQSVSIAGKHR 164

Query: 190 THGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-- 247
            +   +  DEA+G  D   + I G  T+              +  G+FY+  +   ++  
Sbjct: 165 FYQ-LIIIDEAAGVSDEHYEVINGTQTQGGNRTLLASQG--VKQGGFFYETHHKLNKENG 221

Query: 248 --WKRYQIDTRTVEGIDSGFHEG-IISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE 304
             W      +     + + + E   +   G ++   R+ +LG+F + E  N +    IE 
Sbjct: 222 GNWTALCFSSENSPFVTTEWLENVALQAGGKNTTEYRVRVLGKFAENEHENLLTRAQIEP 281

Query: 305 AMSREAIDDLYAP--LIMGCDI-AGEGGDKTV 333
            +    I +   P   ++  D+ AGE  D +V
Sbjct: 282 RIDTLPIIEKGEPFGWLLLVDVGAGEYRDDSV 313


>gi|260580755|ref|ZP_05848581.1| phage terminase large subunit [Haemophilus influenzae RdAW]
 gi|260092572|gb|EEW76509.1| phage terminase large subunit [Haemophilus influenzae RdAW]
          Length = 447

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 89/280 (31%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLSLQAFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  I  W    + ++    
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRT 285


>gi|148826888|ref|YP_001291641.1| phage terminase large subunit [Haemophilus influenzae PittGG]
 gi|148718130|gb|ABQ99257.1| predicted phage terminase large subunit [Haemophilus influenzae
           PittGG]
          Length = 366

 Score =  131 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/280 (15%), Positives = 89/280 (31%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  R +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLRAFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  I  W    + ++    
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRT 285


>gi|319776448|ref|YP_004138936.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319897217|ref|YP_004135412.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|329123931|ref|ZP_08252483.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|317432721|emb|CBY81084.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317451039|emb|CBY87270.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
 gi|327468126|gb|EGF13613.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 447

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 89/280 (31%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  +  W    + ++    
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRT 285


>gi|145629503|ref|ZP_01785301.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145641440|ref|ZP_01797019.1| predicted phage terminase large subunit [Haemophilus influenzae
           R3021]
 gi|144978346|gb|EDJ88110.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145273983|gb|EDK13850.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.4-21]
 gi|309750959|gb|ADO80943.1| Probable bacteriophage terminase, large subunit [Haemophilus
           influenzae R2866]
          Length = 447

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 89/280 (31%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQVEMLGLQDFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  +  W    + ++    
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRT 285


>gi|226227228|ref|YP_002761334.1| hypothetical protein GAU_1822 [Gemmatimonas aurantiaca T-27]
 gi|226090419|dbj|BAH38864.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 549

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 53/283 (18%), Positives = 90/283 (31%), Gaps = 29/283 (10%)

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK-WLSMLPHR 138
            A+++G G GKT L A ++LW I+  P      +A    Q +  +W EV++ W       
Sbjct: 70  VAVASGTGTGKTFLEAVLLLWWIAVEPDSIATTVATKADQQEKGIWREVARHWPRFQACF 129

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
              E+ +L +    W  +                     EE      G H    + +  D
Sbjct: 130 PEAELTTLRIRMEPWRGDAW-------GAWGITAAPKAGEESSSAVQGLHA-KRLLILVD 181

Query: 199 EASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTV 258
           E  G P  +  +++   T            N                +     +I     
Sbjct: 182 ETPGVPQPVMTALVNTAT--GEENVIAAFGNPDYQADPLGQFAET--KRVTAIRISALDH 237

Query: 259 EGI-----------DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
             +                     +YG++S V +  + G  P+Q  +  I   +   A  
Sbjct: 238 PNVVLGVERIPGAATRLSIATREDKYGVESGVYQSRVRGIAPEQSASALIHLAWCVAAAD 297

Query: 308 REAIDDLYA----PLIMGCDIAG-EGGDKTVVVFRRGNIIEHI 345
           R       A    P  +G D+A  E GDK  V   +G  +  +
Sbjct: 298 RAESVQHAALALGPKALGVDVAQSENGDKAAVAMGQGARLLSV 340


>gi|218290759|ref|ZP_03494841.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239297|gb|EED06496.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 422

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 88/303 (29%), Gaps = 38/303 (12%)

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
           S+P   QL  +     H      + +   F+ A + GR  GKT   A  +       PG 
Sbjct: 7   SEPTSKQLR-LRLYTPHSGQVALHRSTARFRVA-TCGRRWGKTYACANEIAKWAWEHPGA 64

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
               +A +  Q                               +  +   +E++     + 
Sbjct: 65  MTWWVAPTYRQTLTAY-----------------------RIITRNFHGAIEKATTTHMRI 101

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINK-SILGFFTELNPNRFWIMT 227
              +         + F          +  DEA+  P    + ++    ++       +  
Sbjct: 102 EWKSGSITEFRSTENFDALRGEGLDFLVVDEAAMVPKEAWEAALRPTLSDKAGRAIIV-- 159

Query: 228 SNTRRLNGWFYDIFNIPLE----DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE 283
            +T +   WFY ++    +    +W+ ++  T     I     E   +     SDV R E
Sbjct: 160 -STPKGRNWFYHVWARGQDPAFPEWESFRFPTLANPYIPPEEVEEARTTL--PSDVFRQE 216

Query: 284 ILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIE 343
              +F +     F            E         ++G D+A    D +V+V        
Sbjct: 217 YEAEFLEDSAGVFRGIRDCISGQ--EEEPQPGRRYVVGWDVAKH-QDFSVLVVMDLERAH 273

Query: 344 HIF 346
            + 
Sbjct: 274 VVK 276


>gi|225155389|ref|ZP_03723881.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
 gi|224803845|gb|EEG22076.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
          Length = 479

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/297 (18%), Positives = 102/297 (34%), Gaps = 41/297 (13%)

Query: 54  WQLEFMEAVDVHCHSNVNNSNPTIFKCAISA-GRGIGK-TTLNAWMMLWLISTRPGMSII 111
           WQ + M +V                K  ++A   G GK + +   + L L+   PG +++
Sbjct: 38  WQAKIMASVWSG-------------KPTVAATPNGAGKTSVIIVALALTLLHEFPGATVV 84

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             + +   + + ++A ++   +      W                  +  +        I
Sbjct: 85  LTSATYRAVCDQIFASLAVHQAKFSAWKW-----------------NDTEINDGQGGRII 127

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
              T    R + F        + +  DEA    D I  +      +       +  S+  
Sbjct: 128 GFATDRGGRFEGFHAYPGR-PLLIILDEAKSIADDIFVAA-----DRCQPTMLLYISSWG 181

Query: 232 RLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
            L G F+D F+   + + ++Q        I   F E + ++YG DSD+ R  ILGQ P+ 
Sbjct: 182 GLFGRFHDAFS--QDRFAQFQAGIADCPHITPEFIEAMRAQYGEDSDIYRSMILGQRPKG 239

Query: 292 EVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
               F+      E               + CD A    D+ V+  R GN +  +  W
Sbjct: 240 NETGFVVPFVDYERCESNPPVWQEGTKQVFCDFAET-SDECVIAKRDGNRLSIVDAW 295


>gi|68250076|ref|YP_249188.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058275|gb|AAX88528.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 447

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 90/280 (32%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  +++F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLQNFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q              +  +   +             + +       T    V+ +E    
Sbjct: 86  Q--------------KTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIECAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  I  W    + ++    
Sbjct: 246 GFDVADEGADSNDNAFVHGSVVLDIEVWKNGDVIDSANRT 285


>gi|119386463|ref|YP_917518.1| PBSX family phage terminase large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377058|gb|ABL71822.1| phage terminase, large subunit, PBSX family [Paracoccus
           denitrificans PD1222]
          Length = 441

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/259 (16%), Positives = 85/259 (32%), Gaps = 20/259 (7%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  M+    T PG+S IC+ + +  L  +++  + +             
Sbjct: 26  GGRGSGKSWDRAMHMIVRHLTEPGLSSICLRDVQKSLDQSVFKLLVE------------- 72

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  L  +     +    +     +  I     +E   +             + +EA+  
Sbjct: 73  TAARLGVAEAIRPVESDRIIRTPGNGIIAFNGMNEFNAENIKSL--EGFDIAWWEEAATA 130

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL---EDWKRYQIDTRTVEG 260
                  +     +     +   T N R  +     +        +     + + R    
Sbjct: 131 GQGPLDMLRPTLRKPGSQIW--FTYNPRLRSDPVDVMMRQDARFADSRTVVEANWRDNPF 188

Query: 261 IDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIM 320
                 E  +     D    R    G +  +    FI    + EAM+R+    +   L++
Sbjct: 189 RGPELEEERLLDLAGDEARYRHIWEGDYEAESDMQFIGGGLVREAMARQPFSQIGDELVL 248

Query: 321 GCDIAGEGGDKTVVVFRRG 339
           G D+A  G D++V+  RRG
Sbjct: 249 GVDVARFGDDRSVIWARRG 267


>gi|86372240|gb|ABC95184.1| GP17-terminase [Stenotrophomonas phage Smp14]
          Length = 536

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/349 (14%), Positives = 93/349 (26%), Gaps = 58/349 (16%)

Query: 9   QKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHS 68
           Q  E EL E+      V  F               P   F     +Q + ++ V  +   
Sbjct: 28  QFSEWELDELEKCQNDVHYFIANYCMIISLDDGLVPFRMFG----YQKKMVDIVLAN--- 80

Query: 69  NVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAE 127
                     + +I    R +GKTT+ A ++LW         I  +AN   Q +  L   
Sbjct: 81  ----------RFSIFKWPRQMGKTTVVAAILLWYAIFNEEYRIAILANKGDQSREILARL 130

Query: 128 VSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
                           + L        +   + ++ + ++    T  T            
Sbjct: 131 ------------QLMYEELPWFMQVGVSVWNKGNIKLGNRSEVFTAAT-------GGSSI 171

Query: 188 HNTHGMAVFNDEASGTPDII-NKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE 246
                  ++ DE +   + +   +              I+TS        FY I+     
Sbjct: 172 RGKSVNLMYLDEFAFVENDVDFYTSTYPVVTSGTKTKVIITSTPN-GMNLFYKIWTDSTN 230

Query: 247 DWKRYQID---TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI- 302
               Y  +          D  + +  +            E L +F         P     
Sbjct: 231 GKNNYVHNEAFWHDHPKRDQAWKDEQLRNMSERQ--FEQEFLCKFQGSSDTLLSPAKLEQ 288

Query: 303 --------EEAMSREAI----DDLYAPLIMGCDIA-GEGGDKTVVVFRR 338
                   E   +R+          A  ++  D++ G G D +V+    
Sbjct: 289 LTYQDHIRELGGNRDFKIYEDPIKDASYVVTVDVSEGIGKDYSVISVFD 337


>gi|329119006|ref|ZP_08247700.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464879|gb|EGF11170.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 449

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/280 (15%), Positives = 91/280 (32%), Gaps = 23/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A + + +   R G  I+C    +  L ++++  +++ ++ L +   FE+
Sbjct: 20  GGRGSGKSYFLAELAVEVA-RRIGTVILCAREFQGSLDDSVYQLLTETIARLGYTQEFEI 78

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
              S+                             +                 + +EA   
Sbjct: 79  LKSSIR---------------HKGTGAKFVFYGVKNNITKIKSIQGVG--ICWVEEAEAV 121

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRYQIDTRTVEGI- 261
                  ++           W+   N + +    Y  F   P +D    + +        
Sbjct: 122 TKNSWDVLIPSIRGDKNAEIWVSF-NPKNILDDTYQRFIVHPPKDSIVLKANYDINPHFA 180

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLI 319
           D+     ++     D D+ R   LG+         I  ++IE A+              I
Sbjct: 181 DTPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAAIDAHEKLGFSAAGRRI 240

Query: 320 MGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           +G D+A EG D    V R G+++  +  W  + +  +  +
Sbjct: 241 LGFDVADEGDDANATVLRHGSVVTDMQQWRGQDVIYSADK 280


>gi|301170180|emb|CBW29784.1| predicted phage terminase large subunit [Haemophilus influenzae
           10810]
          Length = 447

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 88/280 (31%), Gaps = 24/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++      P + ++C    +  + +++   ++  + ML  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQVEMLGLQDFFDV 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           Q   +                 +             + +       T    V+ +E    
Sbjct: 86  QKTQIIEQ--------------NGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENV 127

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  ++    E       I++ N + +    Y  F   P E  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               E +      D ++ R    G+         I   +IE A+               +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           G D+A EG D     F  G+++  I  W    + ++    
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGYVIDSANRT 285


>gi|150021340|ref|YP_001306694.1| hypothetical protein Tmel_1462 [Thermosipho melanesiensis BI429]
 gi|149793861|gb|ABR31309.1| protein of unknown function DUF264 [Thermosipho melanesiensis
           BI429]
          Length = 421

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/289 (15%), Positives = 90/289 (31%), Gaps = 37/289 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            I AGR  GKT   A  + +  +  P   +I    S  Q K   +  +++ + + P + +
Sbjct: 38  VICAGRRFGKTNYVAGKIFYYATIHPKSRVIVGGPSLDQAK-IYYDLLTEAIELSPLKGF 96

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
            +    S  P+ +       ++                                V   EA
Sbjct: 97  VKKTKDSPFPTIYLKNGSSITVRST---------------AHNGKYLRGRKVNLVVLTEA 141

Query: 201 SGTPDIINK-SILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP---LEDWKRYQIDTR 256
           +   D + +  I     +       ++  +T     +FY+ +       +    +     
Sbjct: 142 AFIKDSVYEQVITPMKLDTGAP---VILESTPNGMNYFYEEYQRGLKNKKHTISFHATVY 198

Query: 257 TVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
               +D    E   ++      V R E L +F   +   F P   + EA   +   + Y 
Sbjct: 199 DNPFLDQEEIENAKAKT--PDYVWRQEYLAEFVD-DDTVFFPWKILVEAFE-DYKPEGYK 254

Query: 317 P---LIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCP 362
                 +G D+A    D TV+      I+  + +   K+ +       P
Sbjct: 255 DGRKYSIGVDLAKY-RDYTVI------IVLDVTEEPFKIAEFHRFNQIP 296


>gi|282598783|ref|YP_003359102.1| putative large subunit terminase [Clavibacter phage CMP1]
 gi|262212571|gb|ACY35907.1| putative large subunit terminase [Clavibacter phage CMP1]
          Length = 872

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/288 (17%), Positives = 90/288 (31%), Gaps = 32/288 (11%)

Query: 91  TTLNAWMMLWLISTRPG--MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSL 148
           T L   ++ W +S  P    S++  A    Q+   ++  +    ++   R    +  ++ 
Sbjct: 424 TRLAGDLVTWFVSVFPPEETSVMVSAPIREQIDVMMFRYLRDNYNLAIEREQPLIGEITK 483

Query: 149 HPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN 208
            P        +    +D K      R        +F G H    +AV  DEA G P+ + 
Sbjct: 484 WP------YWQVGAPLDKKLVMP-KRPADGNLISSFQGIH-DGHVAVVLDEAGGLPEDLY 535

Query: 209 KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED--WKRYQIDTRTVEGIDSGFH 266
                  T  +         N  + N  F++ F    +   W R+ I             
Sbjct: 536 IGANAVTTNFHARIL--AIGNPDKRNTPFHERFTDTEKFSSWNRFTIGAEDTPNFTGEKI 593

Query: 267 EG------------------IISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSR 308
                               +  R      V   ++ G FP+ +   F   + I    S 
Sbjct: 594 YEDPAKDEDVKKHLVQVSWAVEMRKSARPSVVAAKVDGNFPESDDTTFFDQSVINRGYST 653

Query: 309 EAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQET 356
           E   +      MG DI+ +G D++V     G  I    +W+     E 
Sbjct: 654 EIEPESTDFKYMGVDISYQGEDQSVAYINHGGQIRIADEWNRFDGAEH 701


>gi|85058727|ref|YP_454429.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779247|dbj|BAE74024.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 456

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/289 (13%), Positives = 88/289 (30%), Gaps = 24/289 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
            P  +K A   GRG GK+   A +++ +   R     +C    +  + +++   ++  + 
Sbjct: 13  QPHRYKIA-KGGRGSGKSWAIARLLVEIA-RRGTYRFLCAREFQASMADSVIQLIADTIQ 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +      +  +   +                   +           
Sbjct: 71  REGYLKEFEIQKAYIRYLATDSLFMFYGIKN-----------------NVTKIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   PL+D     
Sbjct: 114 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVNPLDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           +               +      D D+      G+         I   +I  A+      
Sbjct: 172 VHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHITL 231

Query: 313 --DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
             +      +G D+A EG D   ++   G+++ H+  W+   + ++   
Sbjct: 232 GFEPAGKKRIGFDVADEGEDSNALILSHGSVVMHLETWNKGDVIQSADR 280


>gi|268589862|ref|ZP_06124083.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
 gi|291314845|gb|EFE55298.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
          Length = 470

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/277 (14%), Positives = 85/277 (30%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              + + FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYNNEFEIQRTMIKHLGTGAEFMFYGIKNNPT-----------------KIKSLEGVD 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    + N    W+   N + +    Y  F   P +D     
Sbjct: 114 VCWVEEAEAVTKESWDILIPTIRKPNSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
            +              +      +  + R   LG+         I   ++E A       
Sbjct: 172 ANYTDNPHFPDVLRLEMEECKRKNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  +I   D +  GGD      R G++++ I +
Sbjct: 232 GWKAKGAIIATHDPSDVGGDAKGYAMRHGSVVKRISE 268


>gi|283956317|ref|ZP_06373797.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792037|gb|EFC30826.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 430

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 99/310 (31%), Gaps = 36/310 (11%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
                  V +     F   ++ GR +G T  +A  ++  +    G +++ +        +
Sbjct: 9   YTPAQLKVFDDKNPRF-ITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWV--------D 57

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
           T+ A +  +  +               P          S  +  K   I          +
Sbjct: 58  TIQANLQNYYELY------------FTPELKNLPKDFYSWSVQDKKLIINGAVLHMRSAE 105

Query: 183 TFVGPHNTHGMAVFNDEASGTPDI------INKSILGFFTELNPNRFWIMTSNTRRLNGW 236
                       V  +EA               +I       +  +   +     +    
Sbjct: 106 RSENIEGFGYDLVILNEAGIILKGSKGEYLWYNAIRPMLL--DNPKSRAIIGGVPKGKNL 163

Query: 237 FYDIFNIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEV 293
           FY++    L D  WK +Q  +     +     + +I   G  DS+V + EI G+F     
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEDSEVVKQEIYGEFIDSSS 223

Query: 294 NNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                   IE AMS+ +   + +    I G D+A  G DK+V+  R+G I++ I  +S  
Sbjct: 224 AELFALTEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSVLAKRKGFIVDEIKKYSQL 283

Query: 352 LIQETNQEGC 361
              E      
Sbjct: 284 GTMELANRIL 293


>gi|85059798|ref|YP_455500.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84780318|dbj|BAE75095.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 483

 Score =  126 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/289 (13%), Positives = 88/289 (30%), Gaps = 24/289 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
            P  +K A   GRG GK+   A +++ +   R     +C    +  + +++   ++  + 
Sbjct: 13  QPHRYKIA-KGGRGSGKSWAIARLLVEIA-RRGTYRFLCAREFQASMADSVIQLIADTIQ 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +      +  +   +                   +           
Sbjct: 71  REGYLKEFEIQKAYIRHLATDSLFMFYGIKN-----------------NVTKIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   PL+D     
Sbjct: 114 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVNPLDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           +               +      D D+      G+         I   +I  A+      
Sbjct: 172 VHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHMTL 231

Query: 313 --DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
             D      +G D+A EG D   + F +G+++  + +W    +  ++  
Sbjct: 232 GFDAVGEKRLGFDVADEGEDCNALCFVQGSVVLDLDEWHRGDVIASSNR 280


>gi|309379923|emb|CBX21334.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 449

 Score =  126 bits (315), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/280 (15%), Positives = 90/280 (32%), Gaps = 23/280 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A + +  +S R G  I+C    +  L ++++  + + +  L +   F++
Sbjct: 20  GGRGSGKSYFLAELAV-EVSRRIGTVILCAREFQGSLDDSVYQLLIETIERLGYTEEFDI 78

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
              ++                             +                 + +EA   
Sbjct: 79  LKSTI---------------THKGTGAKFVFYGIKNNVTKIKSIQGVGV--CWVEEAEAV 121

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRYQIDTRTVEGI- 261
                  ++           W+   N + +    Y  F   P +D    + +        
Sbjct: 122 TKNSWDVLIPSIRGDKNAEIWVSF-NPKNILDDTYRRFIVHPPQDSIVLKANYDINPHFA 180

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLI 319
           D+     ++     D D+ R   LG+         I  ++IE A+              I
Sbjct: 181 DTPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAAIDAHEKLGFQAAGKRI 240

Query: 320 MGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           +G D+A EG D    V R G+++  +  W  + +  +  +
Sbjct: 241 LGFDVADEGDDANATVLRHGSVVTDMRQWRGQDVIYSADK 280


>gi|154175204|ref|YP_001409090.1| Ppx/GppA family phosphatase [Campylobacter curvus 525.92]
 gi|112803006|gb|EAU00350.1| phosphatase, Ppx/GppA family [Campylobacter curvus 525.92]
          Length = 433

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/314 (18%), Positives = 97/314 (30%), Gaps = 42/314 (13%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
             WQ E                        I  GR  G T   A   +  +    G  I+
Sbjct: 11  TDWQREVF-------------FKNKAKFTTIEKGRRSGFTKGMANACIEWLI--EGKKIL 55

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
            +      L+          L  LP   W               +   Q   +      +
Sbjct: 56  WVDTVTANLQRYFERYFVPELKQLPADMW---------------KFHAQDKKLTVGEGYL 100

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGT---PDIINKSILGFFTELNPNRFWIMTS 228
             R+      +            V  +EA        + + +I     +  PN    +  
Sbjct: 101 DMRSA-----ERPENIEGFGYDVVILNEAGIILKNSYLWDNAIRPMLLD-YPNSRAFIGG 154

Query: 229 NTRRLNGWFYDIFNIPLE--DWKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEIL 285
             +  N +F           DW  +QI +     +     + +I+  G  DSDV + EI 
Sbjct: 155 VPKGKNRFFDLASRGMRNEKDWVNFQISSFENPLLRKEEIDELIAELGGVDSDVVKQEIY 214

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHI 345
           G+F     N   P + IE A  +    +  A  I G D+A +G D++V+  R G  ++++
Sbjct: 215 GEFLDTTTNALFPLSQIEAAFGKVRAYEPNAVQIWGLDVARDGDDESVLCVREGYHVKNL 274

Query: 346 FDWSAKLIQETNQE 359
             +      E  +E
Sbjct: 275 EGFRIASTTELARE 288


>gi|331035425|gb|AEC52982.1| large terminase protein [Synechococcus phage S-CRM01]
          Length = 567

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/377 (11%), Positives = 101/377 (26%), Gaps = 72/377 (19%)

Query: 10  KLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSN 69
             ++++ E++   +C    + F+  +    IK   L+H   P +                
Sbjct: 21  YTKEQIAELI---KCSQDPEYFLENY----IKIISLDHGIIPFK--------PYNFQRKL 65

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVS 129
           VN+ +   F       R  GK+T     ++     R  ++I  +AN        +     
Sbjct: 66  VNSFHDNRF-TICKLPRQCGKSTTVTAYLIHQAIFRDNINIAILANKRETAYELM----- 119

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
                   +     ++L            + S+ +++        T              
Sbjct: 120 -------AKLQLSYENLPKWMQQGVLGWNKGSIELENGSRITASSTS-------SSAVRG 165

Query: 190 THGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP- 244
                V  DE +  P    D    S+    +        ++  +T      FY ++    
Sbjct: 166 FAYNIVMLDEFAFVPTNVADDFFSSVYPTISSG--KSTKVIIVSTPCGMNHFYKMWTDAT 223

Query: 245 --LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP---- 298
                +   +     V G D  F +  I+   L     + E    F         P    
Sbjct: 224 KGRNSYNPIEAHWSEVPGRDEKFKQETIANTSLSQ--WQQEFETDFIGSVGTLINPAKLK 281

Query: 299 -------------HNYIEEAM--SREAIDDLYAPLIMGCDIAGEGG-DKTVVVFRRGNII 342
                         +  E  +       +      ++  D++     D +        ++
Sbjct: 282 SLVYDEPLLSSGGLDVYEHPIMKDENDENSRDHEYMITVDVSRGMKLDYSAF------LV 335

Query: 343 EHIFDWSAKLIQETNQE 359
             I  +  +L+ +    
Sbjct: 336 FDITQYPHRLVAKYRNN 352


>gi|237704849|ref|ZP_04535330.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|226901215|gb|EEH87474.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|315288241|gb|EFU47640.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           110-3]
          Length = 471

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|260868683|ref|YP_003235085.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|293446697|ref|ZP_06663119.1| phage terminase large subunit [Escherichia coli B088]
 gi|257765039|dbj|BAI36534.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|291323527|gb|EFE62955.1| phage terminase large subunit [Escherichia coli B088]
 gi|323177130|gb|EFZ62720.1| phage terminase, large subunit, PBSX family [Escherichia coli 1180]
          Length = 471

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|157159763|ref|YP_001457081.1| PBSX family phage terminase large subunit [Escherichia coli HS]
 gi|300935792|ref|ZP_07150755.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
 gi|157065443|gb|ABV04698.1| phage terminase, large subunit, pbsx family [Escherichia coli HS]
 gi|300459025|gb|EFK22518.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
          Length = 471

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|324019922|gb|EGB89141.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           117-3]
          Length = 471

 Score =  122 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKCIAE 268


>gi|320103661|ref|YP_004179252.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
 gi|319750943|gb|ADV62703.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
          Length = 553

 Score =  122 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 65/368 (17%), Positives = 120/368 (32%), Gaps = 46/368 (12%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
           +  +++  + L   LM  E         +R       G       +P  W+         
Sbjct: 1   MRKEKEEIRTLATPLMVEESTAGMVARALRCLADDPVGFNRLALGRPDYWEG-------- 52

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
                   +        ++ G  +GK+ L A + LW + T PG  ++  A S+  L   L
Sbjct: 53  --QRRAALALTRARSVVVATGNAVGKSYLAAGLTLWWLYTHPGSLVVATAPSQGLLGTVL 110

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSG-WYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           + E+ K L+    R       +     G  ++  +     + ++ +            + 
Sbjct: 111 FRELQKALAASRRRGLGLPGMVVGSDRGTPFSLRVGPGRRLAAEGWGCLGIATRG--VER 168

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
             G H+   M V  DEASG      +++          R   +  N       F+ +   
Sbjct: 169 LAGRHHADLM-VVVDEASGVQPEAWEALTSL-----NPRKLFVCGNPLTPGTVFHKLHQR 222

Query: 244 PLE-----------DWKRYQIDTRTVEGIDSG----------FHEGIISRYGLDSDVARI 282
            L                  I +     I+            F      ++G  S +   
Sbjct: 223 GLTEASDPSIPDHARGVALTIPSTASPDINLERSPRGLADRGFIREAERQWGRGSPLWLS 282

Query: 283 EILGQFPQQEVNNFIPHNYIEEAMSRE----AIDDLYAPLIMGCDI-AGEGGDKTVVVFR 337
            + G FP   V+  I   ++++A S E      +    P ++GCD+ AG G D+T +V R
Sbjct: 283 HVEGVFPTVAVHALIEPGWLDQAASLERSQTYENPPGQP-VLGCDLAAGVGADRTAIVVR 341

Query: 338 RGNIIEHI 345
               I  +
Sbjct: 342 DEGGIREL 349


>gi|315929403|gb|EFV08605.1| phosphatase, Ppx/GppA family [Campylobacter jejuni subsp. jejuni
           305]
          Length = 430

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 98/310 (31%), Gaps = 36/310 (11%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
                  V +     F   ++ GR +G T  +A  ++  +    G +++ +        +
Sbjct: 9   YTPAQLKVFDDKNPRF-ITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWV--------D 57

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
           T+ A +  +  +               P          S  +  K   I          +
Sbjct: 58  TIQANLQNYYELY------------FTPELKNLPKDFYSWSVQDKKLIINGAVLHMRSAE 105

Query: 183 TFVGPHNTHGMAVFNDEASGTPDI------INKSILGFFTELNPNRFWIMTSNTRRLNGW 236
                       V  +EA               +I       +  +   +     +    
Sbjct: 106 RSENIEGFGYDLVILNEAGIILKGSKGEYLWYNAIRPMLL--DNPKSRAIIGGVPKGKNL 163

Query: 237 FYDIFNIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEV 293
           FY++    L D  WK +Q  +     +     + +I   G   S+V + EI G+F     
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFIDSSS 223

Query: 294 NNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 + IE AMS+ +   + +    I G D+A  G DK+ +  R+G +I  I  +S  
Sbjct: 224 AELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKKYSQL 283

Query: 352 LIQETNQEGC 361
              E   +  
Sbjct: 284 GTIELANKIL 293


>gi|57237579|ref|YP_178593.1| terminase B protein, putative [Campylobacter jejuni RM1221]
 gi|57166383|gb|AAW35162.1| terminase B protein, putative [Campylobacter jejuni RM1221]
          Length = 430

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 98/310 (31%), Gaps = 36/310 (11%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
                  V +     F   ++ GR +G T  +A  ++  +    G +++ +        +
Sbjct: 9   YTPAQLKVFDDKNPRF-ITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWV--------D 57

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
           T+ A +  +  +               P          S  +  K   I          +
Sbjct: 58  TIQANLQNYYELY------------FTPELKNLPKDFYSWSVQDKKLIINGAVLHMRSAE 105

Query: 183 TFVGPHNTHGMAVFNDEASGTPDI------INKSILGFFTELNPNRFWIMTSNTRRLNGW 236
                       V  +EA               +I       +  +   +     +    
Sbjct: 106 RSENIEGFGYDLVILNEAGIILKGSKGEYLWYNAIRPMLL--DNPKSRAIIGGVPKGKNL 163

Query: 237 FYDIFNIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEV 293
           FY++    L D  WK +Q  +     +     + +I   G   S+V + EI G+F     
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFIDSSS 223

Query: 294 NNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 + IE AMS+ +   + +    I G D+A  G DK+ +  R+G +I  I  +S  
Sbjct: 224 AELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKKYSQL 283

Query: 352 LIQETNQEGC 361
              E   +  
Sbjct: 284 GTIELANKIL 293


>gi|310005828|gb|ADP00213.1| DNA maturase beta subunit [Cyanophage Syn26]
          Length = 577

 Score =  122 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 52/371 (14%), Positives = 87/371 (23%), Gaps = 81/371 (21%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            FK F+     W     P      P R Q     A+  +  S          +  I A R
Sbjct: 11  DFKLFLQAL--WDQLDLP-----SPTRAQ----YAIADYLQSGPK-------RLQIQAFR 52

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ +    +LW +       I+ I+ S+ +  N         +     +H       
Sbjct: 53  GVGKSWITGAFVLWTLFNNAEKKIMIISASKERADNMSIFLQKLIIETPWLKHLRPKSDD 112

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCR----------TYSEERPDTFVGPHNTHGMAVF 196
           +      +  L         K   IT +              E P   +       +   
Sbjct: 113 ARWSRISFDVLCSPHQAPSVKSVGITGQMTGSRADLMILDDIEVPGNSMTELMREKLLQL 172

Query: 197 NDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
             EA                 P                   W      + +  +   I  
Sbjct: 173 CTEAESILTPKDDSRIMYLGTPQTTFTVYRKLAERNYRPFVWPARF-PKNITPYEGLIAP 231

Query: 243 IPLEDWKRYQID--TRTVEGIDSGFHEGIISRYGLDSDVARIE----------------- 283
              ED         +   +  D        S  G  + + +                   
Sbjct: 232 QLQEDIDNGAQPGESTDPDRFDDEDLLQRESSMGRSNFMLQFMLDTSLSDAEKFPLKMAD 291

Query: 284 --ILGQFPQQEVNNFI-----------------PHNYIEEAMSREAIDDLYAPLIMGCDI 324
             +    P +  +N I                 P +Y    M  +     Y   I   D 
Sbjct: 292 LVVTSVNPTEAPDNVIWCSDPRNVIKDLPTVGLPGDYFYSPMQLQGEWTPYQETICSVDP 351

Query: 325 AGEGGDKTVVV 335
           +G G D+T   
Sbjct: 352 SGRGSDETAAC 362


>gi|294492319|gb|ADE91075.1| phage terminase, large subunit, PBSX family [Escherichia coli
           IHE3034]
          Length = 471

 Score =  122 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|222032743|emb|CAP75482.1| Terminase large subunit [Escherichia coli LF82]
          Length = 470

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|91211665|ref|YP_541651.1| terminase large subunit [Escherichia coli UTI89]
 gi|117624554|ref|YP_853467.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|218559279|ref|YP_002392192.1| Terminase large subunit [Escherichia coli S88]
 gi|91073239|gb|ABE08120.1| terminase large subunit [Escherichia coli UTI89]
 gi|115513678|gb|ABJ01753.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|148566126|gb|ABQ88401.1| phage terminase large subunit [Enterobacteria phage CUS-3]
 gi|218366048|emb|CAR03793.1| Terminase large subunit [Escherichia coli S88]
 gi|307626097|gb|ADN70401.1| terminase large subunit [Escherichia coli UM146]
 gi|323948780|gb|EGB44679.1| phage terminase large subunit [Escherichia coli H252]
          Length = 471

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|13559866|ref|NP_112076.1| terminase large subunit [Enterobacteria phage HK620]
 gi|13517602|gb|AAK28891.1|AF335538_43 terminase large subunit [Salmonella phage HK620]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|325497784|gb|EGC95643.1| gene 2 protein [Escherichia fergusonii ECD227]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|300897414|ref|ZP_07115839.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
 gi|300358826|gb|EFJ74696.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|41057280|ref|NP_958178.1| gene 2 protein [Enterobacteria phage Sf6]
 gi|191165541|ref|ZP_03027382.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218695968|ref|YP_002403635.1| Terminase large subunit [Escherichia coli 55989]
 gi|331678314|ref|ZP_08378989.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
 gi|33334159|gb|AAQ12192.1| gene 2 protein [Shigella phage Sf6]
 gi|190904464|gb|EDV64172.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218352700|emb|CAU98482.1| Terminase large subunit [Escherichia coli 55989]
 gi|324114096|gb|EGC08069.1| phage terminase large subunit [Escherichia fergusonii B253]
 gi|331074774|gb|EGI46094.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|260856407|ref|YP_003230298.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
 gi|257755056|dbj|BAI26558.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 84/277 (30%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS--REA 310
           ++              +      +  + R   LG+         I   ++E A     + 
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHTKL 231

Query: 311 IDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|323936486|gb|EGB32774.1| phage terminase large [Escherichia coli E1520]
          Length = 470

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|168260952|ref|ZP_02682925.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|205349913|gb|EDZ36544.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
          Length = 471

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKTFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|310005737|gb|ADP00124.1| DNA maturase beta subunit [Cyanophage NATL1A-7]
          Length = 577

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/374 (13%), Positives = 86/374 (22%), Gaps = 81/374 (21%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               FK F+     W     P      P R Q     ++  +             +  I 
Sbjct: 8   LKDDFKLFLQAL--WEELDLP-----SPTRAQ----YSIADYLQHGPK-------RLQIQ 49

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RG+GK+ +    +LW +   P   I+ I+ S+ +  N         +     +H    
Sbjct: 50  AFRGVGKSWITGAFVLWTLFKDPEKKIMIISASKERADNMSIFLQKLIIETAWLKHLRPK 109

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHGM 193
              S      +  L         K   IT +              E P   +       +
Sbjct: 110 SEDSRWSRISFDVLCSPHQAPSVKSVGITGQLTGSRADLMILDDIEVPGNSMTELMREKL 169

Query: 194 AVFNDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYD 239
                EA                 P                   W      + L  +   
Sbjct: 170 LQLCTEAESILTPKDDSRIMYLGTPQTTFTVYRKLAERAYRPFVWPARY-PKSLANYEGL 228

Query: 240 IFNIPLEDWK--RYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE-------------- 283
           I     ED             +  +        +  G  + + +                
Sbjct: 229 IAPQLQEDIDIGAEAGACTDPDRFNDDDLIEREASMGRSNFMLQFMLDTSLSDAEKFPLK 288

Query: 284 -----ILGQFPQQEVNNFI-----------------PHNYIEEAMSREAIDDLYAPLIMG 321
                +    P +  ++ +                 P +Y    M  +     Y   I  
Sbjct: 289 MADLVVTSVNPYEAPDSVVWCSDPRNVIKELPTVGLPGDYFYSPMQLQGEWSKYTETICS 348

Query: 322 CDIAGEGGDKTVVV 335
            D +G G D+T   
Sbjct: 349 VDPSGRGSDETAAA 362


>gi|298381518|ref|ZP_06991117.1| phage terminase large subunit [Escherichia coli FVEC1302]
 gi|298278960|gb|EFI20474.1| phage terminase large subunit [Escherichia coli FVEC1302]
          Length = 470

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/277 (12%), Positives = 82/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+             ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIFKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|168239626|ref|ZP_02664684.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197287704|gb|EDY27095.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 470

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 83/277 (29%), Gaps = 24/277 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYAAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILVPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI- 311
           ++              +      +  + R   LG+         I   ++E A       
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKL 231

Query: 312 -DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
                  ++   D +  G D      R G++++ I +
Sbjct: 232 GWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAE 268


>gi|294663744|gb|ADF29298.1| terminase [Pseudomonas phage JG024]
          Length = 460

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKSTGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDSCVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D + A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GN+I  + +W   
Sbjct: 236 PAGSKRIGFDVADDGDDANATTLMHGNVIMEVDEWDGL 273


>gi|315122636|ref|YP_004063125.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496038|gb|ADR52637.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 301

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 4/152 (2%)

Query: 10  KLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSN 69
           + +  L + ++      +   F    + WG +G PL +   P  WQ E    +      N
Sbjct: 10  EYDTALLQNVLSPAIAGNPLAFTKYMYRWGEEGTPLANCKGPRAWQTEVFLELAEFIEKN 69

Query: 70  VNNS----NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLW 125
                      +FK AI++ RGIGKT L AW+  W +STR G +++  ANS+ Q K T +
Sbjct: 70  KEAKRLGKPLQVFKLAIASARGIGKTALVAWITYWFLSTRIGCTVVISANSDDQCKTTSF 129

Query: 126 AEVSKWLSMLPHRHWFEMQSLSLHPSGWYAEL 157
           AE+ +W S+  + H+FE        +G  +  
Sbjct: 130 AEIRRWHSLAKNAHFFEANIAEALLAGGCSPW 161


>gi|153951273|ref|YP_001397540.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|153951467|ref|YP_001398214.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938719|gb|ABS43460.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938913|gb|ABS43654.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 430

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 93/293 (31%), Gaps = 35/293 (11%)

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
             ++ GR +G T      ++  +    G +++ +        +T+ A +  +  +     
Sbjct: 25  ITVAKGRRLGFTRGCVKYVIENLI--EGKNVLWV--------DTIQANLQNYYELY---- 70

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                     P          S  +  K   I          +            V  +E
Sbjct: 71  --------FTPELKNLPKDFYSWSVQDKKLIINGAVLHMRSAERSENIEGFAYDLVILNE 122

Query: 200 ASGTPDI------INKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED--WKRY 251
           A               SI       +  +   +     +    FY++    L D  WK +
Sbjct: 123 AGIILKDSKGGYLWYNSIRPMLL--DNPKSRAIIGGVPKGKNLFYELCRKELSDKNWKHF 180

Query: 252 QIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
           Q  +     +     + +I   G   SDV R EI G+F           + IE AMS+ +
Sbjct: 181 QFSSYDNPFLKEEQIKELIEEVGGESSDVVRQEIYGEFIDSSSAELFSLSGIENAMSKNS 240

Query: 311 IDDLY--APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
                     I G D+A  G DK+V+  R+G +I+ +  +S     E   +  
Sbjct: 241 FSTQKMQGENIWGLDVARYGDDKSVLAKRKGFVIDELKKYSQLGTIELANKIL 293


>gi|261381054|ref|ZP_05985627.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
 gi|284796087|gb|EFC51434.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
          Length = 450

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/282 (14%), Positives = 95/282 (33%), Gaps = 23/282 (8%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
           ++  GRG  K+   A +++ L        I+C    +  + +++ + +S  +    +   
Sbjct: 20  SLRGGRGGMKSWAVATVLVELARKGR-FRIMCARELQNSISDSVISLLSDTIDRAGYTQE 78

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
           +E+Q   +      +E L   +  +                              + +EA
Sbjct: 79  YEVQRNRIIHLSTGSEFLFYGIKNNPTKIKSI-----------------EAIDICWIEEA 121

Query: 201 SGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVE 259
               D     ++    +      W+   N + +    Y  F   P +D     ++     
Sbjct: 122 ENVSDESWNILIPTIRKAGSE-IWLTW-NPKNILDPTYQRFVVNPPDDMVDIVVNYTDNI 179

Query: 260 GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAP 317
            +         S    D D+ R   LG+       + I   +I+ A+        +    
Sbjct: 180 YLPEVLRLEAESCKARDYDLYRHIWLGEPVADSELSVIKPKWIDAAIDSHIKLGFEATGQ 239

Query: 318 LIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
            I+G D+A EG D +  + R G+++  + +W  + +  +  +
Sbjct: 240 RILGFDVADEGDDASATILRHGSVVIDMDEWRGQDVIYSADK 281


>gi|218148543|ref|YP_002364311.1| terminase, large subunit [Pseudomonas phage 14-1]
 gi|218059739|emb|CAU13815.1| terminase, large subunit [Pseudomonas phage 14-1]
          Length = 460

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKITGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDSCVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D + A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GN+I  + +W   
Sbjct: 236 PAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGL 273


>gi|218457805|ref|YP_002418810.1| terminase, large subunit [Pseudomonas phage SN]
 gi|218379073|emb|CAT99652.1| terminase, large subunit [Pseudomonas phage SN]
          Length = 460

 Score =  120 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKSTGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDSCVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D + A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GN+I  + +W   
Sbjct: 236 PAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGL 273


>gi|197261421|ref|YP_002154236.1| putative terminase, large subunit [Pseudomonas phage LMA2]
 gi|197244511|emb|CAR31245.1| putative terminase, large subunit [Pseudomonas phage LMA2]
          Length = 460

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 37/278 (13%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKITGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDSCVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D + A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GNII  + +W   
Sbjct: 236 PAGSKRIGFDVADDGEDANATTLMHGNIIMEVDEWDGL 273


>gi|227113418|ref|ZP_03827074.1| Terminase large subunit [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 472

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 36/274 (13%), Positives = 81/274 (29%), Gaps = 24/274 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K A   GRG  K+   A +++   + R  + I+C    +  + +++   +   +    
Sbjct: 16  RYKVA-KGGRGSSKSWSIARLIV-EAARRQSIRILCARELQNSISDSVIRLLEDTIEREG 73

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   FE+Q   +   G  AE +   +  +                              +
Sbjct: 74  YTAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGVDICW 116

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA          ++    +      W+   N + +    Y  F   P +D     ++ 
Sbjct: 117 VEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVTPPDDICLLTVNY 174

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                        +      +  + R   LG+         I   ++E A          
Sbjct: 175 TDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASEMAIIKREWLEAATDAHIKLGWK 234

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
               ++   D +  G D      R G++++ I  
Sbjct: 235 AKGAIVAAHDPSDTGPDDKGYAMRHGSVVKRIAS 268


>gi|317152051|ref|YP_004120099.1| hypothetical protein Daes_0328 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942302|gb|ADU61353.1| protein of unknown function DUF264 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 428

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 40/293 (13%), Positives = 75/293 (25%), Gaps = 39/293 (13%)

Query: 79  KCAISAG-RGIGKTTLNAWMMLWLI--STRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           + ++    R  GKT L+   ++     ++R       IA    Q K  +W E+ ++  + 
Sbjct: 21  RFSVLVCHRRFGKTVLSVNRLIRAARTTSRTDWRGAYIAPLYKQAKTVVWDELKRYCGLG 80

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                 +     L                                 +        +    
Sbjct: 81  LDGCTVKFNETELRAD------------------FDNGARIRLFGAENPDSLRGMYLDGA 122

Query: 196 FNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
             DE +  P  +  + I    ++      W M   T R     Y ++     D   +   
Sbjct: 123 VFDEVAQMPHRVWTEVIRPALSD---RMGWAMFIGTPRGKNALYRLWQDARRDPDWFAAM 179

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE---AMSREAI 311
            R  +       E   +   +  +    E    F       +      E        +  
Sbjct: 180 YRASQTGIIEPGELAAAAREMSPEEYEQEFECSFTAAIRGAYFSALIGEADKGGRITKVP 239

Query: 312 DDLYAPLIMGCDIAGEGGDKTVVVF---RRGNIIEHIFDWSAKLIQETNQEGC 361
            D   P+    D+     D T + F   R GN    +         E + EG 
Sbjct: 240 HDPSLPVHTAWDLGM--SDSTAIWFVQARPGNAFAIV------DYYEASGEGL 284


>gi|197261331|ref|YP_002154147.1| putative terminase, large subunit [Pseudomonas phage LBL3]
 gi|197244421|emb|CAR31156.1| putative terminase, large subunit [Pseudomonas phage LBL3]
          Length = 460

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-YLAANYRLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKRTGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDSCVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D + A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GN+I  + +W   
Sbjct: 236 PAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGL 273


>gi|157265379|ref|YP_001467938.1| terminase large subunit [Thermus phage P23-45]
 gi|156905274|gb|ABU96918.1| terminase large subunit [Thermus phage P23-45]
          Length = 485

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/310 (15%), Positives = 90/310 (29%), Gaps = 35/310 (11%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
           E +     H    ++ S     + A   GR  GK+   +   ++ +  RPG     IA +
Sbjct: 12  ELLGYKPHHVQLAIHRSTAKR-RVACL-GRQSGKSEAASVEAVFELFARPGSQGWIIAPT 69

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
             Q +      V K   +       E+Q                          +    +
Sbjct: 70  YDQAEIIFGRVVEKVERLAEVFPATEVQLQRRRLRLLVHHYDRPV--NAPGAKRVATSEF 127

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNG 235
             +  D            V  DEA+  P  +  ++I    +  +    W +  +T +   
Sbjct: 128 RGKSADRPDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDG---WALIISTPKGLN 184

Query: 236 WFYDIF-----------------NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
           WFY+ F                 N    D++ +   +  V          +  R  +   
Sbjct: 185 WFYEFFLMGWRGGLKEGIPNSGVNQTHPDFESFHAASWDV--WPERREWYMERRLYIPDL 242

Query: 279 VARIEILGQFPQQEVNNFIPHNYI-----EEAMSREAIDD--LYAPLIMGCDIAGEGGDK 331
             R E   +F     + F   + +     E   +R  ++D        +G D  G+  D 
Sbjct: 243 EFRQEYGAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADF-GKNQDY 301

Query: 332 TVVVFRRGNI 341
           +V      + 
Sbjct: 302 SVFSVLDLDT 311


>gi|157265496|ref|YP_001468054.1| phage terminase large subunit [Thermus phage P74-26]
 gi|156905391|gb|ABU97034.1| phage terminase large subunit [Thermus phage P74-26]
          Length = 485

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/310 (15%), Positives = 90/310 (29%), Gaps = 35/310 (11%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
           E +     H    ++ S     + A   GR  GK+   +   ++ +  RPG     IA +
Sbjct: 12  ELLGYKPHHVQLAIHRSTAKR-RVACL-GRQSGKSEAASVEAVFELFARPGSQGWIIAPT 69

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
             Q +      V K   +       E+Q                          +    +
Sbjct: 70  YDQAEIIFGRVVEKVERLAEVFPATEVQLQRRRLRLLVHHYDRPV--NAPGAKRVATSEF 127

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNG 235
             +  D            V  DEA+  P  +  ++I    +  +    W +  +T +   
Sbjct: 128 RGKSADRPDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDG---WALIISTPKGLN 184

Query: 236 WFYDIF-----------------NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
           WFY+ F                 N    D++ +   +  V          +  R  +   
Sbjct: 185 WFYEFFLMGWRGGLKEGIPNSGINQTHPDFESFHAASWDV--WPERREWYMERRLYIPDL 242

Query: 279 VARIEILGQFPQQEVNNFIPHNYI-----EEAMSREAIDD--LYAPLIMGCDIAGEGGDK 331
             R E   +F     + F   + +     E   +R  ++D        +G D  G+  D 
Sbjct: 243 EFRQEYGAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADF-GKNQDY 301

Query: 332 TVVVFRRGNI 341
           +V      + 
Sbjct: 302 SVFSVLDLDT 311


>gi|149408318|ref|YP_001294421.1| conserved hypothetical protein ORF004 [Pseudomonas phage F8]
 gi|219523873|ref|YP_002455934.1| terminase large subunit [Pseudomonas phage PB1]
 gi|190333469|gb|ACE73724.1| terminase large subunit [Pseudomonas phage PB1]
          Length = 460

 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/278 (13%), Positives = 81/278 (29%), Gaps = 24/278 (8%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
            +K  I  GR   K+     + +  ++    +  +C    + ++  +++  +   +    
Sbjct: 17  RYKV-IYGGRASSKSHDAGGIAV-YLAANYRLKFLCARQFQNRISESVYTLIKDKIENSE 74

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
           +   F     S+      +E                   +     +            ++
Sbjct: 75  YNGEFIFTKNSIKHKRTGSE-----------------FLFYGIARNLSEIKSTEGIDILW 117

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDT 255
            +EA        + I     + N   +  +  N   +  + Y  F   P +D     I+ 
Sbjct: 118 LEEAHYLTQEQWEVIEPTIRKENSEIW--IIFNPNEVTDFVYQNFVVKPPKDAFVKMINW 175

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DD 313
                +     + I   Y  D D A     G        + I   +I  A+        +
Sbjct: 176 NENPFLSETMLKVIHEAYERDKDQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWE 235

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
                 +G D+A +G D        GN+I  + +W   
Sbjct: 236 PAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGL 273


>gi|66391670|ref|YP_239195.1| gp17 terminase subunit, nuclease and ATPase [Enterobacteria phage
           RB43]
 gi|62288758|gb|AAX78741.1| gp17 terminase subunit, nuclease and ATPase [Enterobacteria phage
           RB43]
          Length = 609

 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/376 (12%), Positives = 103/376 (27%), Gaps = 65/376 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ L E +   +C      F   +                  +Q E + 
Sbjct: 91  LKRAYVQTKWTKEMLMEWV---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQKEML- 145

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +++H +  V  +            R +GKTT+ A  +   +       +  +A+  +  
Sbjct: 146 -IEMHKNRMVTCNLS----------RQLGKTTVVAIFLAHFVCFNEDKYVGVLAHKASMS 194

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+K             
Sbjct: 195 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNKCKIGAF------- 235

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 236 ASSPDAVRGNSFAMIYIDECAFIPNFTDAWLAIQPVISSGRKSK--ILITTTPNGLNHFY 293

Query: 239 DIFNIP---LEDWKRYQIDTR----------TVEGIDSGFHEGIISRYGLDSDVARIEIL 285
           DI+N        +  Y                    D G+        G   +    E  
Sbjct: 294 DIWNAAVEGKSGFVPYTAIWTSVKERLYTDGDNGVFDDGYSWSAKMIAGSSKEAFLQEHC 353

Query: 286 GQFPQQEVN----------NFIPHNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVV 334
            +F                ++I  +  E    +    +     +   D A G G D   +
Sbjct: 354 AEFMGTNGTLISGWKLSKMSWIDIDETETNFYQYKKPEEGHKYVAVLDPAEGRGQDYHAM 413

Query: 335 VFRRGNII--EHIFDW 348
                  +  E +  +
Sbjct: 414 HIIDITTLPFEQVAVY 429


>gi|186682890|ref|YP_001866086.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
 gi|186465342|gb|ACC81143.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
          Length = 543

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/391 (13%), Positives = 110/391 (28%), Gaps = 75/391 (19%)

Query: 22  AECVLSFKNFVMRFFPWGIKGKPL-EHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKC 80
           A+   S   +       G +  P  ++   P  +    +     +  + +  S       
Sbjct: 4   AKLKTSSSKYAALVHG-GSRPIPFPQYADDPVGFFKNELGIELTNEQTIIAESVRDRPIT 62

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            + A  G GK+ + + ++++ +    G   I  A SE Q+K  LWAE+ K   +   +  
Sbjct: 63  NVKAAHGTGKSFIASLLVIYFLFC-VGGVAITTAPSEDQVKWILWAELRKIHGLHKTKLG 121

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
                + L               + S+       T  +   ++F G H      +  DEA
Sbjct: 122 GRCDIMQL---------------LFSETVYAFGITSRDYSENSFQGQHRQKQ-LLIEDEA 165

Query: 201 SGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEG 260
            G    I+   +   T  +         N       F     +              V  
Sbjct: 166 DGITPQIDNGFIACLTGSDNRGLR--IGNPVDPQSQFAKTCKLDKRCLTVSAFSHPNVSW 223

Query: 261 ---------------------------------------------IDSGFHEGIISRYGL 275
                                                        I   + E +      
Sbjct: 224 AYELCADGVYRLKPEVAEHIINEDGEIKPQQEWPPEFPRDRIPGAISIDWIERVRREKFE 283

Query: 276 DSDVARIEILGQFPQQEVNNFIPHNYIEEAM-------SREAIDDLYAPLIMGCDIAGEG 328
            S   +  ++G++ +   +  I    +++A                  P  +G D+ G+G
Sbjct: 284 TSAYWKGRVMGEYAEDAADGIILLTLLKQARSLYDQNPQYWDAIAKRYPWRLGLDV-GDG 342

Query: 329 GDKTVVVFRRGNIIEHIFDWSAK-LIQETNQ 358
           GD   +   RG ++  +     K  + +T +
Sbjct: 343 GDPHALALLRGPVLYEVQIHPTKGDLLDTER 373


>gi|61806451|ref|YP_214228.1| DNA maturase beta subunit [Prochlorococcus phage P-SSP7]
 gi|61374376|gb|AAX44230.1| DNA maturase beta subunit [Prochlorococcus phage P-SSP7]
 gi|265525485|gb|ACY76251.1| DNA maturase beta subunit [Prochlorococcus phage P-SSP7]
          Length = 577

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 53/375 (14%), Positives = 86/375 (22%), Gaps = 89/375 (23%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            FK F+     W     P      P R Q     A+  +  S          +  I A R
Sbjct: 11  DFKLFLQAL--WDQLDLP-----SPTRAQ----YAIADYLQSGPK-------RLQIQAFR 52

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ +    +LW +       I+ I+ S+ +  N         +     +H       
Sbjct: 53  GVGKSWITGAFVLWTLFNDAEKKIMIISASKERADNMSIFLQKLIIETPWLKHLRPKSDD 112

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHGMAVF 196
           +      +  L         K   IT +              E P   +       +   
Sbjct: 113 ARWSRISFDVLCSPHQAPSVKSVGITGQLTGSRADLMILDDIEVPGNSMTELMREKLLQL 172

Query: 197 NDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
             EA                 P                   W      + +  +   I  
Sbjct: 173 CTEAESILTPKDDSRIMYLGTPQTTFTVYRKLAERAYRPFVWPARY-PKDITPYEGLIAP 231

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF-------------- 288
              ED             +              +S + R   + QF              
Sbjct: 232 QLQEDIDN----GAESGTVTDPDRFDDDDLQQRESAMGRSNFMLQFMLDTTLSDAEKFPL 287

Query: 289 -----------PQQEVNNFI-----------------PHNYIEEAMSREAIDDLYAPLIM 320
                      P +  +N I                 P +Y    M  +     Y   I 
Sbjct: 288 KMADLVITSVNPTEAPDNVIWCSDPQNIIKDAPTVGLPGDYFYSPMQLQGEWTPYQETIC 347

Query: 321 GCDIAGEGGDKTVVV 335
             D +G G D+T   
Sbjct: 348 SVDPSGRGTDETAAC 362


>gi|294085818|ref|YP_003552578.1| hypothetical protein SAR116_2251 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665393|gb|ADE40494.1| protein of unknown function DUF264 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 454

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 44/281 (15%), Positives = 77/281 (27%), Gaps = 22/281 (7%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113
           Q+  +                  ++  +  AGRG GKT   A  + WL  +     I  +
Sbjct: 52  QINLLLYEWQLWARPKQLPPAGDWRVWLLMAGRGFGKTRAGAEWIRWLAQSGRARRIALV 111

Query: 114 ANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITC 173
             +    +  +    S  LS+ P+      ++                          + 
Sbjct: 112 GETFDDARQVMVEGASGILSVCPNWARPAWRAGQRTL------------------IWPSG 153

Query: 174 RTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRL 233
                   D             + DE +      +                 + + T R 
Sbjct: 154 TIARCYSADDPEQLRGPEFDYGWADEIAKW-RYPSAWDNLMLALRIGKSPQCIATTTPRP 212

Query: 234 NGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
             W  D+     ED    Q  +R      S      + R   DS +AR E+ G       
Sbjct: 213 VRWLADL--AAAEDTVLVQGASRENAANLSPAFMAAMHRRFGDSYLARQELEGIMMSNLP 270

Query: 294 NNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
           +     N I            +  +++G D A  GGD+T +
Sbjct: 271 DALWCRNDILRLHRPMPKRHRFIRIVIGVDPAMGGGDETGI 311


>gi|310722477|ref|YP_003969300.1| terminase DNA packaging enzyme large subunit [Aeromonas phage
           phiAS5]
 gi|306021320|gb|ADM79854.1| terminase DNA packaging enzyme large subunit [Aeromonas phage
           phiAS5]
          Length = 633

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/375 (12%), Positives = 106/375 (28%), Gaps = 66/375 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF-KNFVMRFF-PWGIKGKPLEHFSQPHRWQLEF 58
           + R     +  ++ + E     + ++ F +N+       WG+    L        +Q + 
Sbjct: 117 LKRANVPTKWTKEMVEEWKRCRDDIVYFAENYCSIVHIDWGVIKVQL------RDYQKDM 170

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  +         ++ P          R +GKTT  A  +   +      ++  +A+   
Sbjct: 171 LRIMST--ERMSMHNLP----------RQLGKTTATAIFLTHFVVFNEAKAVGVLAHKGD 218

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  L     + + +LP                   E  + ++ +++            
Sbjct: 219 MSREVLER-TKQCIELLPD-----------FLQPGIVEWNKGNIELENGCSI-------G 259

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               +           ++ DE +     +   K+IL   +    +R  I+ ++T      
Sbjct: 260 AYASSPDAVRGNSFALIYVDECAFIEGFEDTWKAILPVISSGRKSR--IILTSTPNGINH 317

Query: 237 FYDIFN---IPLEDWKRYQIDTRTVEGI--------DSGFHEGIISRYGLDSDVARIEIL 285
           +YD++       + +K Y     TV+          D GF            +  R E  
Sbjct: 318 WYDLWEVSLNSDKGFKPYTTTWITVKERLYNGADKYDDGFEWATKQINSSSIEAFRQEHC 377

Query: 286 GQFPQQEVNNFIPHNYI---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
             F                       E+        +     I   D A G G D + + 
Sbjct: 378 CVFMGTAGTLINGFKLTKMIWDEVNNEDGFYCLEKPEPDHKYIATVDPAEGRGQDYSTMQ 437

Query: 336 FRRGNI--IEHIFDW 348
                +     +  +
Sbjct: 438 IIDVTVYPYRQVAVY 452


>gi|329849103|ref|ZP_08264131.1| phage terminase, large subunit, PBSX family [Asticcacaulis
           biprosthecum C19]
 gi|328844166|gb|EGF93735.1| phage terminase, large subunit, PBSX family [Asticcacaulis
           biprosthecum C19]
          Length = 430

 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/296 (14%), Positives = 87/296 (29%), Gaps = 26/296 (8%)

Query: 53  RWQLE---FMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +W  E    +E +  +            F+ A   GRG  K+   A   ++     PG  
Sbjct: 16  KWGGEGKVILEPIPAYRFLTKKPLGSFRFRAAY-GGRGAAKSWEFANAAIYHSLNTPGAR 74

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           ++ +   +  L ++ +  V   L        F   +   H              +++   
Sbjct: 75  VVFVREIQGSLADSAFTLVRNRLEAYGLEGAFRQANGRFH-------------HVENGAE 121

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
            +    +   +P+               +EAS         ++        +  W +  N
Sbjct: 122 ILFLGLWRGNKPEGIKSLEGA--TLTIWEEASEGRQRSLDVLIPTVLRTPQSELWCLW-N 178

Query: 230 TRRLNGWFYDIFNIPLE--DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
                      F   +E       +++  +         E +      D   A     G 
Sbjct: 179 PMLPTDPVDRFFRGDVEPQKTICRRVNWDSNPHFPEALREQMALDRKKDPLRAAWIWDGA 238

Query: 288 FPQQEVNNFIPHNYIEEAM--SREAIDDLYAPLIMGCDIAGEGGDKTVVVF--RRG 339
           +     N       ++ A    R+ + +    +++G D AG GGD+  +V   R G
Sbjct: 239 YMPSAQNALWTRELLDRAWVQGRDKVMEAVGRVVVGVDPAGGGGDEVGIVVAGRYG 294


>gi|241760933|ref|ZP_04759022.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241374552|gb|EER64013.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 428

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/286 (14%), Positives = 81/286 (28%), Gaps = 27/286 (9%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K A   GRG GK+   A M++      PG+  +CI   +  LK++    +      
Sbjct: 20  PARYKGAY-GGRGSGKSHFFAEMLVEDCLRLPGLRAVCIREVQKSLKDSAKRLI------ 72

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
                  E +  + H        + +       +  I  +   +   ++           
Sbjct: 73  -------EAKLSAYHLGSNVGFRVFRDHIQTPGNGIIIFQGMQDHTAESIKSLEGFSR-- 123

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWKRYQ 252
            + +EA        + +      ++    W    N R        +     P       Q
Sbjct: 124 AWVEEAQTLSQRSLELLRPTIRTIDSE-LWFSW-NPRFKTDPVDRMLRGETPPTGAVVVQ 181

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
            +        S   +        D D  R    G + +     +      +    +    
Sbjct: 182 ANWENNPWFPSPLDQERRDCLANDPDKYRHIWEGGYAEITEGAYYAQALAKARSEKRIAV 241

Query: 313 DLYAPLI---MGCDIAGEG--GDKTVVVFRR--GNIIEHIFDWSAK 351
               PL+      DI G G   D T +   +  G  I  +  + A+
Sbjct: 242 VAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQ 287


>gi|260906962|ref|ZP_05915284.1| hypothetical protein BlinB_16637 [Brevibacterium linens BL2]
          Length = 249

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/263 (15%), Positives = 79/263 (30%), Gaps = 42/263 (15%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   +                   +  +   R +GKTT  A+  L      PG  +
Sbjct: 24  PELWQERLLRT--------------QEARVLVLCARQVGKTTATAYKALHAAMFNPGRDV 69

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           + ++ S+ Q    L    S +  M                +   +      MG+ +    
Sbjct: 70  LIVSPSQRQSDEMLRRVASLYRGM--------------KEAPKLSRSNTSEMGLSNGSRV 115

Query: 171 ITCRTYSEERPDTFVGPHNTHGM-AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
           ++        P +  G     G+  +  DEAS   D +  S+L            +  S 
Sbjct: 116 VS-------LPGSEGGIRGFAGVKLLILDEASRVDDDVFASVLPMVASDGQ---MVALST 165

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                GWF+++       W+R+++     +         + +  G  S V   + L +F 
Sbjct: 166 PWGRRGWFHELHQETRNGWERHKVTVYESDQYTPPRIAEVKASLG--SFVFSSDYLCEF- 222

Query: 290 QQEVNNFIPHNYIEEAMSREAID 312
               +       +  A S     
Sbjct: 223 GDTDSQLFSTENVRAAFSPGIQP 245


>gi|307251380|ref|ZP_07533296.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306856621|gb|EFM88761.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 384

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 64/211 (30%), Gaps = 9/211 (4%)

Query: 153 WYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSIL 212
            + E+ +  +   +             + +       T    V+ +E           ++
Sbjct: 13  PFFEVQKTQIIGRNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENVSKESWDVLI 68

Query: 213 GFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIIS 271
               E       I++ N + L    Y  F   P E      ++ +          E +  
Sbjct: 69  PTIREDGSQI--IVSFNPKNLLDDTYQRFVINPPERCCSVLVNWQDNPYFPKELMEDMKQ 126

Query: 272 RYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIMGCDIAGEGG 329
               D ++ R    GQ         I   +IE+A+              ++G D+A EG 
Sbjct: 127 MKERDFELYRHVYEGQPVADSDLAIIKPLWIEKAVDAHKKLGFTASGRKVVGFDVADEGI 186

Query: 330 DKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           D     F  G+++  + +W    + ++    
Sbjct: 187 DANANCFAHGSVVLQVDEWRGDDVIQSAHRT 217


>gi|260753099|ref|YP_003225992.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552462|gb|ACV75408.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 428

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/286 (14%), Positives = 81/286 (28%), Gaps = 27/286 (9%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K A   GRG GK+   A M++      PG+  +CI   +  LK++    +      
Sbjct: 20  PARYKGAY-GGRGSGKSHFFAEMLVEDCLRLPGLRAVCIREVQKSLKDSAKRLI------ 72

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
                  E +  + H        + +       +  I  +   +   ++           
Sbjct: 73  -------EAKLSAYHLGSNVGFRVFRDHIQTPGNGVIIFQGMQDHTAESIKSLEGFSR-- 123

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWKRYQ 252
            + +EA        + +      ++    W    N R        +     P       Q
Sbjct: 124 AWVEEAQTLSQRSLELLRPTIRTIDSE-LWFSW-NPRFKTDPVDRMLRGETPPTGAVVVQ 181

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
            +        S   +        D D  R    G + +     +      +    +    
Sbjct: 182 ANWENNPWFPSPLDQERRDCLANDPDKYRHIWEGGYAEITEGAYYAQALAKARSEKRIAV 241

Query: 313 DLYAPLI---MGCDIAGEG--GDKTVVVFRR--GNIIEHIFDWSAK 351
               PL+      DI G G   D T +   +  G  I  +  + A+
Sbjct: 242 VAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQ 287


>gi|56551275|ref|YP_162114.1| PBSX family phage terminase large subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56542849|gb|AAV89003.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 428

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/286 (14%), Positives = 81/286 (28%), Gaps = 27/286 (9%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K A   GRG GK+   A M++      PG+  +CI   +  LK++    +      
Sbjct: 20  PARYKGAY-GGRGSGKSHFFAEMLVEDCLRLPGLRAVCIREVQKSLKDSAKRLI------ 72

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
                  E +  + H        + +       +  I  +   +   ++           
Sbjct: 73  -------EAKLSAYHLGRNVGFRVFRDHIQTPGNGVIIFQGMQDHTAESIKSLEGFSR-- 123

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWKRYQ 252
            + +EA        + +      ++    W    N R        +     P       Q
Sbjct: 124 AWVEEAQTLSQRSLELLRPTIRTIDSE-LWFSW-NPRFKTDPVDRMLRGETPPTGAVVVQ 181

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
            +        S   +        D D  R    G + +     +      +    +    
Sbjct: 182 ANWENNPWFPSPLDQERRDCLTNDPDKYRHIWEGGYAEITEGAYYAQALAKARSEKRIAV 241

Query: 313 DLYAPLI---MGCDIAGEG--GDKTVVVFRR--GNIIEHIFDWSAK 351
               PL+      DI G G   D T +   +  G  I  +  + A+
Sbjct: 242 VAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQ 287


>gi|328952976|ref|YP_004370310.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453300|gb|AEB09129.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
          Length = 466

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 50/297 (16%), Positives = 88/297 (29%), Gaps = 50/297 (16%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ +F+ +                    +   R  GK+T  A + L      PG  I
Sbjct: 27  PDPWQQDFLVSRPEQA--------------LLLCSRQSGKSTSAAALALHEALFHPGALI 72

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           + ++ S  Q +  L+ + +     LPH       S                +  D     
Sbjct: 73  LLLSPSLRQSQE-LFRKAAGLYQRLPHAPAACRTSA-------------LRLEFDHGSRI 118

Query: 171 ITCRTYSEERPDTFVGPHNTHGM-AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
           I+        P           +  +  DEA+  PD +  ++                S 
Sbjct: 119 IS-------LPGQEETIRGFSEVRLLVIDEAALVPDELYYAVRPMLAVSRGRL--TALST 169

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                GWFY  +    + W+RY I       I + F      +  L +   R E   +F 
Sbjct: 170 PAGKRGWFYHCYTEGGDQWQRYTIPATQCPRISADFL--AAEQRSLPAAWFRAEYFCEFG 227

Query: 290 QQEVNNFIPHNYIEEAMSREAID--------DLYAPLIMGCDIAGEGGDKTVVVFRR 338
           +   N   P + ++ A   +                  +G D+ G+  D + +    
Sbjct: 228 EAA-NQLFPAHLLQTAQCSQVSPLFAEITPSPPTGTFFIGLDL-GQSQDYSALTIIH 282


>gi|304373761|ref|YP_003858506.1| gp17 terminase subunit, nuclease and ATPase [Enterobacteria phage
           RB16]
 gi|299829717|gb|ADJ55510.1| gp17 terminase subunit, nuclease and ATPase [Enterobacteria phage
           RB16]
          Length = 609

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/376 (12%), Positives = 102/376 (27%), Gaps = 65/376 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  +Q L E +   +C      F   +                  +Q E + 
Sbjct: 91  LKRAFVQTKWTQQMLIEWV---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQKEML- 145

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +++H +  V  +            R +GKTT+ A  +   +       +  +A+  +  
Sbjct: 146 -IEMHKNRMVACNLS----------RQLGKTTVVAIFLAHFVCFNEDKFVGVLAHKASMS 194

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+K             
Sbjct: 195 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNKCKIGAF------- 235

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P       +I    +    ++  I+ + T      FY
Sbjct: 236 ASSPDAVRGNAFAMIYIDECAFIPNFQDAWLAIQPVISSGRKSK--ILITTTPNGLNHFY 293

Query: 239 DIFNIP---LEDWKRYQIDTRTVEGIDSGFH----------EGIISRYGLDSDVARIEIL 285
           DI+N        +  Y     +V+                        G   +    E  
Sbjct: 294 DIWNAAVEGKSGFVPYTAIWTSVKERLYTDGDDGVFDDGYSWSAKMIAGSSKEAFLQEHC 353

Query: 286 GQFPQQEVN----------NFIPHNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVV 334
            +F                ++I  +  E    +          +   D A G G D   +
Sbjct: 354 AEFMGTNGTLISGWKLSKMSWIDIDETETNFYQYKKPIEGHKYVAVLDPAEGRGQDYHAM 413

Query: 335 VFRRGNII--EHIFDW 348
                + +  E +  +
Sbjct: 414 HIIDISAMPFEQVAVY 429


>gi|159904490|ref|YP_001548152.1| hypothetical protein MmarC6_0096 [Methanococcus maripaludis C6]
 gi|159885983|gb|ABX00920.1| protein of unknown function DUF264 [Methanococcus maripaludis C6]
          Length = 505

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/372 (13%), Positives = 94/372 (25%), Gaps = 62/372 (16%)

Query: 2   PRLISTDQKLEQELHE---MLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           P            L+    ++ + E                          + H+ Q E 
Sbjct: 9   PNYAPQAPYGLGYLNTNPSIIHNPEIKDHLTYNFNHSLEKTACFVEFFMDRKLHQAQEEI 68

Query: 59  MEAVDVHCHSNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSE 117
            EA+           +  ++    I+ GR  GKT +   +     S   G S++ +A   
Sbjct: 69  AEAI-----------DSEMYDVITINIGRRGGKTEVMGGVGPKFCSKYRGFSVLVVAPVY 117

Query: 118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
            Q K           S    R   + +      S +                     T  
Sbjct: 118 NQAKTMYKKIKRGLESNKESRQLVKPKKEGFKESPFPL------------ITFYNGSTIE 165

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGW 236
            +  +T     +     +  DEA+   D I    +     +       +  S        
Sbjct: 166 FKSAETPDNLRSEGYDLIIVDEAAFVDDEIISAVLEPMLMDSGG--ILVKISTPWGTGNH 223

Query: 237 FYDIF----------------NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
           FYD +                      +K ++  +     +   F  G     G D+ V 
Sbjct: 224 FYDSYIKGELQAKMLEEGEGIPEDELRYKSFKFPSWVNPYLSKRFLMGKKKDLGEDNPVW 283

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL--------------YAPLIMGCDIAG 326
             E   +F + +        +++  +S                         ++G D+A 
Sbjct: 284 LQEYCAEFIE-DDTTVFSTAHVQACLSDAFETHYKTENLIYLIDEGERNKEYVIGLDLAK 342

Query: 327 EGGDKTVVVFRR 338
              D TV +   
Sbjct: 343 H-NDYTVFIVLD 353


>gi|323699495|ref|ZP_08111407.1| protein of unknown function DUF264 [Desulfovibrio sp. ND132]
 gi|323459427|gb|EGB15292.1| protein of unknown function DUF264 [Desulfovibrio desulfuricans
           ND132]
          Length = 428

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 75/302 (24%), Gaps = 33/302 (10%)

Query: 67  HSNVNNSNPTIFKCAISAG-RGIGKTTLNAWMML--WLISTRPGMSIICIANSETQLKNT 123
             +       + + A+    R  GKT L+   ++     + R       IA    Q K  
Sbjct: 9   REHQARIEAELGRFAVLVCHRRFGKTVLSVNRLINAARETRRDDWRGAYIAPLYRQAKTV 68

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           +W E+ ++          +     L                                 + 
Sbjct: 69  VWDELKRYCGFGLDGCTVKFNETELRAD------------------FDNGSRIRLFGANN 110

Query: 184 FVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
                  +   V  DE +  P  +  + I    ++    + W M   T R     Y+I+ 
Sbjct: 111 PDSLRGMYLDGVVFDEVAQMPLRVWTEVIRPALSD---RKGWAMFIGTPRGKNALYEIWE 167

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
               D        R  E       E   S   +  +    E    F       +      
Sbjct: 168 KGKTDPDWLAAMYRASETGILPVEELEASAREMSPEEYEQEFECSFTAAIRGAYFGQLLA 227

Query: 303 EEAMS---REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           +        +   D   P+    D+     D T + F +         ++     E   E
Sbjct: 228 DADREGRMTDVPADPSMPVHTAWDLGM--SDSTSIWFVQA---RPGGTFAVIDYYEACGE 282

Query: 360 GC 361
           G 
Sbjct: 283 GL 284


>gi|294661596|ref|YP_003580049.1| gp17 large terminase protein [Klebsiella phage KP15]
 gi|292660757|gb|ADE35005.1| gp17 large terminase protein [Klebsiella phage KP15]
          Length = 609

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/378 (12%), Positives = 105/378 (27%), Gaps = 69/378 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  +Q L E +   +C      F   +                  +Q E + 
Sbjct: 91  LKRAYIQTKWTQQMLMEWV---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQREML- 145

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +++H +  V  +            R +GKTT+ A  +   +       +  +A+  +  
Sbjct: 146 -IEMHKNRMVACNLS----------RQLGKTTVVAIFLAHFVCFNEDKYVGVLAHKASMS 194

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+K             
Sbjct: 195 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNKCKIGAF------- 235

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 236 ASSPDAVRGNSFAMIYIDECAFIPNFIDAWLAIQPVISSGRKSK--ILITTTPNGLNHFY 293

Query: 239 DIFNIP---LEDWKRYQIDTRTVEGI------------DSGFHEGIISRYGLDSDVARIE 283
           DI+N        +  Y     +V+                 +   +I+    +      E
Sbjct: 294 DIWNAAIEGKSGFVPYTAIWTSVKERLYTDGDDGVFDDGYSWSSKMIASSSKE--AFLQE 351

Query: 284 ILGQFPQQEVN----------NFIPHNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDKT 332
              +F                +++  +  E    +          I   D A G G D  
Sbjct: 352 HCAEFMGTNGTLIAGWKLSKLSWVDTDETETNFYQYKAPVEGHKYIAVLDPAEGRGQDYH 411

Query: 333 VVVFRRGNII--EHIFDW 348
            +       +  E +  +
Sbjct: 412 AMHIIDITSMPFEQVAVY 429


>gi|116326387|ref|YP_803107.1| terminase subunit nuclease and ATPase [Enterobacteria phage RB32]
 gi|115343980|gb|ABI94989.1| terminase subunit nuclease and ATPase [Enterobacteria phage RB32]
          Length = 610

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSTLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    R    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAIMDFIEVTPDDHGFHRFKKPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|300907068|ref|ZP_07124735.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|301304068|ref|ZP_07210185.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|300401186|gb|EFJ84724.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|300840675|gb|EFK68435.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|315257729|gb|EFU37697.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           85-1]
          Length = 440

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 91/271 (33%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 4   GGRSSSKSWDAAGIAI-FLSNKYSLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 62

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 63  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGISVLWLEEAHAL 105

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P ED    +I+      + 
Sbjct: 106 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLS 163

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+    +   +      +
Sbjct: 164 DTMLKVIEAAKRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLNFEPSGRKRI 223

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 224 GFDVADSGADKCANVYRHGSVVYWADEWKAK 254


>gi|38640149|ref|NP_944105.1| gp17 terminase DNA packaging enzyme large subunit [Aeromonas phage
           Aeh1]
 gi|33414835|gb|AAQ17878.1| gp17 terminase DNA packaging enzyme large subunit [Aeromonas phage
           Aeh1]
          Length = 633

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/366 (12%), Positives = 100/366 (27%), Gaps = 70/366 (19%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFV-----MRFFPWGIKGKPLEHFSQPHRWQ 55
           + R     +   + + E      C      F      +    WG+    L        +Q
Sbjct: 117 LKRANVPTKWTREMVEEWK---RCRDDIVYFAETYCSIIHIDWGVIKVQL------RDYQ 167

Query: 56  LEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIAN 115
            + +  +         ++ P          R +GKTT  A  +   +      ++  +A+
Sbjct: 168 KDMLRIMA--SERMSMHNLP----------RQLGKTTATAIFLTHFVVFNEAKAVGVLAH 215

Query: 116 SETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRT 175
                K  L     + + +LP                   E  + ++ +++         
Sbjct: 216 KGDMSKEVLER-TKQSIELLPD-----------FLQPGIVEWNKGNIELENGCSI----- 258

Query: 176 YSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRL 233
                  +           ++ DE +     +   K+IL   +    +R  I+ ++T   
Sbjct: 259 --GAYASSPDAVRGNSFALIYVDECAFIEGFEDTWKAILPVISSGRQSR--IILTSTPNG 314

Query: 234 NGWFYDIFN---IPLEDWKRYQIDTRTVEGI--------DSGFHEGIISRYGLDSDVARI 282
              +YD++       + +K Y     TV+          D GF            +  + 
Sbjct: 315 INHWYDLWEVSLKSDKGFKPYTTTWITVKERLYDGSDAYDDGFEWASKQINSSSVEAFQQ 374

Query: 283 EILGQFPQQEVNNFIPHNY---------IEEAMSREAIDDLYAPLIMGCDIA-GEGGDKT 332
           E L +F                       ++   +          I   D A G G D +
Sbjct: 375 EHLCRFMGTSGTLINGFKLSKMTWKEVIADDNFYQIEKPVEGNKYIATVDPAEGRGQDYS 434

Query: 333 VVVFRR 338
            +    
Sbjct: 435 TIQIID 440


>gi|282599341|ref|YP_003358653.1| Gp17 terminase DNA packaging enzyme large subunit [Shigella phage
           phiSboM-AG3]
 gi|226973647|gb|ACO94400.1| Gp17 terminase DNA packaging enzyme large subunit [Shigella phage
           phiSboM-AG3]
          Length = 736

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/292 (17%), Positives = 87/292 (29%), Gaps = 47/292 (16%)

Query: 91  TTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHP 150
           TT+ A  +LW         I  +AN E Q    L             R     Q L    
Sbjct: 269 TTVVAAFLLWYAMFHSDKEIAVLANKEKQAIEIL------------DRIRKAYQDLPFFL 316

Query: 151 SGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD--IIN 208
                +     +  ++        T S                 ++ DE +   +     
Sbjct: 317 QQGCEKFGSTLIEFENGSKIYAYATSS-------DSIRGRSVSLLYVDEVAFIENDFEFW 369

Query: 209 KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF------NIPLEDWKRYQIDTRTVEGID 262
           +S        + +R  I+TS  +   G FYDI       +    D+K  ++    V    
Sbjct: 370 ESTFPAIASADTSR-CILTSTPKGQRGLFYDIVTKANPEHPQYNDFKLTEVPWYRVPTYT 428

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--------DL 314
              +     R  L       E   +F +  V + IP   +++  S+   +          
Sbjct: 429 KDPNWESKQRAKLGDARFDQEFGIKF-RGSVGSLIPAKCLDKMTSKLYQEPNEFTKIYHD 487

Query: 315 YAPLIMGCDIAGEG----GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCP 362
           Y P  +   IA  G    GD +V+       I  I D+  K+  +      P
Sbjct: 488 YDPKRIYMGIADTGKGVEGDYSVL------TILDITDYPHKIAAKYRNNTIP 533


>gi|311993449|ref|YP_004010314.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Acj9]
 gi|295917406|gb|ADG60077.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Acj9]
          Length = 609

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 51/364 (14%), Positives = 102/364 (28%), Gaps = 64/364 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q  +  + E +    C      F   +                  +Q + ++
Sbjct: 94  LKRANIKIQWNQDMISEWI---RCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQKDMLK 149

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +  +             + ++S   R +GKTT+ A  + W        +I  +A+  + 
Sbjct: 150 IMAEN-------------RMSVSKLSRQLGKTTVVAIFLAWFACFNKDKNIGILAHKGSM 196

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 197 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSAISA------- 237

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P  +    +I    +        I+ + T      F
Sbjct: 238 YAASPDAVRGNSFSLIYIDECAFIPNFNDAWLAIQPVISSG--RHSKIIITTTPNGMNHF 295

Query: 238 YDIFNIPLE----------DWKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E          +W   +       +  D G+H    +  G   +  R E +G
Sbjct: 296 YDIWTAAVEGISGFVPYESEWNAVKERLYDDKDVFDDGWHFSFTTIGGSSVEQFRQEHVG 355

Query: 287 QFPQQEVNNFI-----------PHNYIEEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVV 334
            F   +    +           P N  +    +    D     I   D A G G D   +
Sbjct: 356 VFAGGQGTLSLRHETCNLKLETPINVGDSTFYKYKEPDPTRKYIATLDSAEGRGQDYHCM 415

Query: 335 VFRR 338
               
Sbjct: 416 NIID 419


>gi|228861099|ref|YP_002854122.1| gp17 terminase subunit [Enterobacteria phage RB51]
 gi|227438773|gb|ACP31085.1| gp17 terminase subunit [Enterobacteria phage RB51]
          Length = 610

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSTLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    R    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|330858684|ref|YP_004415059.1| putative terminase subunit nuclease and ATPase [Shigella phage
           Shfl2]
 gi|291290383|dbj|BAI83178.1| terminase subunit nuclease and ATPase [Enterobacteria phage AR1]
 gi|327397618|gb|AEA73120.1| putative terminase subunit nuclease and ATPase [Shigella phage
           Shfl2]
          Length = 610

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSTLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    R    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|228861479|ref|YP_002854500.1| gp17 terminase subunit [Enterobacteria phage RB14]
 gi|227438495|gb|ACP30808.1| gp17 terminase subunit [Enterobacteria phage RB14]
          Length = 610

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    R    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAIMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|262276634|ref|ZP_06054439.1| P-loop protein [alpha proteobacterium HIMB114]
 gi|262225214|gb|EEY75661.1| P-loop protein [alpha proteobacterium HIMB114]
          Length = 409

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/271 (14%), Positives = 79/271 (29%), Gaps = 34/271 (12%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
             F+  I+ GR  GKT L    +L          I  ++ +    K  +W ++ K +  L
Sbjct: 15  KRFRVLIT-GRRFGKTHLCLVEILRQARHCDNGKIFYVSPTYRMSKEIMWKQIKKLVKEL 73

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
               +     L++          + S+    K                           +
Sbjct: 74  RWDKYINETELTIVL----VNNCQISLKGADKSA---------------DNLRGVGLNFL 114

Query: 196 FNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL---EDWKRY 251
             DE +  P+    + +    ++   N   +     +    W YD+F        +WK +
Sbjct: 115 VLDEFADIPEEAWTEVLRPTISDKYANGKVLFVGTPKGYGNWSYDMFQRGQAGDPEWKSW 174

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           +  T     ++    E        D+   R E    F       +   N+      +   
Sbjct: 175 KYTTIEGGQVEPHEIEQAKKDL--DARSFRQEYEASFETYAGVVYY--NFDRAKNVKPVP 230

Query: 312 DDLYAPLIMGCDIAGEGGD---KTVVVFRRG 339
            D  A + +G D      D     +   ++G
Sbjct: 231 YDQNAVIHIGMD---FNIDPMSACLFYVKQG 258


>gi|194434997|ref|ZP_03067239.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|194416779|gb|EDX32906.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|323166781|gb|EFZ52535.1| phage terminase, large subunit, PBSX family [Shigella sonnei 53G]
          Length = 447

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 10  GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 68

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 69  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 111

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 112 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 169

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 170 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 229

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 230 GFDVADSGTDKCANVYRHGSVVFWADEWKAK 260


>gi|326804661|ref|YP_004327532.1| Gp17 terminase subunit for DNA packaging, nuclease and ATPase
           [Salmonella phage Vi01]
 gi|301795311|emb|CBW38029.1| Gp17 terminase subunit for DNA packaging, nuclease and ATPase
           [Salmonella phage Vi01]
          Length = 736

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/292 (16%), Positives = 84/292 (28%), Gaps = 47/292 (16%)

Query: 91  TTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHP 150
           TT+ A  +LW         I  +AN E Q    L             R     Q L    
Sbjct: 269 TTVVAAFLLWYAMFHSDKEIAVLANKEKQAIEIL------------DRIRKAYQDLPFFL 316

Query: 151 SGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD--IIN 208
                +     +  ++        T S                 ++ DE +   +     
Sbjct: 317 QQGCEKFGSTLIEFENGSKIYAYATSS-------DSIRGRSVSLLYVDEVAFIENDFEFW 369

Query: 209 KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF------NIPLEDWKRYQIDTRTVEGID 262
           +S        + +R  I+TS  +   G FYDI       +    D+   ++    V    
Sbjct: 370 ESTFPAIASADTSR-CILTSTPKGQRGLFYDIVTKADPRHPQYNDFHLTEVPWYKVPAYT 428

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--------L 314
                    R  L       E   +F +  V + IP   +++  S+   +          
Sbjct: 429 KDPDWETKQRARLGDARFDQEFGIKF-RGSVGSLIPAKCLDKMTSKLYREPNEFTKIYKE 487

Query: 315 YAPLIMGCDIAGEG----GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCP 362
           Y P  +   IA  G    GD +V+       I  I ++   +  +      P
Sbjct: 488 YDPQRIYFGIADTGKGVEGDYSVL------TILDITEYPHVIAAKYRNNTIP 533


>gi|324012808|gb|EGB82027.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           60-1]
          Length = 441

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 4   GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 62

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 63  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 105

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 106 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 163

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 164 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 223

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 224 GFDVADSGTDKCANVYRHGSVVFWADEWKAK 254


>gi|16760783|ref|NP_456400.1| bacteriophage protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|25512494|pir||AE0735 probable bacteriophage protein STY2040 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503080|emb|CAD05583.1| putative bacteriophage protein [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 467

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 30  GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 88

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 89  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 131

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 132 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 189

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 190 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 249

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 250 GFDVADSGTDKCANVYRHGSVVFWADEWKAK 280


>gi|74311301|ref|YP_309720.1| putative bacteriophage protein [Shigella sonnei Ss046]
 gi|73854778|gb|AAZ87485.1| putative bacteriophage protein [Shigella sonnei Ss046]
          Length = 473

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 36  GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 94

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 95  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 137

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 138 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 195

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 196 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 255

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 256 GFDVADSGTDKCANVYRHGSVVFWADEWKAK 286


>gi|188492395|ref|ZP_02999665.1| phage terminase large subunit [Escherichia coli 53638]
 gi|188487594|gb|EDU62697.1| phage terminase large subunit [Escherichia coli 53638]
          Length = 467

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 30  GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 88

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 89  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 131

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 132 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 189

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 190 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 249

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G+++    +W AK
Sbjct: 250 GFDVADSGTDKCANVYRHGSVVFWADEWKAK 280


>gi|9632853|ref|NP_049777.1| gp17'A unknown function [Enterobacteria phage T4]
 gi|5354477|gb|AAD42684.1|AF158101_271 gp17'A unknown function [Enterobacteria phage T4]
 gi|299780522|gb|ADJ39884.1| gp17'A [Enterobacteria phage T4T]
          Length = 523

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 6   LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 61

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 62  IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 108

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 109 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 149

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 150 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 207

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 208 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 267

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    +    +     I   D + G G D   + 
Sbjct: 268 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALH 327

Query: 336 FRR 338
              
Sbjct: 328 IID 330


>gi|103487487|ref|YP_617048.1| hypothetical protein Sala_2004 [Sphingopyxis alaskensis RB2256]
 gi|98977564|gb|ABF53715.1| protein of unknown function DUF264 [Sphingopyxis alaskensis RB2256]
          Length = 436

 Score =  109 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 44/263 (16%), Positives = 74/263 (28%), Gaps = 25/263 (9%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           + AGRG GKT   A  +     T PG  I  +A S  + +  +    S  L++ P     
Sbjct: 54  LLAGRGFGKTRTGAEWVRAFAETTPGARIALVAASLLEARQVMVEGESGLLAIAPDHLRP 113

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
           E +S     +                         +                A + DE +
Sbjct: 114 EYESSLRRLT------------------WPNGAVATLYSAVEPDSLRGPEHDAAWCDEIA 155

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGI 261
             P           T     R  ++ + T R                            +
Sbjct: 156 KWPKGEAAWDNLMLTMRIGARPQVVATTTPRCV-PLVRRLIQERGVATTRGRTASNRRNL 214

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMG 321
              +   + + YG    + R E+ G+  +   +       IE           +A +++G
Sbjct: 215 SVQWLATMDAIYGGT-RLGRQELDGELLEDVEDALWTRALIERCRVDAGSIGKFARVVIG 273

Query: 322 CD-IAGEGGDKTVVVF----RRG 339
            D  A  GGD   +V     R G
Sbjct: 274 VDPPASAGGDACGIVVAALLRDG 296


>gi|218781804|ref|YP_002433122.1| hypothetical protein Dalk_3968 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763188|gb|ACL05654.1| protein of unknown function DUF264 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 443

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 78/302 (25%), Gaps = 36/302 (11%)

Query: 67  HSNVNNSNPTIFKCAISAG-RGIGKTTLNAWMMLWLISTRP--GMSIICIANSETQLKNT 123
             +    +    + ++    R  GKT      ++      P        IA    Q K+ 
Sbjct: 25  RRHQWEIHQNKKRFSVLVCHRRFGKTVAAVNELIMKACQNPLPAPRYAYIAPLYKQAKSV 84

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           +W  + K+                       A         + +         +    D 
Sbjct: 85  VWDYLKKF---------------------AGAINGTTFHETELRCDLPNGARITLLGADN 123

Query: 184 FVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
                  +      DE +  P+ +  + I    ++      W M   T R +  FYD++ 
Sbjct: 124 PDRLRGIYLDGAVLDEMAQMPERVWGEIIRPALSD---RLGWAMFIGTPRGHNAFYDLYQ 180

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
               D   +    R  E    G  E   ++  +  +    E    F    V  +      
Sbjct: 181 FARSDPDWFCAMYRASETGIVGRDELDAAKKEMTPEQYEQEFECSFSAAIVGAYYGPLIA 240

Query: 303 EE---AMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           +            +   P+    D+     D T V F +   +    +       E   +
Sbjct: 241 QAEKEGRIVTLPVERALPVHTAWDLGM--SDSTAVWFFQ---VSPGGEIRVVDYLEDAGQ 295

Query: 360 GC 361
           G 
Sbjct: 296 GL 297


>gi|85716479|ref|ZP_01047450.1| prophage MuMc02, terminase, ATPase subunit, putative [Nitrobacter
           sp. Nb-311A]
 gi|85696668|gb|EAQ34555.1| prophage MuMc02, terminase, ATPase subunit, putative [Nitrobacter
           sp. Nb-311A]
          Length = 250

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/263 (16%), Positives = 73/263 (27%), Gaps = 40/263 (15%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ E +                   +  +   R  GKTT+ A M L       G  +
Sbjct: 24  PDPWQAELLR--------------LNPKRALLLCSRQSGKTTVTALMALHRAIYETGALV 69

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           + ++ S  Q    L  ++ K    L         +                + + +    
Sbjct: 70  VIVSPSNRQSGEML-RQIKKLHGSLKGAPELVGDA-------------VLKVELANGSRI 115

Query: 171 ITCRTYSEERPDTFVGPHN-THGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
           I         P T            V  DEAS   D +  ++         +   I  + 
Sbjct: 116 IA-------LPGTEKTIRGIAGVSLVIIDEASRVDDELLAAVRPMLATR-ADGSLIALTT 167

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                G+FY+ ++   + W R ++       I   F    +   G        E    F 
Sbjct: 168 PAGKRGFFYEAWHSDDQTWHRVRVAASDCPRISKEFLADELRSLG--PARYSEEYELAFV 225

Query: 290 QQEVNNFIPHNYIEEAMSREAID 312
               + F P   IE A + E   
Sbjct: 226 DDAASAF-PTAVIERAFTTEVEP 247


>gi|9632591|ref|NP_049776.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage T4]
 gi|137951|sp|P17312|TERL_BPT4 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein Gp17; AltName: Full=Terminase large subunit
 gi|5354215|gb|AAD42422.1|AF158101_9 gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage T4]
 gi|15201|emb|CAA36641.1| unnamed protein product [Enterobacteria phage T4]
 gi|299780521|gb|ADJ39883.1| large terminase protein [Enterobacteria phage T4T]
          Length = 610

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    +    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|212703351|ref|ZP_03311479.1| hypothetical protein DESPIG_01394 [Desulfovibrio piger ATCC 29098]
 gi|212673197|gb|EEB33680.1| hypothetical protein DESPIG_01394 [Desulfovibrio piger ATCC 29098]
          Length = 509

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/307 (10%), Positives = 70/307 (22%), Gaps = 42/307 (13%)

Query: 67  HSNVNNSNPTIFKCAISAG-RGIGKTTLNAWMMLWLIST--RPGMSIICIANSETQLKNT 123
                  +    +  +    R  GKT      +L       R        A    Q K  
Sbjct: 19  RPLQWRFHQQRTRFCVLLCHRRFGKTVAAVNDLLRAALRTSRTDWRAAYAAPYLGQAKAV 78

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
            W  +  +  ++P                       +    + +              D 
Sbjct: 79  AWDYLRHFAGVIP---------------------GTRFHEGELRCDLPNGARIRLYGTDN 117

Query: 184 FVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
                  +   +  DE +  P  +  + +     +      +      +  +   +D++ 
Sbjct: 118 AQALRGLYLDDLVLDEPADIPREVWSQILRPALADRRGRALFC--GTPKGCDNLLHDVWQ 175

Query: 243 -----IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFI 297
                   E W R++        +     +   S  G+     + E    F       + 
Sbjct: 176 LAGSLGAAEGWSRFRFPASQTGYLPQAELDAARS--GMSEAEYQQEFECSFAAAVRGAYY 233

Query: 298 ---PHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQ 354
                                 P+    D+     D T + F +   +E    W      
Sbjct: 234 AAQLDAADLAGRICPLPVSPDLPVHTAWDLGM--DDATAIWFFQ---VEPSGTWRMLDYY 288

Query: 355 ETNQEGC 361
           E + EG 
Sbjct: 289 EASGEGL 295


>gi|220702483|pdb|3EZK|A Chain A, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal
           Structures And Cryo-Em Reconstructions
 gi|220702484|pdb|3EZK|B Chain B, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal
           Structures And Cryo-Em Reconstructions
 gi|220702485|pdb|3EZK|C Chain C, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal
           Structures And Cryo-Em Reconstructions
 gi|220702486|pdb|3EZK|D Chain D, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal
           Structures And Cryo-Em Reconstructions
 gi|220702487|pdb|3EZK|E Chain E, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal
           Structures And Cryo-Em Reconstructions
          Length = 577

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    +    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|308814529|ref|YP_003934803.1| terminase DNA packaging enzyme large subunit [Shigella phage SP18]
 gi|308206121|gb|ADO19520.1| terminase DNA packaging enzyme large subunit [Shigella phage SP18]
          Length = 610

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/363 (12%), Positives = 99/363 (27%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ + E     +C      F   +                  +Q + +E
Sbjct: 93  LKRANIKIKWTKEMVQEWK---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLE 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  H       +            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IM--HKKRMTVCNLS----------RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                  +E  + ++ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGISEWNKGNITLDNGSTI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFVDAWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI+   +E           W   +       +  D G+     +      +    E   Q
Sbjct: 296 DIWTAAIEKKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSKQTISASTLEQFNQEHGAQ 355

Query: 288 FPQQEVNNFIP------HNYIEEA-----MSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
           F Q      I        ++IE         R    D     I   D + G G D   + 
Sbjct: 356 F-QGTSGTLISGMKLAIMDWIEVMPENGYFYRYKKPDPERKYIASLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|238695317|ref|YP_002922510.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage JS10]
 gi|220029453|gb|ACL78387.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage JS10]
          Length = 611

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/372 (12%), Positives = 95/372 (25%), Gaps = 65/372 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +                  +Q + ++
Sbjct: 93  LKRANIKTQWTREMVSEWK---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +  +  N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IMSKNRMTTCNLS------------RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFLDSWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI+   +E           W   +       +  D G+     +         R E   +
Sbjct: 296 DIWTAAVEGKSGFAPYTAIWNSVKERLYNDADIFDDGWEWSSQTISASSLAQFRQEHCAE 355

Query: 288 FPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVVF 336
           F                             R    D     I   D + G G D   +  
Sbjct: 356 FQGTSGTLISGMKLAIMDWKEVIPENGYFYRFHEPDPTHKYIASLDCSEGRGQDYHALHI 415

Query: 337 RRGNIIEHIFDW 348
                     +W
Sbjct: 416 IDVTT----DEW 423


>gi|161622599|ref|YP_001595293.1| gp17 terminase DNA packaging enzyme large subunit [Enterobacteria
           phage JS98]
 gi|52139922|gb|AAU29292.1| gp17 terminase DNA packaging enzyme large subunit [Enterobacteria
           phage JS98]
          Length = 611

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/372 (12%), Positives = 95/372 (25%), Gaps = 65/372 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +                  +Q + ++
Sbjct: 93  LKRANIKTQWTREMVSEWK---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +  +  N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IMSKNRMTTCNLS------------RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFLDSWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI+   +E           W   +       +  D G+     +         R E   +
Sbjct: 296 DIWTAAVEGKSGFAPYTAIWNSVKERLYNDADIFDDGWEWSSQTISASSLAQFRQEHCAE 355

Query: 288 FPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVVF 336
           F                             R    D     I   D + G G D   +  
Sbjct: 356 FQGTSGTLISGMKLAIMDWKEVIPENGYFYRFHEPDPTHKYIASLDCSEGRGQDYHALHI 415

Query: 337 RRGNIIEHIFDW 348
                     +W
Sbjct: 416 IDVTT----DEW 423


>gi|314121742|ref|YP_004063861.1| large terminase protein [Enterobacteria phage vB_EcoM-VR7]
 gi|313151499|gb|ADR32555.1| large terminase protein [Enterobacteria phage vB_EcoM-VR7]
          Length = 610

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/363 (12%), Positives = 97/363 (26%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ + E      C      F   +                  +Q + +E
Sbjct: 93  LKRANIKIKWTKEMVQEWK---RCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLE 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  H       +            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IM--HKKRMTVCNLS----------RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                  +E  + ++ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGISEWNKGNITLDNGSTI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFVDAWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI+   +E           W   +       +  D G+     +      +    E   Q
Sbjct: 296 DIWTAAIEKKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSKQTISASTLEQFNQEHGAQ 355

Query: 288 FPQQEVNNFIP------HNYIEEA-----MSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
           F Q      I        ++I          R    D     I   D + G G D   + 
Sbjct: 356 F-QGTSGTLISGMKLAIMDWIRSMPENGYFYRYKKPDPERKYIASLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|16759908|ref|NP_455525.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142320|ref|NP_805662.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213583175|ref|ZP_03365001.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213647535|ref|ZP_03377588.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213855100|ref|ZP_03383340.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|25512685|pir||AF0621 probable prophage terminase large chain STY1047 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16502201|emb|CAD05440.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137950|gb|AAO69511.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 467

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A   +  ++ +  +   C    + +++ +++  +   +     RH F +
Sbjct: 30  GGRSSSKSWDAAGFAI-FLANKYSLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 88

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 89  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 131

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P ED    +I+      + 
Sbjct: 132 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLS 189

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIM 320
               + I +    D +       G     +    I  ++IE A+    + D        +
Sbjct: 190 DTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRI 249

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G++I    +W AK
Sbjct: 250 GFDVADSGADKCANVYRYGSVIYWADEWKAK 280


>gi|326536310|ref|YP_004300751.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage 133]
 gi|299483391|gb|ADJ19485.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage 133]
          Length = 606

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/363 (11%), Positives = 88/363 (24%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R         + + E     +C      F   +                  +Q + ++
Sbjct: 89  LKRSNVRTPYTREMIEEWK---KCRDDILYFAETYCAITHIDHGTIKVK-LRDYQRDMLQ 144

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +D               +   +   R +GKT   A  +   +      S+  +A+  + 
Sbjct: 145 LMDSG-------------RLTCAKLSRQLGKTAAVAIFLAHYVCFNESKSVGILAHKGSM 191

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
            +  L+    + + +LP                   E  ++S+ +D+             
Sbjct: 192 SEEVLFR-TKQAIELLPD-----------FLQPGIVEWNKRSIELDNGSSIGAF------ 233

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +     D    +I    +        I+ + T      F
Sbjct: 234 -ASSPDAVRGNSFSLIYIDETAFVQNWDDCWLAIQPVISSG--RHSKIIMTTTPNGMNHF 290

Query: 238 YDIFNIPLEDWKRYQID-----------TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YD++   +     ++                 +  D G+     +      +    E LG
Sbjct: 291 YDLWQGAINGTSGFRPYEATWVSVKDRLYNEADTFDDGWEFSARAIGSSSIEQFLQEHLG 350

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +               I   D A G G D   + 
Sbjct: 351 NFAGGSNTLIDGTKLAVLFGQERIADQHEFIEFKPPVAGRKYIATLDSAEGRGQDYHALH 410

Query: 336 FRR 338
              
Sbjct: 411 IID 413


>gi|9632854|ref|NP_049778.1| gp17'B unknown function [Enterobacteria phage T4]
 gi|5354478|gb|AAD42685.1|AF158101_272 gp17'B unknown function [Enterobacteria phage T4]
 gi|299780523|gb|ADJ39885.1| gp17'B [Enterobacteria phage T4T]
          Length = 505

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 83/312 (26%), Gaps = 59/312 (18%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSI 110
             +Q + ++ +                +  +    R +GKTT+ A  +   +      ++
Sbjct: 35  RDYQRDMLKIMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAV 81

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
             +A+  +     L     + + +LP                   E  + S+ +D+    
Sbjct: 82  GILAHKGSMSAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI 129

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTS 228
                       +           ++ DE +  P+      +I    +    ++  I+ +
Sbjct: 130 -------GAYASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIIT 180

Query: 229 NTRRLNGWFYDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDS 277
            T      FYDI+   +E           W   +       +  D G+   I +  G   
Sbjct: 181 TTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSL 240

Query: 278 DVARIEILGQFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-G 326
              R E    F                        +    +    +     I   D + G
Sbjct: 241 AQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEG 300

Query: 327 EGGDKTVVVFRR 338
            G D   +    
Sbjct: 301 RGQDYHALHIID 312


>gi|16273317|ref|NP_439561.1| terminase large subunit-like protein [Haemophilus influenzae Rd
           KW20]
 gi|1175785|sp|P44184|Y1410_HAEIN RecName: Full=Uncharacterized protein HI_1410
 gi|1574247|gb|AAC23058.1| predicted coding region HI1410 [Haemophilus influenzae Rd KW20]
          Length = 394

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/240 (13%), Positives = 73/240 (30%), Gaps = 11/240 (4%)

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           ++ E+ K +S    +   +   + +     + ++ +  +   +             + + 
Sbjct: 1   MFREIQKSISDSVIQMLAD--QIEMLSLQAFFDVQKTQIIGQNGSRFTFA----GLKTNI 54

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN- 242
                 T    V+ +E           ++    E       I++ N + +    Y  F  
Sbjct: 55  TSIKSMTGIDVVWVEEGENVSKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVI 112

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
            P E  K   ++ +          E +      D ++ R    G+         I   +I
Sbjct: 113 HPPERCKSVLVNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWI 172

Query: 303 EEAMSREAID--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           E A+               +G D+A EG D     F  G+++  I  W    + ++    
Sbjct: 173 EYAVDAHLKLGFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRT 232


>gi|213618708|ref|ZP_03372534.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 282

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 89/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A   +  ++ +  +   C    + +++ +++  +   +     RH F +
Sbjct: 30  GGRSSSKSWDAAGFAI-FLANKYSLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 88

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 89  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 131

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P ED    +I+      + 
Sbjct: 132 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLS 189

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIM 320
               + I +    D +       G     +    I  ++IE A+    + D        +
Sbjct: 190 DTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRI 249

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G++I    +W AK
Sbjct: 250 GFDVADSGADKCANVYRYGSVIYWADEWKAK 280


>gi|299779112|ref|YP_003734306.1| gp17 terminase DNA packaging enzyme large subunit [Enterobacteria
           phage IME08]
 gi|298105841|gb|ADI55485.1| gp17 terminase DNA packaging enzyme large subunit [Enterobacteria
           phage IME08]
          Length = 611

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/372 (12%), Positives = 95/372 (25%), Gaps = 65/372 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +                  +Q + ++
Sbjct: 93  LKRANIKTQWSREMVSEWK---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +  +  N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IMSKNRMTTCNLS------------RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFLDSWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI+   +E           W   +       +  D G+     +         R E   +
Sbjct: 296 DIWTAAVEGKSGFAPYTAIWNSVKERLYNDADIFDDGWEWSSQTISASSLAQFRQEHCAE 355

Query: 288 FPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVVF 336
           F                             R    D     I   D + G G D   +  
Sbjct: 356 FQGTSGTLISGMKLAIMDWKEVIPENGYFYRFHEPDPTHKYIASLDCSEGRGQDYHALHI 415

Query: 337 RRGNIIEHIFDW 348
                     +W
Sbjct: 416 IDVTT----DEW 423


>gi|161614489|ref|YP_001588454.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363853|gb|ABX67621.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 441

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 88/271 (32%), Gaps = 23/271 (8%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A   +  ++ +  +   C    + +++ +++  +   +     RH F +
Sbjct: 4   GGRSSSKSWDAAGFAI-FLANKYSLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 62

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 63  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 105

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P ED    +I+      + 
Sbjct: 106 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLS 163

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIM 320
               + I +      +       G     +    I  ++IE A+    + D        +
Sbjct: 164 DTMLKVIDAARRRYPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRI 223

Query: 321 GCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           G D+A  G DK   V+R G++I    +W AK
Sbjct: 224 GFDVADSGADKCANVYRYGSVIYWADEWKAK 254


>gi|296117130|ref|ZP_06835723.1| phage terminase, large subunit [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976225|gb|EFG83010.1| phage terminase, large subunit [Gluconacetobacter hansenii ATCC
           23769]
          Length = 404

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/264 (13%), Positives = 72/264 (27%), Gaps = 29/264 (10%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K     GRG GK+   A +++ + + RP + I+C     + + +++   +S  ++ 
Sbjct: 18  PARYKILY-GGRGSGKSWTVARVIVAMAAARP-LRILCCREYHSSMADSVRRLLSDQVAA 75

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           L    WF ++                           +   +     +            
Sbjct: 76  LGLGPWFRIR------------------ENLLTTACGSEILFRGLGRNVEAIKSTEKVDI 117

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY--Q 252
            + +EA          +L          +   T N  R +   + +     +D       
Sbjct: 118 CWVEEAQSLSRASLDILLPTIRAPGSEIW--FTYNPEREDAPMHQMMRALRDDPDAIVRH 175

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           +  R                   D D       G+   +        +      +     
Sbjct: 176 VGWRDNPWFPPELDAERRRMLRHDPDSYDHVWEGECRTRSDAVVFGGHVEVAEFTT---- 231

Query: 313 DLYAPLIMGCDIAGEGGDKTVVVF 336
              A L  G D  G   D TV+V 
Sbjct: 232 PPDARLYFGVD-WGFARDPTVMVR 254


>gi|326536497|ref|YP_004300928.1| gp17 terminase DNA packaging enzyme large subunit [Aeromonas phage
           65]
 gi|312262843|gb|ADQ53099.1| gp17 terminase DNA packaging enzyme large subunit [Aeromonas phage
           65]
          Length = 642

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/370 (11%), Positives = 95/370 (25%), Gaps = 74/370 (20%)

Query: 10  KLEQELHEMLMHAECVLSFKNFVMRF----FPWGIKGKPLEHFSQPHRWQLEFMEAVDVH 65
             ++ + E     +C      F           G+ G  L        +Q + +  +   
Sbjct: 127 WSQEMVEEWK---KCRDDILYFAKYCAIIHLDHGVIGINL------RPYQKDMLRIMSE- 176

Query: 66  CHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
                        + +I    R +GKTT  +      ++     ++  +A+  +  +  L
Sbjct: 177 ------------KRMSIHNLSRQLGKTTATSVYPCHYVTFNEAKNVGILAHKASMSREVL 224

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
                + + +LP                   E  + S+ +++                  
Sbjct: 225 ER-TKQIIELLPD-----------FLQPGIVEWNKGSIELENGCAISA-------YSSDP 265

Query: 185 VGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI-- 240
                     ++ DE       +   K+IL   +    N   ++TS    +N W+     
Sbjct: 266 DAVRGNSFALIYVDECGFVEAWEDCWKAILPVISS-GRNSKIVLTSTPNGMNHWYDLWQS 324

Query: 241 -------FNIPLEDWKRYQI--DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
                  F     +W   +        +  D G             +    E  GQF   
Sbjct: 325 AINGKSGFEPYEANWSAVKERLYHSETDSFDDGISWTTNQIGSSSVEAFLQEHAGQFM-G 383

Query: 292 EVNNFIPHNYIEEAMSREAI----------DDLYAPLIMGCDIA-GEGGDKTVVVFRRGN 340
                I    + +    +             ++        D A G G D + +      
Sbjct: 384 SAGTLITGFKLSKMTWTDIEATENLYRFKQPEVGHKYFACVDPAEGRGQDYSTIQIIDVT 443

Query: 341 I--IEHIFDW 348
               E +  +
Sbjct: 444 KYPYEQVAVY 453


>gi|310005651|gb|ADP00039.1| DNA maturase beta subunit [Cyanophage 9515-10a]
          Length = 577

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/395 (12%), Positives = 97/395 (24%), Gaps = 84/395 (21%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +    F+ F+     W     P      P R QL     +  +  +          +  I
Sbjct: 6   QLKDDFRYFLTAV--WTHLALP-----APTRAQL----CIAEYLQNGPK-------RLQI 47

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFE 142
            A RG+GK+ + A  +LW +       I+ ++ S+ +  +         L +    H   
Sbjct: 48  QAFRGVGKSWITAAFVLWTLYNNSDKKIMVVSASKDRADSFSIFCQRLILEVPWMSHLKP 107

Query: 143 MQSLSLHPS-----------GWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
                                  +       G  +            E P+  +      
Sbjct: 108 KNDDQRWSRVSFDVGPAAPHQAPSVKSVGITGQLTGSRADLMVLDDVEVPNNSMTELQRE 167

Query: 192 GMAVFNDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
            +     E                  P                   W      R++  + 
Sbjct: 168 KLLQLVTECESILTPKKDSRIMFLGTPQTTFTVYNKLRERAYKPFVWPARY-PRKVAMYD 226

Query: 238 YDIFNIPLEDWKRYQIDTRTV--EGIDSGFHEGIISRYGLDSDVARIEILG------QFP 289
             +     +D       T                 S  G  + + +  +        +FP
Sbjct: 227 GLLAPQLEKDLNNDSELTWVPTDTRFREEDLLERESAMGRSNFMLQFMLDTSLSDAEKFP 286

Query: 290 QQEVNNFI------------------------------PHNYIEEAMSREAIDDLYAPLI 319
            +  +  I                              P +Y    M  +     Y+  I
Sbjct: 287 LKFADLIINPVNPETAPENIIWCSSKDNILKDLPCVGLPGDYYYSPMQVQGEWKPYSETI 346

Query: 320 MGCDIAGEGGDKTVVVFR-RGNIIEHIFD-WSAKL 352
              D +G G D+TV  F  + N I ++ + +++  
Sbjct: 347 CSVDPSGRGSDETVACFISQLNGIMYLHEVYASTD 381


>gi|294508906|ref|YP_003566117.1| hypothetical protein PSR_11004 [Salinibacter ruber M8]
 gi|294342043|emb|CBH22709.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 255

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 79/260 (30%), Gaps = 40/260 (15%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   + +                 +  ++  R  GKTT +A + L          +
Sbjct: 8   PDPWQEALLTSDWE--------------RALLNCARQSGKTTASAALALETALEATDSLV 53

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           + +A +  Q K  L +  S +    P     +   L L                +++   
Sbjct: 54  LILAPARRQSKEFLRSVRSLYRDAAPDGGLDKQSELRLRL--------------ENESRI 99

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
           I         P             V  DEA+  PD    +              +  S  
Sbjct: 100 IA-------LPGKEGTVRGYTADLVIADEAARVPDAAYVATRPMLAVTGGRF--VGLSTP 150

Query: 231 RRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
               GWFY+ +  P ++W++ ++  +    +   F E      G      R E + +F  
Sbjct: 151 AGQRGWFYEAWTDPGQEWEQVKVTGQDCPRMTEAFLEQERREMGD--WQFRSEYMCEF-T 207

Query: 291 QEVNNFIPHNYIEEAMSREA 310
              +      +IE +++ E 
Sbjct: 208 DTEDQLFATEHIESSLTSEV 227


>gi|291336835|gb|ADD96368.1| phage terminase large subunit [uncultured organism
           MedDCM-OCT-S09-C20]
          Length = 454

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 91/320 (28%), Gaps = 24/320 (7%)

Query: 40  IKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMM 98
              +P+E    P        + +     +     +    +  +   G G GK+   A  +
Sbjct: 14  EPKRPVERAIDPGAADALRAKILADCLPAQREFLDDESHRILSYIGGFGSGKSFALAAKL 73

Query: 99  LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELL 158
           ++L    PG +++    +   ++  L   +   L      + +       +        +
Sbjct: 74  IFLGLRNPGGTLMACEPTFPMIRTVLVPAIDMALDQWDIEYSYRASPQPEYSINLPTGPV 133

Query: 159 EQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF--T 216
                           T   +  + +      +  A   DE   +P    +         
Sbjct: 134 ----------------TIYCQSAENYQRIRGQNICAAVWDECDTSPVDTAQKAGEMLLAR 177

Query: 217 ELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGL 275
                   +  ++T     W Y  F      D +  ++ T+    + + F   +   Y  
Sbjct: 178 MRTGELNQLAVASTPEGFRWAYRTFVENDGPDKRLIRVRTQDNPHLPADFIPSLERNY-- 235

Query: 276 DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVV 335
            S + +  + G F      +  P  +       +        + +G D+   G   T  +
Sbjct: 236 PSQLIQAYLEGHFVNLASCSLYP-EFDRSLNYCDTQPTENDTIWIGVDL-NVGNCVTQHL 293

Query: 336 FRRGNIIEHIFDWSAKLIQE 355
            RRG+      +   +  Q+
Sbjct: 294 VRRGDEFHFFAEKVYRDTQQ 313


>gi|85059367|ref|YP_455069.1| putative phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779887|dbj|BAE74664.1| putative phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 264

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 77/269 (28%), Gaps = 23/269 (8%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
            P  +K A   GRG GK+   A +++  I+ R     +C    +  + +++   ++  + 
Sbjct: 13  QPHRYKIA-KGGRGSGKSWAIARLLV-EIARRGTYRFLCAREFQASMADSVIQLIADTIQ 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +        L       ++     +                     
Sbjct: 71  REGYLKEFEIQKAYIRHLAATDSLFMFYGIKNNVTKIKS----------------LEGID 114

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
             + +EA          ++    +      W+  ++   L+  +      P +D     +
Sbjct: 115 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSFNSKNILDDTYQRFVVNPPDDICLLTV 173

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID- 312
                          +      D D+      GQ         I   +I  A+       
Sbjct: 174 HYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGQPVADSDLAIIKPLWIAAAVDAHMTLG 233

Query: 313 -DLYAPLIMGCDIAGEGGDKT--VVVFRR 338
            D      +G D+A EG   T   +   +
Sbjct: 234 FDAVGEKRLGFDVADEGKTATPCALCRAQ 262


>gi|311993161|ref|YP_004010027.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage CC31]
 gi|284177999|gb|ADB81665.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage CC31]
          Length = 610

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 95/363 (26%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R        ++ + E     +C      F  ++                  +Q + + 
Sbjct: 93  LKRANIKTNWTKEMVQEWK---KCRDDIVYFAEKYCAITHIDYGTIKVQ-LRDYQRDMLR 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +         +   T    +    R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 149 IMS--------SKRMTCCNLS----RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMS 196

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + + +LP                   E  + S+ +D+              
Sbjct: 197 AEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GAY 237

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      FY
Sbjct: 238 ASSPDAVRGNSFAMIYIDECAFIPNFIDAWLAIQPVISSGRRSK--IIITTTPNGLNHFY 295

Query: 239 DIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           DI++  L            W   +       +  D G+     +      +  + E   +
Sbjct: 296 DIWDAALSGKSGFEPYTAIWNSVKERLYNDQDMFDDGWQWSSQTISASSLEQFKQEHCAE 355

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDD-----------LYAPLIMGCDIA-GEGGDKTVVV 335
           F        I    +      E   D                I   D + G G D   + 
Sbjct: 356 FHGTS-GTLISGMKLANMDWTEVTPDNHGFYKFKEAQPERKYIAALDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|148257070|ref|YP_001241655.1| putative phage terminase large subunit [Bradyrhizobium sp. BTAi1]
 gi|146409243|gb|ABQ37749.1| putative phage Terminase large subunit [Bradyrhizobium sp. BTAi1]
          Length = 428

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 70/273 (25%), Gaps = 27/273 (9%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+     +++       G   +CI  ++  L  +    +   ++ L     F  
Sbjct: 26  GGRGSGKSHFFGELLVETCQAERGTLAVCIREAQRTLAQSSKRLIEGKIAALGLGQGFRP 85

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            S  +                      I  R   +   ++            + DEA   
Sbjct: 86  FSDRI---------------ATPGDGLIIFRGMQDHTAESIKSL--EGFRIAWIDEAQTL 128

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
                  +            W    N RR +    D       +     + + R    + 
Sbjct: 129 SVRSLSLLRPTIRAPRSE-LWASW-NPRRKSDAVDDFLRSRKPDGAVVVKANWRDNPWLP 186

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS---REAIDDLYAPLI 319
           +   E       L  D       G + +     +      +        +   D   PL 
Sbjct: 187 AVLDEERRLDLALYPDRYEHIWEGDYVRAFEGAYFADLLAQARREGRIGKVAADPLLPLR 246

Query: 320 MGCDIAGEG--GDKTVVVFRR--GNIIEHIFDW 348
              DI G G   D   +   +  GN +  +  +
Sbjct: 247 AFIDIGGAGASADAFTIWIVQWVGNEVRVLDYY 279


>gi|32453660|ref|NP_861869.1| large terminase protein [Enterobacteria phage RB69]
 gi|32350479|gb|AAP76078.1| gp17 terminase DNA packaging enzyme, large subunit [Enterobacteria
           phage RB69]
          Length = 611

 Score =  102 bits (254), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 45/367 (12%), Positives = 96/367 (26%), Gaps = 65/367 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +                  +Q + ++
Sbjct: 93  LKRANIKTQWTYEMVAEWK---KCRDDIVYFAETYCAITHIDYGTIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIQLDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFIDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+     +         R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSKQTISASSLTQFRQEHTA 354

Query: 287 QFPQQEVNNFIP------HNYIE-----EAMSREAIDDLYAPLIMGCDIA-GEGGDKTVV 334
            F +      I        +YIE         +    +     I   D + G G D   +
Sbjct: 355 AF-EGTSGTLISGMKLAILDYIEVTPDSHGFHQFKKPEEGHKYIATLDCSEGRGQDYHAM 413

Query: 335 VFRRGNI 341
                  
Sbjct: 414 HIIDVTT 420


>gi|237745726|ref|ZP_04576206.1| phage terminase [Oxalobacter formigenes HOxBLS]
 gi|229377077|gb|EEO27168.1| phage terminase [Oxalobacter formigenes HOxBLS]
          Length = 414

 Score =  102 bits (253), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/266 (15%), Positives = 82/266 (30%), Gaps = 27/266 (10%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K A   GRG GK+   A  +  +  +RP + ++C    +  +++++   +   +
Sbjct: 30  FRPYRYKSA-RGGRGSGKSVHFARALTVISYSRP-VRVLCCREVQNTIRDSVHKLIGDQI 87

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           S L    WF +   S+  S     + +  +  D +    T                    
Sbjct: 88  SALGLAPWFRITDSSIKSSVGSEFIFKG-LKYDPQGIKST-----------------EGI 129

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWKR 250
              + +E     +     ++    + N    WI   N    +G  Y  F    P + +  
Sbjct: 130 DICWVEEGQTVSEESWSILIPTIRKENSE-IWISW-NPIDEDGPTYKRFVTAPPPDCYNA 187

Query: 251 YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
            +++            + +      D        LG+             Y  E    + 
Sbjct: 188 -EVNYYDNPWFPDVLRKEMEYLKATDYAAYEHVWLGKPLTVSDAVIFAGKYTVETF-PDD 245

Query: 311 IDDLYAPLIMGCDIAGEGGDKTVVVF 336
           + +    L  G D  G   D + +V 
Sbjct: 246 LWEKADRLFFGADF-GFARDPSALVR 270


>gi|220702377|pdb|3CPE|A Chain A, Crystal Structure Of T4 Gp17
          Length = 592

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/363 (11%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 118 LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 173

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 174 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 220

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 221 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 261

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ ++ +  P+      +I    +    ++  I+ + T      F
Sbjct: 262 YASSPDAVRGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 319

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 320 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 379

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    +    +     I   D + G G D   + 
Sbjct: 380 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALH 439

Query: 336 FRR 338
              
Sbjct: 440 IID 442


>gi|320091491|gb|ADW08983.1| terminase-like protein [Clavibacter phage CN77]
          Length = 414

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 66/207 (31%), Gaps = 30/207 (14%)

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNR 222
           G  ++      R   ++   TF G        V  DEA G P  +        T  +   
Sbjct: 17  GSGNEAIAFGKRPTDQDIVSTFQGTR-KLRTFVALDEAGGVPPELFTGAEAVMTGQDSKI 75

Query: 223 FWIMTSNTRRLNGWFYDIFNIPL--EDWKRYQIDTRTVEGIDSG---------------- 264
             +   N       F+ IF +P   ++W  + I    +  +                   
Sbjct: 76  --VAIGNPDSRGTEFHRIFTVPALMDEWNTFTISAYDLPTVTGEVVYPDHPEKQERMLKG 133

Query: 265 -----FHEGIISRY---GLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
                + +     +   G        ++LG+FP +  N F P   I+        D    
Sbjct: 134 LTSLDWIQHKERVWKVGGKPDGRFLAKVLGEFPGETDNAFFPQEAIDRGNDTTI-DKPEK 192

Query: 317 PLIMGCDIAGEGGDKTVVVFRRGNIIE 343
            +IMG D+A  G D +VV   +G  + 
Sbjct: 193 GIIMGVDLARMGDDDSVVYTNQGGRVR 219


>gi|299531659|ref|ZP_07045064.1| putative phage associated protein [Comamonas testosteroni S44]
 gi|298720375|gb|EFI61327.1| putative phage associated protein [Comamonas testosteroni S44]
          Length = 436

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 85/286 (29%), Gaps = 26/286 (9%)

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
                   P  +K  +  GRG GK+   A ++L + ++RP + ++C    +  +K ++  
Sbjct: 23  EKLAGIWEPKRYKV-MHGGRGGGKSWTVAAVLLVMAASRP-LRVLCTREIQKSIKQSVHQ 80

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
            +   ++ L    +F              E+LE  +   +    +     S         
Sbjct: 81  LLKDVITRLNLHAFF--------------EVLETEVRGINGSLFLFSGLQS---HTVDSI 123

Query: 187 PHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPL 245
                   V+ +EA G       +++    +     +  +  N        Y  F   P 
Sbjct: 124 KSFEGCDIVWVEEAHGVSKKSWDTLIPTIRKEGSEIWLTL--NPDMETDETYQRFIATPS 181

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNY--- 301
            D    +I+ R          E        + +D       G+  +        H     
Sbjct: 182 PDTWVVEINWRDNPWFPRVLDEERRKAKRTMLADDYAHIWEGKARRVAAGAIYRHEMESV 241

Query: 302 IEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +  +R+   D   P+    D+         +V R    +  I  
Sbjct: 242 YLDNRARDVPYDPTLPVHTVWDLGWNDAMSIALVQRGPQDVRIIGH 287


>gi|116625333|ref|YP_827489.1| hypothetical protein Acid_6278 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228495|gb|ABJ87204.1| hypothetical protein Acid_6278 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 260

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 76/270 (28%), Gaps = 31/270 (11%)

Query: 46  EHFSQPH--RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIS 103
           E    P    W    +        + V N+     +  ++  R  GK+T+ A   +    
Sbjct: 16  EIPQGPEIADWVRGTLGFEADATQARVLNTRSK--RVLLNCTRQWGKSTVTAARAVHEAV 73

Query: 104 TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMG 163
           T+     I ++ +  Q    +                 E  +  L          E S+ 
Sbjct: 74  TKADSLTIAVSPTARQTGEFVRK--------------AEAFAGMLKMKVKGDGSNEMSLA 119

Query: 164 IDSKHYTITCRTYSEERPDTFVGPHNTHGM-AVFNDEASGTPDIINKSILGFFTELNPNR 222
             +    +         P T         +  +  DEAS   D +  ++           
Sbjct: 120 FPNGSRIV-------GLPGTEATVRGFSAVALLLVDEASRVEDDLYMAMRPMLAVSGGTL 172

Query: 223 FWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARI 282
           +  + S      G+FY+ +      W+R  +         + + E      G    + R 
Sbjct: 173 W--LMSTPWGKRGFFYEAWANGGPTWERVSVKAEDCPRFGAEYLEEERRVMGE--RIYRQ 228

Query: 283 EILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           E   +F +         + IE A S +   
Sbjct: 229 EYCCEFGESSS-AVFDRDLIEAAFSDDFGP 257


>gi|221067857|ref|ZP_03543962.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           KF-1]
 gi|220712880|gb|EED68248.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           KF-1]
          Length = 434

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 86/286 (30%), Gaps = 26/286 (9%)

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
                  +P  +K  +  GRG GK+   A ++L + ++RP + ++C    +  +K ++  
Sbjct: 23  EKLAGIWDPKRYKV-MHGGRGGGKSWTVAAVLLVMAASRP-LRVLCTREIQKSIKQSVHQ 80

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
            +   ++ L    +F              E+LE  +   +    +     S         
Sbjct: 81  LLKDVIARLNLHAFF--------------EVLETEVRGINGSLFLFSGLQS---HTVDSI 123

Query: 187 PHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPL 245
                   V+ +EA G       +++    +     +  +  N        Y  F   P 
Sbjct: 124 KSFEGCDIVWVEEAHGVSKKSWDTLIPTIRKEGSEIWLTL--NPDMETDETYQRFIATPC 181

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNY--- 301
            D    +I+ R          E        + +D       G+  +        H     
Sbjct: 182 PDTWVVEINWRDNPWFPRVLDEERRKAKRTMLADDYAHIWEGKARRVAAGAIYRHEMESV 241

Query: 302 IEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +  +R+   D   P+    D+         +V R    +  I  
Sbjct: 242 YLDNRARDVPYDPTLPVHTVWDLGWNDAMSIALVQRGPQDVRIIGH 287


>gi|145638997|ref|ZP_01794605.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
 gi|145271969|gb|EDK11878.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
          Length = 379

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 9/210 (4%)

Query: 154 YAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILG 213
           + ++ +  +   +             + +       T    V+ +E           ++ 
Sbjct: 14  FFDVQKTQIIGQNGSRFTFA----GLKTNITSIKSMTGIDVVWVEEGENVSKESWDILIP 69

Query: 214 FFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIISR 272
              E       I++ N + +    Y  F   P E  K   ++ +          E +   
Sbjct: 70  TIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFPKELMEDMEQM 127

Query: 273 YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIMGCDIAGEGGD 330
              D ++ R    G+         I   +IE A+               +G D+A EG D
Sbjct: 128 RERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKVGFDVADEGAD 187

Query: 331 KTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                F  G+++  +  W    + ++    
Sbjct: 188 ANANAFVHGSVVLGVEVWKNGDVIDSANRT 217


>gi|300922509|ref|ZP_07138621.1| phage terminase large subunit [Escherichia coli MS 182-1]
 gi|300421167|gb|EFK04478.1| phage terminase large subunit [Escherichia coli MS 182-1]
          Length = 240

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/235 (13%), Positives = 69/235 (29%), Gaps = 22/235 (9%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
               +K A   GRG GK+   A +++   + R  + I+C    +  + +++   +   + 
Sbjct: 13  EAHRYKVA-KGGRGSGKSWAIARLLV-EAARRQPVRILCARELQNSISDSVIRLLEDTIE 70

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
              +   FE+Q   +   G  AE +   +  +                            
Sbjct: 71  REGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPT-----------------KIKSLEGID 113

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             + +EA          ++    +      W+   N + +    Y  F   P +D     
Sbjct: 114 ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNPPDDICLLT 171

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
           ++              +      +  + R   LG+         I   ++E A  
Sbjct: 172 VNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATD 226


>gi|319404714|emb|CBI78316.1| phage-related protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 442

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 78/292 (26%), Gaps = 36/292 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLP-HR 138
            GRG GKT   A M   +            I+C    +  L  +   E+ + +   P   
Sbjct: 27  GGRGSGKTRSFALMTAVIGYHHGKAGERGIILCARQFQNSLAESSLEEIKRAIEAYPFLS 86

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
            ++E+    +             +  +        R                  +  + D
Sbjct: 87  DYYEIGDKYIRSKDGCIVYAFAGLDRNIASVKSMGR-----------------ILLCWVD 129

Query: 199 EASGTPDIINKSILGFFTELNPN---RFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQID 254
           EA    D   + ++    E         W+   N  R N      F    + + K  +I+
Sbjct: 130 EAEPVTDAAWQILIPTLREEGKEWHSELWVTW-NPCRENAAVEKRFRFTKDPNIKGVEIN 188

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
            R      +  +    +      +  +    G++ Q     +     +E           
Sbjct: 189 WRDNPKFPAKLNRDRQADLEQRPEQYQHIWEGEYLQAMQGAYYQKLLLEAEQEGRITTVP 248

Query: 315 YAPLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
             PLI   +  DI G G   D T +   +        +       E   +  
Sbjct: 249 RDPLIQVKIFWDIGGTGAKADATALWVAQ----FVGREIRVLDYYEAQGQPL 296


>gi|259418958|ref|ZP_05742875.1| phage DNA Packaging Protein [Silicibacter sp. TrichCH4B]
 gi|259345180|gb|EEW57034.1| phage DNA Packaging Protein [Silicibacter sp. TrichCH4B]
          Length = 478

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/296 (14%), Positives = 80/296 (27%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q+++ +    S  L+ 
Sbjct: 85  VILGGRGAGKTRAGAEWVRSEVEGAEPFGIGRARRMALVGETYDQVRDVMIHGDSGILAC 144

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                             T                  A
Sbjct: 145 SPPDRRPEWRAGERRL------------------VWPNGATAQAFSASDPEALRGPQFDA 186

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          R  +    T R       +   P      + 
Sbjct: 187 AWVDELAKWRRAQDAWDMLQFALRLGAAPRVCVT--TTPRNVPLLKQLLESPST-VTTHA 243

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +  GF   + +RYG  S +AR E+ G               +E+   R+   
Sbjct: 244 PTEANRANLAPGFLTEVRARYGG-SRLARQELDGVMLADVDGALWTSGMLEQLQRRDRPP 302

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC-PVG 364
                +++  D    A +G D   ++         I +W A ++ +   +G  P G
Sbjct: 303 --LDRIVVAVDPSVSAHKGSDACGIIVAGAQTQGPISEWRAYVLADHTVQGLGPTG 356


>gi|148724503|ref|YP_001285469.1| DNA packaging protein [Cyanophage Syn5]
 gi|145588148|gb|ABP87967.1| DNA packaging protein [Synechococcus phage Syn5]
          Length = 574

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 55/382 (14%), Positives = 99/382 (25%), Gaps = 83/382 (21%)

Query: 18  MLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTI 77
             + A+    FK F+     W     P     +P R QL    A+  +            
Sbjct: 4   EKLEAKMRGDFKFFLSLV--WRELDLP-----KPTRAQL----AIADYLQHGPK------ 46

Query: 78  FKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            +  ISA RG+GK+ + A  +LW++   P   I+ I+ S+ +  N         L +   
Sbjct: 47  -RLQISAFRGVGKSWITAAFVLWVLFVDPDRKIMVISASKERADNFSIFCQKLILDIEWL 105

Query: 138 RHWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVG 186
            H     S        +     +       K   IT +              E P     
Sbjct: 106 SHLRPRDSDQRWSRISFDVGPAKPHQAPSVKSVGITGQMTGSRAHLMVFDDVEVPANSAT 165

Query: 187 PHNTHGMAVFNDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRR 232
                 +     E+                 P                   W      R 
Sbjct: 166 DMQREKLLQLVSESESILVPDDDARIMFLGTPQSTFTIYRKLAERSYRPFVWPARY-PRD 224

Query: 233 LNGWFYDIFNIPLEDWKR---YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG--- 286
           L+ +   +    + D ++              +        S  G  + + +  +     
Sbjct: 225 LSKYEGLLAPQLVADLEKDPELTWKPTDT-RFNELNLMERESAMGRSNFMLQFMLDTSLS 283

Query: 287 ---QFPQQEVNNFI-----------------------------PHNYIEEAMSREAIDDL 314
              +FP +  +  +                             P +     M  +     
Sbjct: 284 DAEKFPLKFQDLIVTPLGAECAEAYAWSADPRYMRKELNPVGLPGDRFYGPMYIDEGIVP 343

Query: 315 YAPLIMGCDIAGEGGDKTVVVF 336
           Y+  I+  D +G G D+TV V 
Sbjct: 344 YSETIVSVDPSGRGTDETVAVV 365


>gi|311992670|ref|YP_004009538.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Ac42]
 gi|298684453|gb|ADI96414.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Ac42]
          Length = 619

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/362 (11%), Positives = 94/362 (25%), Gaps = 61/362 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R        ++ L E     +C      F   +                  +Q + ++
Sbjct: 104 LKRANIKTSWTKEMLSEWK---KCRDDIVYFAETYCAITHIDYGTIKVK-LRDYQRDMLQ 159

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +        +    T  K +    R +GKT   A  +   +      S   +A+  +  
Sbjct: 160 LM--------DGGRLTCCKLS----RQLGKTAAVAIFLAHYVCFNKSKSAGILAHKGSMS 207

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  L+    + + +LP                   E  ++S+ +D+              
Sbjct: 208 EEVLFR-AKQAIELLPD-----------FLQPGIVEWNKRSIELDNGSSI-------GAY 248

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +     +    +I    +        I+ + T      FY
Sbjct: 249 ASSPDAVRGNSFALIYIDETAFIQNWEDCWLAIQPVISSG--RHSKIIMTTTPNGMNHFY 306

Query: 239 DIFNIP---LEDWKRYQIDT--------RTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           D++         ++ Y+                 D G+     +      +    E LG 
Sbjct: 307 DLWQGAIKGKSGFRPYEATWVSVKERLYTEAGDFDDGWEFSYRAIGSSSLEQFLQEHLGN 366

Query: 288 FPQQEVNNFIPHNYIE---EAMSREAI-------DDLYAPLIMGCDIA-GEGGDKTVVVF 336
           F             +    + +  ++         +     I   D A G G D   +  
Sbjct: 367 FSGGSNTLIAGPKLVLLEGKKIIPDSYGFYQFETPNPERKYIATLDSAEGRGQDYHALNI 426

Query: 337 RR 338
             
Sbjct: 427 ID 428


>gi|291335709|gb|ADD95314.1| DNA packaging protein B [uncultured phage MedDCM-OCT-S05-C139]
          Length = 309

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/320 (12%), Positives = 71/320 (22%), Gaps = 47/320 (14%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            FK F+     W     P      P R Q     A+  +  S          +  I A R
Sbjct: 11  DFKLFLQAL--WDQLDLP-----SPTRAQ----YAIADYLQSGPK-------RLQIQAFR 52

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ +    +LW +   P   I+ I+ S+ +  N         +      H       
Sbjct: 53  GVGKSWITGAFVLWTLFNDPEKKIMIISASKERADNMSIFLQKLIIETPWLNHLQPKSDD 112

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHGMAVF 196
                  +            K   IT +              E P   +       +   
Sbjct: 113 GRWSRISFDVACSPHQAPSVKSVGITGQLTGSRADLMILDDIEVPGNSMTELMREKLLQL 172

Query: 197 NDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
             EA                 P                   W      R    +   I  
Sbjct: 173 CTEAESILTPKDDSRIMYLGTPQTTFTIYRKLAARNYRPFVWTARY-PRNNTPYEGLIAP 231

Query: 243 IPLEDWKRYQIDTR-TVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
              ED          T +           +  G  + + +  +             P   
Sbjct: 232 QLQEDIDNGVTPWTPTDDRFTEDDLVEREASMGRSNFMLQFMLD---TSLSDAEKFPLKM 288

Query: 302 IEEAMSREAIDDLYAPLIMG 321
            +  ++     +    ++  
Sbjct: 289 ADLVITSVNPTEAPDNVVWC 308


>gi|238695035|ref|YP_002922229.1| terminase DNA packaging enzyme large subunit [Enterobacteria phage
           JSE]
 gi|220029171|gb|ACL78106.1| terminase DNA packaging enzyme large subunit [Enterobacteria phage
           JSE]
          Length = 607

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/385 (10%), Positives = 101/385 (26%), Gaps = 70/385 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF--KNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           + R     Q   + + E     + ++ F      +    +G     L        +Q + 
Sbjct: 91  LRRANIKTQYTPEMIAEWKRCRKDIVYFAETYCAITHIDYGTIKVQL------RDYQKDM 144

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           ++ +  H +    +             R +GKTT  A  +   +      ++  +A+  +
Sbjct: 145 LKIM--HENRMSAHKLS----------RQLGKTTAVAIFLAHYVCFNKDKAVGILAHKGS 192

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
                L     + + +LP                   E  ++S+ +++            
Sbjct: 193 MAVEVLER-TKQAIELLPD-----------FLQPGIVEWNKKSIVLENGSSI-------G 233

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               +           ++ DEA+          +I    +    ++   + + T      
Sbjct: 234 AYASSPDAVRGNSFSFIYIDEAAFISAWQDAWLAIQPVISSGRESKL--IMTTTPNGLNH 291

Query: 237 FYDIFNIPLED----------WKRYQIDTRT-VEGIDSGFHEGIISRYGLDSDVARIEIL 285
           FYDI+   ++           W   +       +  D G+     +  G   +    E  
Sbjct: 292 FYDIWQSAIDGKSGYVPYEAVWHSVKERLYNKADIFDDGYEWSSQAIAGSSLEQFLQEHN 351

Query: 286 GQFPQQEVNNFIPHNYI---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            +F                       +    +          +   D + G G D   + 
Sbjct: 352 AEFFGSSGTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQ 411

Query: 336 FRRGNIIEHIFDWSAKLIQETNQEG 360
                    I ++  K +   +   
Sbjct: 412 IID------ITEFPYKQVAVYHSNT 430


>gi|34419588|ref|NP_899601.1| terminase DNA packaging enzyme large subunit [Vibrio phage KVP40]
 gi|13661164|dbj|BAB41133.1| gp17v [Bacteriophage KVP40]
 gi|34333269|gb|AAQ64424.1| terminase DNA packaging enzyme large subunit [Vibrio phage KVP40]
          Length = 600

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/340 (11%), Positives = 81/340 (23%), Gaps = 59/340 (17%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +C      F   +               P  +Q E +E                  + +I
Sbjct: 98  KCRDDIVYFAENYCSIVHIDLGNIKMV-PRPYQKEMLEV-------------ADRSRFSI 143

Query: 83  -SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
               R +GKTT+    +   +          +A+  +     L   V   +  LP     
Sbjct: 144 FLLPRQLGKTTIMGIFLAHYLVFNEDKEAGILAHKGSMSMEVLER-VKNVIENLPD---- 198

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
                         E  + ++  D+                            ++ DE +
Sbjct: 199 -------FLQPGIEEWNKGNITFDNGCKL-------GAYASGSDAVRGKSFSMIYVDECA 244

Query: 202 GTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY---QIDTR 256
             P  D   K+     +        ++TS        ++D++N  ++    +       R
Sbjct: 245 FVPGFDDFWKATFPVISS-GEESKVVLTSTPN-GLNHYHDMWNAAVQGISTFEPYTTTWR 302

Query: 257 TVEGIDSGFHE-------GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY-----IEE 304
            V+       E          +      +    E L  F                  I+ 
Sbjct: 303 AVQNRLYKDGEFDDGEAFKRETIGNTSREAFSQEHLCNFLGTAGTLINGFKLSKMKGIDV 362

Query: 305 AMSREA-----IDDLYAPLIMGCDIA-GEGGDKTVVVFRR 338
               +        +     I+  D + G G D   +    
Sbjct: 363 VKDSDGWCVYKKPEEGHKYILTVDTSEGRGQDYHALHMID 402


>gi|116624478|ref|YP_826634.1| hypothetical protein Acid_5400 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227640|gb|ABJ86349.1| hypothetical protein Acid_5400 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 260

 Score =  100 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/261 (14%), Positives = 71/261 (27%), Gaps = 29/261 (11%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIIC 112
            W    +        + V ++     +  ++  R  GK+T+ A   +       G   I 
Sbjct: 25  EWARRALGFEADAAQARVLDTRSK--RVLLNCTRQWGKSTVTAARAVHEAVKNAGSLTIA 82

Query: 113 IANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTIT 172
           +  +  Q    +                    +  L          E S+   +    + 
Sbjct: 83  VTPTARQTGEFVRK--------------AATFASGLEMRVKGDGHNEMSLAFPNGSRIV- 127

Query: 173 CRTYSEERPDTFVGPHNTH-GMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                   P T            +  DEAS   D +  ++           +  + S   
Sbjct: 128 ------GLPGTEATVRGFSAVTLLLIDEASRVGDDLYMAMRPMLAVSAGTLW--LMSTPH 179

Query: 232 RLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
              G+FY+ +    E W+R  +         + + E      G    + R E   +F + 
Sbjct: 180 GKRGFFYEAWANGGETWERVSVKAEDCPRFKAEYLEEERQVMGE--RIYRQEYCCEFGET 237

Query: 292 EVNNFIPHNYIEEAMSREAID 312
                   + IE A S E   
Sbjct: 238 S-GAVFDRDLIEAAFSDEVTP 257


>gi|21280309|dbj|BAB96804.1| gp17v [Bacteriophage KVP20]
          Length = 600

 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 41/340 (12%), Positives = 81/340 (23%), Gaps = 59/340 (17%)

Query: 23  ECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI 82
           +C      F   +               P  +Q E +E                  + +I
Sbjct: 98  KCRDDIVYFAENYCSIVHIDLGNIKMV-PRPYQKEMLEV-------------ADRSRFSI 143

Query: 83  -SAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
               R +GKTT+    +   +          +A+  +     L   V   +  LP     
Sbjct: 144 FLLPRQLGKTTIMGIFLAHYLVFNEDKEAGILAHKGSMSMEVLER-VKNVIENLPD---- 198

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
                         E  + ++  D+                            ++ DE +
Sbjct: 199 -------FLQPGIEEWNKGNITFDNGCKL-------GAYASGSDAVRGKSFSMIYVDECA 244

Query: 202 GTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP---LEDWKRYQIDTR 256
             P  D   K+     +        ++TS        ++D++N     +  ++ Y    R
Sbjct: 245 FVPGFDDFWKATFPVISS-GEESKVVLTSTPN-GLNHYHDMWNAAVAGVSTFEPYTTTWR 302

Query: 257 TVEGIDSGFHE-------GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY-------I 302
            V+       E          +      +    E L  F                    I
Sbjct: 303 AVQNRLYKDGEFDDGEAFKSETIGNTSREAFSQEHLCNFLGTAGTLINGFKLSKMKGQDI 362

Query: 303 EEAMSREA---IDDLYAPLIMGCDIA-GEGGDKTVVVFRR 338
            +           +     I+  D + G G D   +    
Sbjct: 363 VKDHDGWYVYKQPEENHKYILTVDTSEGRGQDYHALHMID 402


>gi|212499721|ref|YP_002308529.1| terminase [Bacteriophage APSE-2]
 gi|238898754|ref|YP_002924436.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
 gi|211731690|gb|ACJ10178.1| terminase [Bacteriophage APSE-2]
 gi|229466514|gb|ACQ68288.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
          Length = 469

 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 81/288 (28%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      +++++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +                +   +       +        +    H       + +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      W    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       + +            +    R    G+      +  I   ++E A+     
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|211731806|gb|ACJ10127.1| terminase [Bacteriophage APSE-3]
          Length = 469

 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 81/288 (28%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      +++++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +                +   +       +        +    H       + +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      W    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       + +            +    R    G+      +  I   ++E A+     
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|211731737|gb|ACJ10086.1| terminase [Bacteriophage APSE-5]
          Length = 469

 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 81/288 (28%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      +++++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +                +   +       +        +    H       + +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      W    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKELIDTQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       + +            +    R    G+      +  I   ++E A+     
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|291336431|gb|ADD95986.1| hypothetical protein Ddes_0719 [uncultured organism
           MedDCM-OCT-S04-C1073]
          Length = 311

 Score = 99.2 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 75/269 (27%), Gaps = 41/269 (15%)

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQS 161
           ++ +       IA +  Q K+  W  + ++ + +P+                  +  E  
Sbjct: 1   MTKKKNPRYAYIAPTFKQAKSIAWDYMKQFTAKIPN-----------------TKFNETE 43

Query: 162 MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNP 220
           + +D           +    +   G    +      DE +     +  + I    +  + 
Sbjct: 44  LRVD----LPNGSRITLLGAENSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALS--DR 97

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
             + +       +N  FYD++      EDW  Y+      + +D    E      G    
Sbjct: 98  KGYCVFIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK- 156

Query: 279 VARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVV 335
               E    +                 ++        D   P+    D+     D + ++
Sbjct: 157 -YLQEFECDWIANIEGAIYGEEIAKIEDKNQIARVPYDPTLPVSTAWDLGV--ADHSSII 213

Query: 336 FRR--GNIIEHIFDWSAKLIQETNQEGCP 362
           F +  G  ++ I         E    G P
Sbjct: 214 FFQQKGTGVQII------DYHEERGHGLP 236


>gi|29366753|ref|NP_813693.1| gp33 [Streptomyces phage phiBT1]
 gi|29243073|emb|CAD80101.1| gp33 [Streptomyces phage phiBT1]
          Length = 527

 Score = 99.2 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 80/314 (25%), Gaps = 28/314 (8%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPG---MS 109
            WQ   +                      +   R  GK+T+ A +ML+ +    G     
Sbjct: 54  PWQRTLLIDAYELTQDTFGRWRRKHRTVVVCVARKNGKSTIAAAIMLYHLIADRGDAQRQ 113

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWF-EMQSLSLHPSGWYAELLEQSMGIDSK- 167
           +I  AN   Q +  ++    + ++  P       +Q   +        ++    G     
Sbjct: 114 VIAAANDRNQAR-MVFDSAKQMVNASPKLAAVCNVQRDVIRYKDNTYRVVSADAGRQQGL 172

Query: 168 -------HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
                        ++       T         M +    A   PD           E   
Sbjct: 173 NPAAVSLDEYAFSKSSDLFDALTLGSAARNQPMFLIISTAGPDPDGPF----AALCEQGE 228

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRT---VEGIDSGFHEGIISRYGLDS 277
                   +       FY  +   L +   +             D    +   +     +
Sbjct: 229 RVNSGEADDPT----LFYRSWGPKLGETVDHLDPEVWARCNPSYDILNPDDFKAAAQRST 284

Query: 278 DV-ARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV-- 334
           +   RI  L QF +          +   A   +   +    ++ G D + +G D T +  
Sbjct: 285 EASFRIYRLSQFVRGASTWLPHGLWDSLAADDDDPLEPGDEVVCGFDGSWKG-DSTALVA 343

Query: 335 VFRRGNIIEHIFDW 348
              R   +  +  W
Sbjct: 344 CRVRDLRVFVLGHW 357


>gi|240140465|ref|YP_002964944.1| Phage terminase, large subunit, PBSX [Methylobacterium extorquens
           AM1]
 gi|240010441|gb|ACS41667.1| Phage terminase, large subunit, PBSX [Methylobacterium extorquens
           AM1]
          Length = 422

 Score = 99.2 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 80/303 (26%), Gaps = 32/303 (10%)

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
                         +K  +  GRG  K+   A  ++   +T+P M ++C    +  +  +
Sbjct: 4   EFPEKLAFLFESHRYKV-LHGGRGGSKSWGAARALIIQAATKP-MRVLCAREFQNSINES 61

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           +   +S  +  L  R  FE+Q   +                 +    I    +S  R   
Sbjct: 62  VHQLLSNQIEELGLRSAFEIQDKRI--------------IGLNGSEFI----FSGLRHKI 103

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN- 242
                       + +EA    +     ++    +     +  +T N        Y  F  
Sbjct: 104 DSLKSTEGIDVCWVEEAQTVSNASWSKLIPTIRKDGSEIW--VTFNPELDTDPTYQRFVV 161

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
            P  D K  +++                     D D       G   Q            
Sbjct: 162 NPPADAKVVRLNWSDNPWFPEVLRREKDELAARDPDAYLNVWEGATRQTLDGAVYAKEMR 221

Query: 303 EEAMS---REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           E A          D   P+    D+     D T + F +        ++      E +Q 
Sbjct: 222 EAAAEGRIGRVQYDRTKPVHTAWDLGW--ADCTSIWFAQAVG----GEFRVIDFLEVSQR 275

Query: 360 GCP 362
             P
Sbjct: 276 AIP 278


>gi|315426011|dbj|BAJ47659.1| prophage MuMc02, terminase, ATPase subunit [Candidatus
           Caldiarchaeum subterraneum]
          Length = 439

 Score = 98.9 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/305 (18%), Positives = 98/305 (32%), Gaps = 36/305 (11%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
           H WQ  F++              P+ F+  I   RG G T   A        T P  +I+
Sbjct: 22  HPWQKRFIDD-------------PSRFRI-ILKHRGAGATFTIAAEACAEALTHPASTIL 67

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
            I+ S  Q     +  V   LS L ++                  +   +  I ++   +
Sbjct: 68  LISYSLRQSLEI-FRHVRTILSRLENKRLKH-----------GHSIYRLAAKIGARTVEL 115

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
              +     P+           AV+ DEA+      N      FT +  N    + S  +
Sbjct: 116 GNGSRIISLPNNPESLRGYRADAVYVDEAAFFRGDTNLKTAIMFTTVARNGRVTLVSTPK 175

Query: 232 RLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
              GWF++ +      W ++ +       I     E +           R E++ +F  +
Sbjct: 176 GKRGWFHEAWTTD-NTWSKHLVKLGDSPHITMHDLEELRKTMS--PLEWRQEMMCEFLDE 232

Query: 292 EVNNFIPHNYIEEAMSREAI-DDLYAPLIMGCDIAGEGGDKTVV--VFRRGNIIEH--IF 346
             N FIP+  I E +        +   + +G D      D TV+  V   G       + 
Sbjct: 233 V-NAFIPYEKILECVEDYVPARVVGGRVYVGVDFGRF-RDSTVIIAVVEDGERFRVCYVE 290

Query: 347 DWSAK 351
           +   K
Sbjct: 291 ELRQK 295


>gi|291335422|gb|ADD95035.1| phage terminase large subunit [uncultured phage MedDCM-OCT-S04-C26]
          Length = 446

 Score = 98.9 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/320 (16%), Positives = 99/320 (30%), Gaps = 34/320 (10%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIAN 115
           E ++ +    H           +   +SAG G GKT     M + L +   G     +  
Sbjct: 25  ELLDRIRADLHPPQQQFFDNQNEIVGLSAGYGAGKTRALCSMAVKLAAQNIGFIGAVMEP 84

Query: 116 SETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRT 175
           +   +++    +   +L      + F    L  +           +M        + CR+
Sbjct: 85  TAPLIRDIWQTDFELFLEQYEIPYTFRASPLPEY-----------TMHFKEGDSKLLCRS 133

Query: 176 YSEERPDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTR 231
           +     + +      +   V  DE         D     ILG     N  +F     +T 
Sbjct: 134 F-----ENWSRIIGLNLSHVLVDEIDVVSPVIADKAFPKILGRLRAGNVRQFCAA--STP 186

Query: 232 RLNGWFYDIFNIP----LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
               W Y+ F         D +  ++ T+    + S F E + + Y  D  + +  + G+
Sbjct: 187 EGFRWLYNTFGTDEAKERTDRELIKMRTQDNPHLPSDFIERMQANY--DPSMLQAYLNGE 244

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
           F              E  M+    D    PL +G D    G    V+   +   +    +
Sbjct: 245 FINLTTGQVYDRFTRENNMTNIKPDIGLEPLRVGLDF-NIGNMNAVIGIVQDQKLLIFDE 303

Query: 348 WSA----KLIQETNQEGCPV 363
            S       + +T +   P+
Sbjct: 304 ISGSHDTDSLAQTIKSRYPM 323


>gi|319409256|emb|CBI82900.1| phage-related protein [Bartonella schoenbuchensis R1]
          Length = 441

 Score = 98.5 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/291 (13%), Positives = 75/291 (25%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M   +            I+C    +  L  +   E+ + +       
Sbjct: 27  GGRGSGKTRSFALMSAVVGYRHGKAGERGIILCARQFQNSLNESSLEEIKRAIESY---- 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        +Y    +     D +              +          +  + DE
Sbjct: 83  --------SFLRDYYEIGDKYVRSKDGRIIYAFAGLDR----NIASIKSMGRILLCWVDE 130

Query: 200 ASGTPDIINKSILGFFTELNPN---RFWIMTSNTRRLNGWFYDIFNIPLEDW-KRYQIDT 255
           A    +   ++++    E   N     W+   N  R N      F    +   K  +I+ 
Sbjct: 131 AEPVTETAWQTLIPTLREEGENWHCELWVTW-NPLRENAPVEKRFRAVKDPHIKGVEINW 189

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
           R         +    + +    +       G++ Q     +     +E            
Sbjct: 190 RDNPQFPDRLNRAREADFTQRPEQYNHIWEGEYLQAVQGAYYQKLLLEAEQEGRITHVPR 249

Query: 316 APLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
            PLI   +  DI G G   D T +   +        +       E   +  
Sbjct: 250 DPLIQIKIFWDIGGTGAKADATALWVAQ----FIGREIRVLDYYEAQGQPL 296


>gi|33620526|ref|NP_891724.1| terminase DNA packaging enzyme large subunit [Enterobacteria phage
           RB49]
 gi|33347993|gb|AAQ15394.1| terminase DNA packaging enzyme large subunit [Enterobacteria phage
           RB49]
          Length = 607

 Score = 98.5 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/385 (10%), Positives = 100/385 (25%), Gaps = 70/385 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF--KNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           + R     Q   + + E     + ++ F      +    +G     L        +Q + 
Sbjct: 91  LRRANIKTQYTPEMIAEWKRCRKDIVYFAETYCAITHIDYGTIKVQL------RDYQKDM 144

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           ++ +  H +    +             R +GKTT  A  +   +      ++  +A+  +
Sbjct: 145 LKIM--HENRMSAHKLS----------RQLGKTTAVAIFLAHYVCFNKDKAVGILAHKGS 192

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
                L     + + +LP                   E  ++S+ +++            
Sbjct: 193 MAVEVLER-TKQAIELLPD-----------FLQPGIVEWNKKSIVLENGSSI-------G 233

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               +           ++ DE +   +      +I    +        IMT+        
Sbjct: 234 AYASSPDAVRGNSFSFIYIDECAFIQNWTDCFLAIQPVISS-GRESKMIMTTTPN-GLNH 291

Query: 237 FYDIFNIPLED----------WKRYQIDTRT-VEGIDSGFHEGIISRYGLDSDVARIEIL 285
           FYDI+   ++           W   +       +  D G+     +  G   +    E  
Sbjct: 292 FYDIWQSAIDGKSGYVPYEAVWHSVKERLYNKADIFDDGYEWSSQAIAGSSLEQFLQEHN 351

Query: 286 GQFPQQEVNNFIPHNYI---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            +F                       +    +          +   D + G G D   + 
Sbjct: 352 AEFFGSSGTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQ 411

Query: 336 FRRGNIIEHIFDWSAKLIQETNQEG 360
                    I ++  K +   +   
Sbjct: 412 IID------ITEFPYKQVAVYHSNT 430


>gi|6685017|gb|AAF23757.1|AF203974_1 terminase large subunit [Enterobacteria phage RB49]
          Length = 607

 Score = 98.5 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/385 (10%), Positives = 100/385 (25%), Gaps = 70/385 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF--KNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           + R     Q   + + E     + ++ F      +    +G     L        +Q + 
Sbjct: 91  LRRANIKTQYTPEMIAEWKRCRKDIVYFAETYCAITHIDYGTIKVQL------RDYQKDM 144

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           ++ +  H +    +             R +GKTT  A  +   +      ++  +A+  +
Sbjct: 145 LKIM--HENRMSAHKLS----------RQLGKTTAVAIFLAHYVCFNKDKAVGILAHKGS 192

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
                L     + + +LP                   E  ++S+ +++            
Sbjct: 193 MAVEVLER-TKQAIELLPD-----------FLQPGIVEWNKKSIVLENGSSI-------G 233

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               +           ++ DE +   +      +I    +        IMT+        
Sbjct: 234 AYASSPDAVRGNSFSFIYIDECAFIQNWTDCFLAIQPVISS-GRESKMIMTTTPN-GLNH 291

Query: 237 FYDIFNIPLED----------WKRYQIDTRT-VEGIDSGFHEGIISRYGLDSDVARIEIL 285
           FYDI+   ++           W   +       +  D G+     +  G   +    E  
Sbjct: 292 FYDIWQSAIDGKSGYVPYEAVWHSVKERLYNKADIFDDGYEWSSQAIAGSSLEQFLQEHN 351

Query: 286 GQFPQQEVNNFIPHNYI---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            +F                       +    +          +   D + G G D   + 
Sbjct: 352 AEFFGSSGTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQ 411

Query: 336 FRRGNIIEHIFDWSAKLIQETNQEG 360
                    I ++  K +   +   
Sbjct: 412 IID------ITEFPYKQVAVYHSNT 430


>gi|9633565|ref|NP_050979.1| P18 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118013|gb|AAF03961.1|AF157835_18 P18 [Endosymbiont phage APSE-1]
          Length = 469

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 80/288 (27%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      ++++  A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSGHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +                +   +       +        +    H       + +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    S++    +      W    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDSLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKELIDTQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       + +            +    R    G+      +  I   ++E A+     
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|319406198|emb|CBI79835.1| phage-related protein [Bartonella sp. AR 15-3]
          Length = 442

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/291 (13%), Positives = 75/291 (25%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M   +            I+C    +  L  +   E+ + +       
Sbjct: 27  GGRGSGKTRSFALMTAVIGYRHGKTGERGIILCARQFQNSLAESSLEEIKRAIESY---- 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      S +Y    +     D +              +          +  + DE
Sbjct: 83  --------SFLSDYYEVGDKYIRSKDGRIVYAFAGLDR----NIASVKSMGRILLCWVDE 130

Query: 200 ASGTPDIINKSILGFFTELNPN---RFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQIDT 255
           A    D   + ++    E         W+   N  R N      F    + + K  +I+ 
Sbjct: 131 AEPVTDAAWQVLIPTLREEGKEWHSELWVTW-NPCRENAAVEKRFRFTKDPNIKGVEINW 189

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
           R      +  +    +      +  +    G++       +     +E            
Sbjct: 190 RDNPKFPAKLNRDRTADLEQRPEQYQHIWEGEYLLAMQGAYYQKLLLEAEQEGRITTVPR 249

Query: 316 APLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
            PLI   +  DI G G   D T +   +        +       E   +  
Sbjct: 250 DPLIQVKIFWDIGGTGAKADATALWVAQ----FVGREIRVLDYYEAQGQPL 296


>gi|239502629|ref|ZP_04661939.1| hypothetical protein AbauAB_09982 [Acinetobacter baumannii AB900]
          Length = 414

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 81/271 (29%), Gaps = 38/271 (14%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            + +H        +   F+  + AGR  GKT+L +  ++   S +P   I  +A +    
Sbjct: 6   RLSLHPKQMEVYLSNARFRVVV-AGRRWGKTSL-SRTLIISKSRKPRQRIWYVAPTYRMA 63

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K  +W ++ + +                 P  W  ++   S+ I+     +       + 
Sbjct: 64  KQIMWKDLIEAI-----------------PRKWVVKINHSSLSIE----LVNGTLIELKG 102

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYD 239
            D            +  DE     +    + +              +   T +     Y 
Sbjct: 103 ADDPDSLRGVGIDFLVLDEFQDISEEAWTQCLRPTLASTGG---HAIFIGTPKAYNQLYT 159

Query: 240 IFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
           ++    +        W+ +Q  T T   I     E   +     S   + E L  F    
Sbjct: 160 VYMQGQDPKKVKAGQWQSWQFPTITSPFIPESEIEAARADMDEKS--FKQEFLASFETMS 217

Query: 293 VNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
              + P +   +    +   D   P+ +G D
Sbjct: 218 GRVYYPFD--RKEHVGKYPFDPKLPIWIGMD 246


>gi|319899324|ref|YP_004159421.1| hypothetical protein BARCL_1179 [Bartonella clarridgeiae 73]
 gi|319403292|emb|CBI76851.1| phage-related protein [Bartonella clarridgeiae 73]
          Length = 442

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 79/292 (27%), Gaps = 36/292 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLP-HR 138
            GRG GKT   A M   +            I+C    +  L  +   E+ + +   P   
Sbjct: 27  GGRGSGKTRSFALMTAVIGYRHGKAGERGIILCARQFQNSLAESSLEEIKRAIESYPFLS 86

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
            ++E+    +             +  +        R                  +  + D
Sbjct: 87  DYYEVGDKYIRSKDGCIVYAFAGLDRNIASVKSMGR-----------------ILLCWVD 129

Query: 199 EASGTPDIINKSILGFFTELNP---NRFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQID 254
           EA    D   + ++    E      +  W+   N  R N      F    + + K  +I+
Sbjct: 130 EAEPVTDAAWQILIPTLREEGKDWHSELWVTW-NPCRENAAVEKRFRFTKDPNVKGVEIN 188

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
            R      +  +    +      +  +    G++ Q     +     +E           
Sbjct: 189 WRDNPKFPAKLNRDRKADLEQRPEQYQYIWEGEYLQAMQGAYYQKLLLEAEQEGRITKVP 248

Query: 315 YAPLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
             PLI   +  DI G G   D T +   +        +       E   +  
Sbjct: 249 RDPLIQIKIFWDIGGTGAKADATALWVAQ----FVGREIRVLDYYEAQGQPL 296


>gi|37651634|ref|NP_932508.1| gp17 [Aeromonas phage 44RR2.8t]
 gi|34732934|gb|AAQ81472.1| terminase DNA packaging enzyme large subunit [Aeromonas phage
           44RR2.8t]
          Length = 613

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/398 (11%), Positives = 101/398 (25%), Gaps = 82/398 (20%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ L E      C      F   +         +        +Q + + 
Sbjct: 84  LKRANIKIKWTKEMLAERK---RCKEDIVYFAENYCCIEHIDYGIIRVQ-LRDYQKDMLR 139

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +     N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 140 IMAGNRLMAANLS------------RQLGKTTVVAIFLAHFVCFNSAKNVGILAHKASMS 187

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + L +LP                   E  + S+ + +        +     
Sbjct: 188 AEVLHR-TKQALELLPD-----------FLQPGIVEWNKGSITLGNGCAIGAFSS----- 230

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      +Y
Sbjct: 231 --SPDAVRGNSFALIYVDEVAFIPNFTDAWMAIQPVISSGRRSK--ILMTTTPNGLNHWY 286

Query: 239 DIFNIP----------LEDWKRYQIDTRTVEGIDSGFHEGI---------------ISRY 273
           DI+                +  Y     +V+       + +                +  
Sbjct: 287 DIWTAAITPNSSGDGSKSGFVPYTATWSSVKERLYSDGKELSGSDSYFDDGYSWSSKTIA 346

Query: 274 GLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----------IDDLYAPLIMGCD 323
           G   D  + E    F Q      I    + +    +                   I   D
Sbjct: 347 GSALDAFQQEHNTAF-QGTSGTLINGTKLSKLNWIDIPPQDNFTMFEEPKEGRKYIATLD 405

Query: 324 IA-GEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
            A G G D   +          I ++  K +   +   
Sbjct: 406 SAEGRGQDYHAMHIFD------ITEFPYKQVAVYHSNT 437


>gi|291334706|gb|ADD94352.1| hypothetical protein Ddes_0719 [uncultured phage
           MedDCM-OCT-S04-C890]
          Length = 311

 Score = 97.7 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/269 (13%), Positives = 74/269 (27%), Gaps = 41/269 (15%)

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQS 161
           +S         IA +  Q K+  W  + ++ + +P+                  +  E  
Sbjct: 1   MSKLKNPRFAYIAPTFKQAKSIAWDYMKQFTAKIPN-----------------TKFNETE 43

Query: 162 MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNP 220
           + +D           +    +   G    +      DE +     +  + I    +  + 
Sbjct: 44  LRVD----LPNGSRITLLGAENSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALS--DR 97

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
             + +       +N  FYD++      EDW  Y+      + +D    E      G    
Sbjct: 98  KGYCVFIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK- 156

Query: 279 VARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVV 335
               E    +                 ++        D   P+    D+     D + ++
Sbjct: 157 -YLQEFECDWIANIEGAIYGEEIAKIEDKNQIARVPYDPTLPVSTAWDLGV--ADHSSII 213

Query: 336 FRR--GNIIEHIFDWSAKLIQETNQEGCP 362
           F +  G  ++ I         E    G P
Sbjct: 214 FFQQKGTGVQII------DYHEERGHGLP 236


>gi|157311455|ref|YP_001469498.1| large terminase protein [Enterobacteria phage Phi1]
 gi|149380659|gb|ABR24664.1| gp17 terminase DNA packaging enzyme large subunit [Enterobacteria
           phage Phi1]
          Length = 607

 Score = 97.7 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/385 (10%), Positives = 100/385 (25%), Gaps = 70/385 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF--KNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           + R     Q   + + E     + ++ F      +    +G     L        +Q + 
Sbjct: 91  LRRANIKTQYTPEMIAEWKRCRKDIVYFAETYCAITHIDYGTIKVQL------RDYQKDM 144

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           ++ +  H +    +             R +GKTT  A  +   +      ++  +A+  +
Sbjct: 145 LKIM--HENRMSAHKLS----------RQLGKTTAVAIFLAHYVCFNKDKAVGILAHKGS 192

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
                L     + + +LP                   E  ++S+ +++            
Sbjct: 193 MAVEVLER-TKQAIELLPD-----------FLQPGIVEWNKKSIVLENGSSI-------G 233

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               +           ++ DE +   +      +I    +        IMT+        
Sbjct: 234 AYASSPDAVRGNSFSFIYIDECAFIQNWTDCFLAIQPVISS-GRESKMIMTTTPN-GLNH 291

Query: 237 FYDIFNIPLED----------WKRYQIDTRT-VEGIDSGFHEGIISRYGLDSDVARIEIL 285
           FYDI+   ++           W   +       +  D G+     +  G   +    E  
Sbjct: 292 FYDIWQSAIDGKSGYVPYEAVWHSVKERLYNKADIFDDGYEWSSQAIAGSSLEQFLQEHN 351

Query: 286 GQFPQQEVNNFIPHNYI---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            +F                       +    +          +   D + G G D   + 
Sbjct: 352 AEFFGSSGTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQ 411

Query: 336 FRRGNIIEHIFDWSAKLIQETNQEG 360
                    I ++  K +   +   
Sbjct: 412 IID------ITEFPYKPVAVYHSNT 430


>gi|66391955|ref|YP_238880.1| gp17 [Aeromonas phage 31]
 gi|62114792|gb|AAX63640.1| gp17 [Aeromonas phage 31]
          Length = 613

 Score = 97.7 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/398 (11%), Positives = 101/398 (25%), Gaps = 82/398 (20%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ L E      C      F   +         +        +Q + + 
Sbjct: 84  LKRANIKIKWTKEMLAERK---RCKEDIVYFAENYCCIEHIDYGIIRVQ-LRDYQKDMLR 139

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +     N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 140 IMAGNRLMAANLS------------RQLGKTTVVAIFLAHFVCFNSAKNVGILAHKASMS 187

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + L +LP                   E  + S+ + +        +     
Sbjct: 188 AEVLHR-TKQALELLPD-----------FLQPGIVEWNKGSITLGNGCAIGAFSS----- 230

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P+      +I    +    ++  I+ + T      +Y
Sbjct: 231 --SPDAVRGNSFALIYVDEVAFIPNFTDAWMAIQPVISSGRRSK--ILMTTTPNGLNHWY 286

Query: 239 DIFNIP----------LEDWKRYQIDTRTVEGIDSGFHEGI---------------ISRY 273
           DI+                +  Y     +V+       + +                +  
Sbjct: 287 DIWTAAITPNSSGDGSKSGFVPYTATWSSVKERLYSDGKELSGSDSYFDDGYSWSSKTIA 346

Query: 274 GLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----------IDDLYAPLIMGCD 323
           G   D  + E    F Q      I    + +    +                   I   D
Sbjct: 347 GSALDAFQQEHNTAF-QGTSGTLINGTKLSKLNWIDIPPQDNFTMFEEPKEGRKYIATLD 405

Query: 324 IA-GEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
            A G G D   +          I ++  K +   +   
Sbjct: 406 SAEGRGQDYHAMHIFD------ITEFPYKQVAVYHSNT 437


>gi|311992925|ref|YP_004009792.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Acj61]
 gi|295815214|gb|ADG36140.1| gp17 terminase DNA packaging enzyme large subunit [Acinetobacter
           phage Acj61]
          Length = 611

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 96/367 (26%), Gaps = 69/367 (18%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSF--KNFVMRFFPWGIKGKPLEHFSQPHRWQLEF 58
           + R        ++ + E     + V+ F  +   +    +G+    L        +Q + 
Sbjct: 94  LKRANIKIMWTQEMIDEWKRCRDDVVYFAERYCAITHIDYGVIKVQL------RDYQKDM 147

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSE 117
           +  +  +             + ++S   R +GKTT  A  +   +      S+  +A+  
Sbjct: 148 LRIMSGN-------------RMSVSKLSRQLGKTTAVAIFLAHYVCFNKAKSVGILAHKG 194

Query: 118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
           +     L     + + +LP                   E  + ++ +D+           
Sbjct: 195 SMSAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGNITLDNGSSI------- 235

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
                +           ++ DE +     +    +I    +        I+ + T     
Sbjct: 236 GAYASSPDAVRGNSFSLIYIDEVAFVQNWEDCWLAIQPVISSG--RHSKIVMTTTPNGMN 293

Query: 236 WFYDIFNIP----------LEDWKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
            FY I+               +W   +       +  D G+     + YG   +  R E 
Sbjct: 294 HFYTIWTAAVGKKSGFIPYESEWNAVKERLYDDNDEFDDGWSFSSKAIYGSSVEQFRQEH 353

Query: 285 LGQFPQQEVNNFIPHNY------------IEEAMSREAIDDLYAPLIMGCDIA-GEGGDK 331
            G F                          +    +          I   D A G G D 
Sbjct: 354 KGVFSGGSGTLISGMKLSVLDHSEPININDDNTFFKFKEPSPERKYIATLDSAEGRGQDY 413

Query: 332 TVVVFRR 338
             +    
Sbjct: 414 HSLNIID 420


>gi|303257560|ref|ZP_07343572.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
 gi|302859530|gb|EFL82609.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
          Length = 330

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 56/174 (32%), Gaps = 15/174 (8%)

Query: 191 HGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE--- 246
           +   V  DE +     +  + I     +    + W     T +    F  +++  L    
Sbjct: 2   YFDGVVIDEVAQIKPTLWGEVIRPALAD---RKGWAAFIGTPKGINLFSQLYDQALNLMS 58

Query: 247 ----DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
               DW            ID      +        +  R E L  F   + N  IP + I
Sbjct: 59  KGDPDWIAMLYSVEQTHVIDEKELAALKVEMSE--NEFRQEFLCDFSAAQDNGLIPIDDI 116

Query: 303 EEAMSREAIDDLY--APLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQ 354
             A ++   +  Y  APLI G D+A  G D +V+  RRG +             
Sbjct: 117 RAAANKFYRESEYMGAPLIYGIDVARFGSDASVIFKRRGLVAFEPIVIRKFDNM 170


>gi|224583103|ref|YP_002636901.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467630|gb|ACN45460.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 492

 Score = 97.3 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/334 (13%), Positives = 90/334 (26%), Gaps = 53/334 (15%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIA 114
           Q    EA + +         P  FK A   GRG  KT      +L       G  +IC  
Sbjct: 4   QCSIPEAFEEYLQ-------PARFKVAY-GGRGSAKTRTF-ITILLNNVIYHGWKLICFR 54

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
                +K + +AE+ + ++         +    +                 +        
Sbjct: 55  EYMKSIKESCYAEIVEEINRRNLHSLVTINKTEIF----------------ANSGGRISF 98

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF-----TELNPNR----FWI 225
            +     +   G    +  A   +EA        ++++        +           W+
Sbjct: 99  DFLRLNVENIKGY--ANFDAALVEEAENVSKDSWETLIPTVRKEFYSAEYGRVVESEIWV 156

Query: 226 MTSNTRRL---------NGWFYDIFNIPLEDWKRYQ-IDTRTVEGIDSGFHEGIISRYGL 275
              N +               Y  ++     +   + I+              +      
Sbjct: 157 A-YNPKNRLSDTHQRFVTNRIYPDYDENGNRYCIVKQINYTANPWFPETLRRDMEIMKKA 215

Query: 276 DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTV 333
           + ++ R   LG+         I   ++E A              +I   D +  G D   
Sbjct: 216 NHELYRHVYLGEPVGASEMAIIKFAWLEAATDAHIKLGWKAKGAVIAAHDPSDTGPDAKG 275

Query: 334 VVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI 367
              R G++++ + +     I     EG    SS+
Sbjct: 276 YAVRHGSVVKRVCEGLLMDI----NEGADWASSL 305


>gi|327191373|gb|EGE58399.1| prophage MuMc02, terminase, ATPase subunit, putative [Rhizobium
           etli CNPAF512]
          Length = 248

 Score = 97.3 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/263 (16%), Positives = 85/263 (32%), Gaps = 40/263 (15%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P  WQ   + A                 +  +   R  GK+T+ A++++      P   
Sbjct: 22  EPDPWQANLLRA--------------NPRRSMLLCSRQSGKSTVAAFLVIQTALFVPAAQ 67

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I+ ++ ++ Q    L+  +  +LS LP       +S             +Q   + +   
Sbjct: 68  IVVVSPTQRQSNE-LFRTIVGFLSRLPGAPRPTAES-------------KQGTELSNGAR 113

Query: 170 TITCRTYSEERPDTFVGPHN-THGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
            ++        P T            V  DEA+   D +  ++        P+   +  +
Sbjct: 114 VLS-------LPGTEKTIRGIAGVDLVVMDEAARVEDALLTAVRPMMATK-PDARLVALT 165

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
                 GWFY+ +      W+R ++       I   F +  +   G  +     E   +F
Sbjct: 166 TPAGKRGWFYEAWVSDDPSWERVRVPASACPRITQQFLDEELKALG--AIKFSEEYGLEF 223

Query: 289 PQQEVNNFIPHNYIEEAMSREAI 311
                    P   IE A ++E  
Sbjct: 224 HD-PEEAVFPLAIIEAAFTQEVR 245


>gi|319407675|emb|CBI81323.1| phage-related protein [Bartonella sp. 1-1C]
          Length = 442

 Score = 97.3 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 78/292 (26%), Gaps = 36/292 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLP-HR 138
            GRG GKT   A M   +            I+C    +  L  +   E+ + +       
Sbjct: 27  GGRGSGKTRSFALMTAVIGYRYGKAGERGIILCARQFQNSLAESSLEEIKRAIESYSFLS 86

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
            ++E+    +     Y       +  +        R                  +  + D
Sbjct: 87  DYYEIGDKYIRSKDGYIVYAFAGLDRNIASVKSMGR-----------------ILLCWVD 129

Query: 199 EASGTPDIINKSILGFFTELNPN---RFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQID 254
           EA    D   + ++    E         W+   N  R N      F    + + K  +I+
Sbjct: 130 EAEPVTDAAWQILIPTLREEGKEWHSELWVTW-NPCRENAAVEKRFRFTEDPNIKGVEIN 188

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
            R      +  +    +      +  +    G++ Q     +     +E           
Sbjct: 189 WRDNPKFPAKLNRDRKADLEQRPEQYQHIWEGEYLQAMQGAYYQKLLLEAEQEGRITIVP 248

Query: 315 YAPLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
             PLI   +  DI G G   D T +   +        +       E   +  
Sbjct: 249 RDPLIQVKIFWDIGGTGAKADATALWVAQ----FVGREIRVLDYYEAQGQPL 296


>gi|330004400|ref|ZP_08304921.1| phage terminase, large subunit, PBSX family [Klebsiella sp. MS
           92-3]
 gi|328536646|gb|EGF62969.1| phage terminase, large subunit, PBSX family [Klebsiella sp. MS
           92-3]
          Length = 418

 Score = 96.9 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 80/273 (29%), Gaps = 37/273 (13%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMKVFKSPHRFKV-VCAGRRWGKSRLSISKIIKAAAADRKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L                 P  W A+  + +M I            + 
Sbjct: 66  MARQILWDDLQEVL-----------------PRKWIAKKNDTTMTI----VLKNGSEIAL 104

Query: 179 ERPDTFVGPHNTHGMAVFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  D            V  DE     PD   K +    +        ++     +    F
Sbjct: 105 KGADKPDTLRGVALNFVVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTP-KGFSEF 161

Query: 238 YDIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
           + +F I           WK +Q  T     +     E   +    D      E L  F  
Sbjct: 162 HKLFMIGQNPEMQAKGLWKSWQFVTADSPFVPDSEIEAAKNDM--DPKSFAQEYLASFEN 219

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
                + P +       R    +   P+ +G D
Sbjct: 220 MSGRVYYPFD--RNVHVRPLQFNPRLPIWVGQD 250


>gi|82776052|ref|YP_402399.1| putative bacteriophage protein [Shigella dysenteriae Sd197]
 gi|81240200|gb|ABB60910.1| putative bacteriophage protein [Shigella dysenteriae Sd197]
          Length = 272

 Score = 96.9 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/253 (12%), Positives = 78/253 (30%), Gaps = 23/253 (9%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GR   K+   A + +  +S +  +   C    + +++ +++  +   +     RH F +
Sbjct: 39  GGRSSSKSWDAAGIAI-FLSNKYTLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRI 97

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +    +    +     +            ++ +EA   
Sbjct: 98  LNNKIINRV-------------TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHAL 140

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGID 262
            +   K +     +     ++I   N   +  + +  F   P E     +I+      + 
Sbjct: 141 TEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLS 198

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYAPLIM 320
               + I +    D D  +    G     +    I  ++IE A+        +      +
Sbjct: 199 DTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRI 258

Query: 321 GCDIAGEGGDKTV 333
           G D+A  G DK  
Sbjct: 259 GFDVADSGTDKCA 271


>gi|319786769|ref|YP_004146244.1| phage terminase, large subunit, PBSX family [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465281|gb|ADV27013.1| phage terminase, large subunit, PBSX family [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 439

 Score = 96.6 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 70/301 (23%), Gaps = 28/301 (9%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K A   GRG GK+   A + +      PG       ++   L+     EV K L  
Sbjct: 18  PARYKGA-HGGRGSGKSHFFAGLAVEDAIAFPG-------DAGEGLRMVCIREVQKSLKH 69

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
              +   E +             +   +        I  +   +   D+       H   
Sbjct: 70  S-AKSLIEAKLAEFGMREADGFKVFNEVIKTPGDGVIIFQGMQDHTADSIKSLEGFHR-- 126

Query: 195 VFNDEASGTPDIINKSILGFFTELNP-----NRFWIMTSNTRRLNGWFYDIFNIPLE--D 247
            + +EA          +       +      +  W    N RR       +   P     
Sbjct: 127 AWVEEAQSLSSTSLGLLRPTIRWEDAGRGLTSEMWFGW-NPRRKTDPVDVLLRGPEPPTG 185

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMS 307
               + +        S   +  +       D       G +       +     +     
Sbjct: 186 AAVVRANWSDNPWFPSVLEQERLDCLRSMPDQYEHIWEGGYATAATGAYFAQALVTAKSE 245

Query: 308 REAIDDLYAPLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCP 362
                    PL+      DI G G   D   +   +        +       E   +   
Sbjct: 246 GRIGRVAADPLMTTRAYWDIGGTGAKADACAIWIVQ----FVGREVRVLDYYEAQGQPLA 301

Query: 363 V 363
            
Sbjct: 302 T 302


>gi|299534276|ref|ZP_07047625.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           S44]
 gi|298717734|gb|EFI58742.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           S44]
          Length = 436

 Score = 96.6 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 73/299 (24%), Gaps = 27/299 (9%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
            P  +K A   GRG GK+     M++      PG      A+    L++    EV K LS
Sbjct: 17  EPARYKGA-HGGRGSGKSHFFGEMLIEDCLYEPG------ASGGEGLRSVCIREVQKDLS 69

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
               +   E +  +L+        + + +        I  +  ++   D+          
Sbjct: 70  QS-SKALLEGKLSALNLGSADGFRVYKDVITTPGDGLIIFKGMNDYTADSVKSLEGFKR- 127

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL--EDWKRY 251
             + +EA          +            W    N R        +             
Sbjct: 128 -AWWEEAQTATQRSLDLLRPTMRAPGSQ-LWFGW-NPRFAMDPVDRMLRAAELPTGALVV 184

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           Q + R      +   +  +       D       G +       +               
Sbjct: 185 QANWRDNPWFPAELEQERLDCLRQQPDKYDHIWEGGYETVNEGAYFAKQLTAAKAEGRLG 244

Query: 312 D---DLYAPLIMGCDIAGEGG--DKTVVVFRR--GNIIEHIFDWSAKLIQETNQEGCPV 363
               D    L    DI G G   D   +   +  G  +  +         E   +    
Sbjct: 245 VVAADPSMRLRAYVDIGGTGRNADSFAMWIVQFVGLQVRVL------DYYEAQGQPMAT 297


>gi|9631142|ref|NP_047924.1| gp33 [Streptomyces phage phiC31]
 gi|3947452|emb|CAA07103.1| gp33 [Streptomyces phage phiC31]
          Length = 519

 Score = 96.6 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 44/314 (14%), Positives = 85/314 (27%), Gaps = 29/314 (9%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPG---MS 109
            WQ E +    V                 +   R  GK+T+ A +ML+ +    G     
Sbjct: 51  PWQRELLIDAYVLTQDTFGRWRRKHRTVVVCVARKNGKSTIAAAIMLYHLIADRGDAQRQ 110

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWF-EMQSLSLHPSGWYAELLEQSMGIDSK- 167
           II  AN   Q +  ++    + ++  P      ++Q   +        ++    G     
Sbjct: 111 IIAAANDRNQAR-MVFDSAKQMVNASPKLAAVCDVQRDVIRYKDNTYRVVSADAGRQQGL 169

Query: 168 -------HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
                        +        T         M +    A   PD           E   
Sbjct: 170 NPAAVSLDEYAFSKHSDLFDALTLGSAARNQPMFLIISTAGPDPDGPF----AALCEQGE 225

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRT---VEGIDSGFHEGIISRYGLDS 277
                   +       FY  +   L +   +             D    +   +     +
Sbjct: 226 RVNSGEADDPT----LFYRSWGPKLGETVDHLDPDVWRACNPSYDILNPDDFKAAAQRST 281

Query: 278 DV-ARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV-- 334
           +   RI  L QF +       PH   +   + +   +    +++G D + +G D T +  
Sbjct: 282 EASFRIYRLSQFVRGASTWL-PHGLWDSLAADDDPLEPGDEVVLGFDGSWKG-DSTALVA 339

Query: 335 VFRRGNIIEHIFDW 348
              R   +  +  W
Sbjct: 340 CRIRDLKVFVLGHW 353


>gi|163851850|ref|YP_001639893.1| terminase large subunit [Methylobacterium extorquens PA1]
 gi|163663455|gb|ABY30822.1| terminase large subunit [Methylobacterium extorquens PA1]
          Length = 342

 Score = 96.6 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 75/302 (24%), Gaps = 32/302 (10%)

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
                      P  +K A   GRG  K+      +L ++  +  + ++C    +  +  +
Sbjct: 4   EFPERLDFLFEPARYKIAY-GGRGGAKSWGFGRALL-IMGAQKKIRVLCAREFQNSIAES 61

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
             A +S+ + +L    ++E+Q   +                 +    I        R + 
Sbjct: 62  AHALLSQQIDLLGLSGFYEIQEKRV--------------LGSNGTEFIFK----GLRHNV 103

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-N 242
                       + +EA          ++    +      WI   N        Y  F  
Sbjct: 104 ASVKSTEGIDVCWVEEARTVSKSSWDVLIPTIRKEGSE-IWISF-NPELEEDETYKRFVK 161

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
            P    K  +I  +          +  +     D         G            +  +
Sbjct: 162 NPPTGAKVVKIGWQDNPWFPDVLKQEALDLKARDPAAYLTVWDGHCKVVLDGAIYANEIM 221

Query: 303 ---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
              E         D   P+    D+     D T + F +        ++      +    
Sbjct: 222 AATEANRFIRVPYDGTKPVHTFWDLGR--ADMTAIWFAQVVGF----EFRIIDYYQNRGH 275

Query: 360 GC 361
             
Sbjct: 276 AL 277


>gi|83943173|ref|ZP_00955633.1| terminase, large subunit, putative [Sulfitobacter sp. EE-36]
 gi|83846181|gb|EAP84058.1| terminase, large subunit, putative [Sulfitobacter sp. EE-36]
          Length = 408

 Score = 96.2 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/296 (14%), Positives = 80/296 (27%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q++  +    S  L+ 
Sbjct: 15  VIMGGRGAGKTRAGAEWVRAQVEGSRPLDAGRCRRVALVGETIEQVREVMIFGDSGILAC 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                               +        G       A
Sbjct: 75  SPADRRPDWEATRKRL------------------VWPNGAVATVHTAHDPEGLRGPQFDA 116

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +          R  +    T R  G   ++   P      + 
Sbjct: 117 AWVDELAKWKKAEETWDQLQFALRLGEDPRVCVT--TTPRNVGVLKNLLASPST-VTTHA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G               IE    R+   
Sbjct: 174 PTEANAANLAGSFLEEVRARYRGT-RLGRQELDGVLLADAEGALWTSERIEAGRVRDVPL 232

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG-CPVG 364
                +++G D    AG G D+  +V           DW A ++ +   +G  P G
Sbjct: 233 --LDRIVVGLDPATTAGAGSDECGIVVVGAQTQGPPQDWRAVVMADCTVQGATPSG 286


>gi|293604595|ref|ZP_06686998.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
 gi|292817011|gb|EFF76089.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
          Length = 463

 Score = 96.2 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/278 (14%), Positives = 86/278 (30%), Gaps = 24/278 (8%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K  +  GR   KT     M    ++    +  +C+   + ++ ++++  V + +  
Sbjct: 33  PKPYKL-LKGGRFSSKTQDAGGMAA-FLARNYSVRFLCLRQLQNRIADSVYTVVKEKIEA 90

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
              R  F++   ++      +E                   +     +            
Sbjct: 91  AGWRDEFDIGVSTIRHKLTGSE-----------------FLFYGLARNIEEIKGTEGVDV 133

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQI 253
            + +E  G  +     I     +      W++  N   +  +        L  D     I
Sbjct: 134 CWIEEGEGLTEEQWSIIDPTIRKEGAEV-WVLW-NPHLITDFVQAKLPALLGADCIIRHI 191

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI-- 311
           +      + +            D D  R   LGQ    +  + I  ++IE A+       
Sbjct: 192 NYPDNPFLSATAKRKAERLKEADPDAYRHIYLGQPLSSDDASVIKFHWIEAAVDAHLKLG 251

Query: 312 DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS 349
            +L     +G D+A  G DK       G I + + +W+
Sbjct: 252 IELGGARTVGYDVADSGADKNACSVFDGAICDELDEWA 289


>gi|284008456|emb|CBA74928.1| phage terminase large subunit [Arsenophonus nasoniae]
          Length = 477

 Score = 96.2 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/288 (11%), Positives = 77/288 (26%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      +++++ A +   +  L  ++ F +
Sbjct: 21  GGRGGMKTVSFAKIALITASINK-RRFLCLREFMNSIEDSVHAVLQAEIETLRLQNRFRI 79

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
               +                 +       +        +    H       + +EA   
Sbjct: 80  LDNCI--------------KGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 121

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDW------------KRY 251
            +     ++    +      W    N    +G  Y  F  P +D                
Sbjct: 122 SEKSLDILIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKDIIDDKGYYEDDDLYVG 179

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       +              +         G+      +  I   +++ A+     
Sbjct: 180 KVSYLDNPWLPEELKNDAEKMKRDNYKKWLHVYGGECDANYDDAIIQPEWVDAAIDAHIK 239

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G ++E    WS   + +  
Sbjct: 240 LGFKPKGIRVITFDPADSGQDEKALSKRYGVLVEDCVSWSEGDVADAT 287


>gi|82702592|ref|YP_412158.1| Phage terminase, large subunit, PBSX [Nitrosospira multiformis ATCC
           25196]
 gi|82410657|gb|ABB74766.1| Phage terminase, large subunit, PBSX [Nitrosospira multiformis ATCC
           25196]
          Length = 417

 Score = 95.8 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/293 (12%), Positives = 76/293 (25%), Gaps = 30/293 (10%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
                       P  +K     GRG  K+   A  +L   +  P + I+C+   +  +  
Sbjct: 6   AEFPIKLRFLFEPARYKILY-GGRGGAKSWGVARALLIQAAATP-LRILCVREFQNSIVE 63

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
           ++   +   +  +    ++E+ +  +                 +    I          +
Sbjct: 64  SVHHLLKAQIEAIGLNSFYEVHNNVI--------------RGINGSEFIFA----GLHSN 105

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
                       V+ +EA         +++    +     +  +T N        +  F 
Sbjct: 106 VTRIKSFEGVDRVWVEEAQTVSKTSWDTLIPTIRKEGSEIW--VTYNPELNTDETHQRFV 163

Query: 243 -IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
             P       +I+                     D D  +    G               
Sbjct: 164 VNPPAGAVVVKINWNDNPWFPEILRREKDGLKARDPDAYQNVWEGNCRVTLEGAVYAKEL 223

Query: 302 I---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR--GNIIEHIFDWS 349
               EE   R    D   P+    D+     D T + F +  GN +  I  +S
Sbjct: 224 RLAQEEGRIRSVPYDEAKPVHTFFDLGW--ADNTSIWFAQTVGNELRLIDYYS 274


>gi|126011061|ref|YP_001039811.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
 gi|119712637|gb|ABL96858.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
          Length = 459

 Score = 95.8 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 44/296 (14%), Positives = 85/296 (28%), Gaps = 29/296 (9%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
           A+  GR   K+   A   +  ++    +  +C    + ++  +++  +   +        
Sbjct: 20  ALYGGRASSKSHDAAGFAV-YLARNYTVKFLCARQFQNKISESVYTLIKGKIDAAGWTKE 78

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
           F++   S+      AE                   +     +            ++ +EA
Sbjct: 79  FDVTISSIRHKKTGAE-----------------FLFYGIARNLNEIKSTEGVDILWLEEA 121

Query: 201 SGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVE 259
               +     I            W++  N  +   + Y  F   P  D    QI+     
Sbjct: 122 QYLTEEQWNVINPTIRREGSQ-IWLIW-NPDQYTDFIYQNFVVNPPADCLSKQINWTENP 179

Query: 260 GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAP 317
            +     + I   Y  D  +A     G          I   Y+  A+         +   
Sbjct: 180 FLSDTMLKVIYDEYQRDPKLAEHVYGGAPKMGGDKAIIQLQYVLAAIDAHKKLGWKIEGS 239

Query: 318 LIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA------KLIQETNQEGCPVGSSI 367
              G DIA +G D   +V   GN++    +W        K   +        GSSI
Sbjct: 240 KRTGFDIADDGDDANAIVDAIGNVVVWAEEWDGLEDELLKSSTKVFNHALEKGSSI 295


>gi|257455568|ref|ZP_05620798.1| phage terminase, large subunit, pbsx family [Enhydrobacter
           aerosaccus SK60]
 gi|257447034|gb|EEV22047.1| phage terminase, large subunit, pbsx family [Enhydrobacter
           aerosaccus SK60]
          Length = 428

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/284 (15%), Positives = 78/284 (27%), Gaps = 33/284 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  +L +I T     I+C    +  +K ++   +S  ++ +        
Sbjct: 28  GGRGGGKSWEIADFLL-IIGTTAKHRILCCREVQKSIKQSVHKLLSDRIAAMGL------ 80

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
                   G + E+LE  +   +                             + +EA   
Sbjct: 81  --------GGFYEILETEIRGRNGTEFSFAGLL---GHTVDSIKSFEGATITWIEEAQTV 129

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRYQIDTRTVEGID 262
                  ++       PN   IM+ N R      Y  +  +  +D    Q++        
Sbjct: 130 SAFSLGILIPTVI-RTPNPMVIMSLNPRLPQDAVYAQYIAVERDDTAVVQVNYTDNPHCP 188

Query: 263 SGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLI 319
                        D D      LG+  +          +    +         D   P+ 
Sbjct: 189 PELIRLAEQMRDEDFDNYEHIYLGRPKEIADGAIYKAEFEAIRKSNRICNVPHDPNLPVY 248

Query: 320 MGCDIAGEGGDKTVVVFRR--GNIIEHIFDWSAKLIQETNQEGC 361
              D+     D T + F +  G  +  I         E N E  
Sbjct: 249 TSWDLGIL--DPTAIWFFQIYGKEVRVI------DYYEANNEPL 284


>gi|18466735|ref|NP_569542.1| hypothetical protein HCM2.0070c [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16506051|emb|CAD09937.1| hypothetical protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
          Length = 418

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 76/273 (27%), Gaps = 37/273 (13%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMQVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L     R   +     +                            + 
Sbjct: 66  MARQILWDDLQEVLPRKWVRKKNDTTMTIV---------------------LKNGSEIAL 104

Query: 179 ERPDTFVGPHNTHGMAVFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  D            V  DE     PD   K +    +        ++     +    F
Sbjct: 105 KGADKPDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTP-KGFSEF 161

Query: 238 YDIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
           + ++ I           WK +Q  T     + S   E   +    D      E L  F  
Sbjct: 162 HKLWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDM--DPKSFAQEYLASFEN 219

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
                + P +       +    +   P+ +G D
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPKLPIWVGQD 250


>gi|16082806|ref|NP_395360.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|31795361|ref|NP_857813.1| hypothetical protein Y1030 [Yersinia pestis KIM]
 gi|40787951|ref|NP_857660.2| hypothetical protein YPKMT021 [Yersinia pestis KIM]
 gi|45478613|ref|NP_995469.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52788073|ref|YP_093901.1| hypothetical protein pG8786_021 [Yersinia pestis]
 gi|108793557|ref|YP_636707.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|108793757|ref|YP_636595.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|145597216|ref|YP_001154679.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|149192775|ref|YP_001294006.1| hypothetical protein YPE_4292 [Yersinia pestis CA88-4125]
 gi|162417876|ref|YP_001604588.1| hypothetical protein YpAngola_0076 [Yersinia pestis Angola]
 gi|165939469|ref|ZP_02228016.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166214433|ref|ZP_02240468.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402343|ref|ZP_02307808.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422791|ref|ZP_02314544.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167466683|ref|ZP_02331387.1| hypothetical protein YpesF_02065 [Yersinia pestis FV-1]
 gi|229896952|ref|ZP_04512111.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|229897756|ref|ZP_04512911.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900293|ref|ZP_04515428.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904817|ref|ZP_04519927.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|270491004|ref|ZP_06208077.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294502015|ref|YP_003565752.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|3883031|gb|AAC82691.1| unknown [Yersinia pestis KIM 10]
 gi|5834709|emb|CAB55206.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|45357266|gb|AAS58660.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52538002|emb|CAG27427.1| hypothetical protein [Yersinia pestis]
 gi|108777821|gb|ABG20339.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|108782104|gb|ABG16161.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|145212984|gb|ABP42389.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|148872433|gb|ABR14922.1| hypothetical protein YPMT1.24c [Yersinia pestis CA88-4125]
 gi|162350848|gb|ABX84797.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165912657|gb|EDR31287.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166204381|gb|EDR48861.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958284|gb|EDR55305.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167048235|gb|EDR59643.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|229678132|gb|EEO74238.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|229686652|gb|EEO78733.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229693337|gb|EEO83387.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229699988|gb|EEO88028.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|262363909|gb|ACY60628.1| hypothetical protein YPD4_pMT0023 [Yersinia pestis D106004]
 gi|262364065|gb|ACY64401.1| hypothetical protein YPD8_pMT0023 [Yersinia pestis D182038]
 gi|270334985|gb|EFA45763.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294352486|gb|ADE66542.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|320017547|gb|ADW01117.1| hypothetical protein YPC_4788 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 418

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 76/273 (27%), Gaps = 37/273 (13%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMQVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L     R   +     +                            + 
Sbjct: 66  MARQILWDDLQEVLPRKWVRKKNDTTMTIV---------------------LKNGSEIAL 104

Query: 179 ERPDTFVGPHNTHGMAVFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  D            V  DE     PD   K +    +        ++     +    F
Sbjct: 105 KGADKPDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTP-KGFSEF 161

Query: 238 YDIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
           + ++ I           WK +Q  T     + S   E   +    D      E L  F  
Sbjct: 162 HKLWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDM--DPKSFAQEYLASFEN 219

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
                + P +       +    +   P+ +G D
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPKLPIWVGQD 250


>gi|293396491|ref|ZP_06640767.1| phage terminase large subunit [Serratia odorifera DSM 4582]
 gi|291420755|gb|EFE94008.1| phage terminase large subunit [Serratia odorifera DSM 4582]
          Length = 430

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 85/265 (32%), Gaps = 24/265 (9%)

Query: 101 LISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQ 160
            +S +  +  +C    + +++ +++A +   +     RH F +    +            
Sbjct: 4   FLSDKYRLRFLCTRQIQNKIEESVYALLKIQIERFGLRHRFRILDNKIINRF-------- 55

Query: 161 SMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
                +    +    +                  ++N+EA    +   + +     +   
Sbjct: 56  -----TGSEFMFYGLWR----HVDEIKSLESIDVLWNEEAHAMTEAQWEVLEPTIRKEGS 106

Query: 221 NRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDV 279
              W +  N R    + +  F + P  D    +I+      +       I +    D+++
Sbjct: 107 E-CWFLF-NPRLTTDFVWRNFVVAPPPDTLVRKINYDENPFLSRTIMNVIEAAKARDAEM 164

Query: 280 ARIEILGQFPQQEVNNFIPHNYIEEAMSRE--AIDDLYAPLIMGCDIAGEGGDKTVVVFR 337
                LG     +    I  ++IE A+        +      +G D+A  G DK   V+ 
Sbjct: 165 FEHVYLGMPRTDDDEAIIKLSWIEAAVDAHKALNIEPAGHRRVGFDVADSGADKCANVYA 224

Query: 338 RGNIIEHIFDWSA--KLIQETNQEG 360
            G++     +W A    + ++ +  
Sbjct: 225 HGSVALWADEWKAREDELMKSCKRT 249


>gi|239590013|ref|YP_002941860.1| gp2 [Mycobacterium phage Angel]
 gi|238890545|gb|ACR77534.1| gp2 [Mycobacterium phage Angel]
          Length = 478

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/334 (12%), Positives = 82/334 (24%), Gaps = 64/334 (19%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            RWQ      +     + +  ++ ++    IS  R +GKT L   ++  L    PG+++I
Sbjct: 39  DRWQDGLGRLILALDGTGLYAADTSV----ISIPRQVGKTYLIGCIVFALALLTPGLTVI 94

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+     K T  +  +   + L + H                         D   Y  
Sbjct: 95  WTAHRTKTAKETFGSMKAMCATPLVNAH----------------VRNVSDARGDEGIYLH 138

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                     +   G        +  DEA    D     ++     +      ++T    
Sbjct: 139 NGSRILFGARENGFGLGFAGVGILVLDEAQRLTDKAMDDLIPTMNTVENPLI-LLTGTPP 197

Query: 232 RLNG------------------------WFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHE 267
           R                           +  D    P +  +  + +             
Sbjct: 198 RPTDSGEVFTMLRQDALDGESEGTLYVEFSADEGAHPDDRAQLRKANPSYPHRTSERAIR 257

Query: 268 GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE 327
            +      +S     E  G +     +  +    +  A  R       A    G    G 
Sbjct: 258 RMRKNLTEES--FLREAFGIW-----DKVVHRPVVTAARWRRLESTGPA---AGVKPNGF 307

Query: 328 GGDKT--------VVVFRRGNIIEHIFDWSAKLI 353
           G D +         V    G+       W+    
Sbjct: 308 GVDMSHSRMVSVNAVWL-DGDQAHTEEVWAGDDT 340


>gi|109392289|ref|YP_655519.1| gp2 [Mycobacterium phage Halo]
 gi|189043089|ref|YP_001936030.1| hypothetical protein BPs1_2 [Mycobacterium phage BPs]
 gi|91980539|gb|ABE67259.1| terminase [Mycobacterium phage Halo]
 gi|171909204|gb|ACB58161.1| hypothetical protein BPs1_2 [Mycobacterium phage BPs]
 gi|255927846|gb|ACU41466.1| gp2 [Mycobacterium phage Hope]
          Length = 478

 Score = 95.8 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/334 (12%), Positives = 82/334 (24%), Gaps = 64/334 (19%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            RWQ      +     + +  ++ ++    IS  R +GKT L   ++  L    PG+++I
Sbjct: 39  DRWQDGLGRLILALDGTGLYAADTSV----ISIPRQVGKTYLIGCIVFALALLTPGLTVI 94

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+     K T  +  +   + L + H                         D   Y  
Sbjct: 95  WTAHRTKTAKETFGSMKAMCATPLVNAH----------------VRNVSDARGDEGIYLH 138

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                     +   G        +  DEA    D     ++     +      ++T    
Sbjct: 139 NGSRILFGARENGFGLGFAGVGILVLDEAQRLTDKAMDDLIPTMNTVENPLI-LLTGTPP 197

Query: 232 RLNG------------------------WFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHE 267
           R                           +  D    P +  +  + +             
Sbjct: 198 RPTDSGEVFTMLRQDALDGESEGTLYVEFSADEGAHPDDRAQLRKANPSYPHRTSERAIR 257

Query: 268 GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE 327
            +      +S     E  G +     +  +    +  A  R       A    G    G 
Sbjct: 258 RMRKNLTEES--FLREAFGIW-----DKVVHRPVVTAARWRRLESTGPA---AGVKPNGF 307

Query: 328 GGDKT--------VVVFRRGNIIEHIFDWSAKLI 353
           G D +         V    G+       W+    
Sbjct: 308 GVDMSHSRMVSVNAVWL-DGDQAHTEEVWAGDDT 340


>gi|99080898|ref|YP_613052.1| hypothetical protein TM1040_1057 [Ruegeria sp. TM1040]
 gi|99037178|gb|ABF63790.1| DNA packaging protein Gp17 (Terminase) [Ruegeria sp. TM1040]
          Length = 425

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 77/296 (26%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q+++ +    S  L+ 
Sbjct: 32  VILGGRGAGKTRAGAEWVRSQVEGAGPFGVGSARRVALVGETYDQVRDVMIHGDSGILAC 91

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                             +                  A
Sbjct: 92  SPPDRRPEWRAGERRL------------------LWPNGASAQAFSASDPEVLRGPQFDA 133

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          R  +    T R       +   P      + 
Sbjct: 134 AWVDELAKWRRAQEAWDMLQFALRLGTAPRVCVT--TTPRNVPLLKGLLQSPST-VTTHA 190

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RY   S +AR E+ G             + + E   R+   
Sbjct: 191 PTEANSANLAPSFLSEVRARYAG-SRLARQELDGVLLADVDGALWSSDMLAEIQRRDTP- 248

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC-PVG 364
                +++  D    A +G D   ++         I  W A ++ +   +G  P G
Sbjct: 249 -RLDRIVVAVDPSVSAHKGSDACGIIVAGAQTQGPISSWRAYVLADHTVQGLGPTG 303


>gi|213161040|ref|ZP_03346750.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
          Length = 421

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/253 (13%), Positives = 83/253 (32%), Gaps = 22/253 (8%)

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQS 161
           ++ +  +   C    + +++ +++  +   +     RH F + +  +             
Sbjct: 1   MANKYSLRFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRILNNKIINRV--------- 51

Query: 162 MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPN 221
               +    +    +     +            ++ +EA    +   K +     +    
Sbjct: 52  ----TGSEFVFYGLWR----NIEEIKSLEGIDVLWLEEAHALTEYQWKILEPTIRKEGSE 103

Query: 222 RFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
            ++I   N   +  + +  F   P ED    +I+      +     + I +    D +  
Sbjct: 104 CWFIF--NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGF 161

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRR 338
                G     +    I  ++IE A+    + D        +G D+A  G DK   V+R 
Sbjct: 162 VHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRY 221

Query: 339 GNIIEHIFDWSAK 351
           G++I    +W AK
Sbjct: 222 GSVIYWADEWKAK 234


>gi|158425199|ref|YP_001526491.1| phage-related DNA maturase [Azorhizobium caulinodans ORS 571]
 gi|158332088|dbj|BAF89573.1| phage-related DNA maturase [Azorhizobium caulinodans ORS 571]
          Length = 569

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/377 (12%), Positives = 89/377 (23%), Gaps = 85/377 (22%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               F+NF+     W   G P      P   Q      + V+             +  I 
Sbjct: 20  LKADFRNFLYVV--WKHLGLP-----DPTPIQ----YDIAVYLQHGPK-------RSIIE 61

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RG+GK+ + +  + WL+   P   I+ ++ S+ +  +     +     M   +H    
Sbjct: 62  AFRGVGKSWVTSAFVCWLLYCNPDHKILVVSASKIRADDFTTFTLRLIKEMPVLQHLIPK 121

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHGM 193
                    +     + S     K   IT +              E P+          +
Sbjct: 122 PDQRESKVAFDVGPAKASHSPSVKSVGITGQLAGSRADTIIADDVEIPNNSQTQAMRDKL 181

Query: 194 AVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
           +    E                P                 R W             Y   
Sbjct: 182 SELVKEFDAILKPGGRIIYLGTPQTEQSLYNELPNRGYQVRIWPARI-PDEKQRAIYGER 240

Query: 242 NIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------QFP 289
             P       + WK     +   +           + YG      +  +        ++P
Sbjct: 241 LAPYIDDLIAKGWKA--GASTDPKRFSEEDLWEREASYGRAGFSLQFMLDTRLSDADRYP 298

Query: 290 QQEVNNF------------------------------IPHNYIEEAMSREAIDDLYAPLI 319
            +  +                                   + +   M  +     Y   +
Sbjct: 299 LKLSDLIVMSLNPTLAPLKVVWASSPELAHNELPNVGFAGDRLYRPMWVDKDWTEYTGSV 358

Query: 320 MGCDIAGEGGDKTVVVF 336
           M  D +G GGD+T    
Sbjct: 359 MAIDPSGRGGDETGFAV 375


>gi|323175059|gb|EFZ60673.1| phage terminase large subunit [Escherichia coli LT-68]
          Length = 399

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 69/215 (32%), Gaps = 9/215 (4%)

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
             ++Q         +  L  + +   +    +    +     +            ++ +E
Sbjct: 4   LLKIQIDRFGLRHRFRILNNKIINRVTGSEFVFYGLWR----NIEEIKSLEGIDVLWLEE 59

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTV 258
           A    +   K +     +     ++I   N   +  + +  F   P E     +I+    
Sbjct: 60  AHALTEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRKINYDEN 117

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DLYA 316
             +     + I +    D D  +    G     +    I  ++IE A+        +   
Sbjct: 118 PFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSG 177

Query: 317 PLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
              +G D+A  G DK   V+R G+++    +W AK
Sbjct: 178 RKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAK 212


>gi|163746673|ref|ZP_02154030.1| hypothetical protein OIHEL45_14759 [Oceanibulbus indolifex HEL-45]
 gi|161379787|gb|EDQ04199.1| hypothetical protein OIHEL45_14759 [Oceanibulbus indolifex HEL-45]
          Length = 414

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/309 (12%), Positives = 80/309 (25%), Gaps = 32/309 (10%)

Query: 62  VDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIA 114
           +      N        ++  +   GRG GKT   A  +   +             +  + 
Sbjct: 1   MFEFWALNHQLPPEGDWRTWVIMGGRGAGKTRAGAEWVRSKVEGSRPLDPGECSRVALVG 60

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
            +  Q++  +    S  L+  P     + ++                             
Sbjct: 61  ETIEQVREVMIFGDSGILACSPPDRRPDWEATRKRL------------------VWPNGA 102

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
             +        G       A + DE +             F      R  +  + T R  
Sbjct: 103 IATVHTAHDPEGLRGPQFDAAWVDELAKWKRGQEAWDQLQFALRLGERPQVCVTTTPRNV 162

Query: 235 GWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
                +   P      +         +   F E + +RY     + R E+ G        
Sbjct: 163 DVLKALLQSPST-VTTHAPTEANAANLAGSFLEEVRARYRGT-RLGRQELDGVLLADAEG 220

Query: 295 NFIPHNYIEEAMSREAIDDLYAPLIMGCDIA---GEGGDKTVVVFRRGNIIEHIFDWSAK 351
                  +E    R  +      +++G D A   G G D+  +V           +W A 
Sbjct: 221 ALWTSALLEAG--RVQVAPELDRIVVGLDPATTSGAGSDECGIVVVGAQTQGPPQEWRAV 278

Query: 352 LIQETNQEG 360
           ++ +   +G
Sbjct: 279 VLADCTVQG 287


>gi|269941618|emb|CBI50024.1| phage protein [Staphylococcus aureus subsp. aureus TW20]
          Length = 599

 Score = 95.0 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 60/414 (14%), Positives = 109/414 (26%), Gaps = 106/414 (25%)

Query: 4   LISTDQKLEQELHEM-LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAV 62
             +T  + EQ +  + +  +    +   FV+ F                  +Q   + A+
Sbjct: 24  KRNTKSRSEQTMENIAVWISFYRENPHRFVLDFMN-----------INLRPFQCVLLWAM 72

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
             H           +F     A RG+GKT L+A   L      PG  II  A +++Q  N
Sbjct: 73  IHH--------QYFMF----LASRGLGKTFLSAVYCLTRCILYPGTKIIITAPTKSQGIN 120

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            L    ++ LS L HR    + + +  P   +           +  +             
Sbjct: 121 VLEKIENELLSPLIHREIESINTGNQKPMIAFH----------NGSWIRVVA-------- 162

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINK-SILGFFTELNPNRFW--IMTSNTRRLNG---- 235
           +           +  DE     + +         T      F       N  R       
Sbjct: 163 SNDNARGHRANLLLVDEFVKVDEDLIDTVFKKMLTSQREPAFLHKAKYKNYPREENTQMY 222

Query: 236 ---------WFYDIFNIPLED-----------------------------WKRYQIDTRT 257
                    W YD      +                               K+ + + + 
Sbjct: 223 LSSAWMKSHWAYDSMRSFTKQMLKKKSEDDLKSFVCHIPYYTGVMEKLYSHKQMKAEAQA 282

Query: 258 VEGIDSGFHEGIISR-YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
                  F   + +  +G             F ++    F P   + +A     I +   
Sbjct: 283 EGFNKMKFAMEMEAVWWGETESAFFNFNTIDFNRKLSQAFYPKEVLVQADINNPIKEPKE 342

Query: 317 PLIMGCDIAGEGG---DKTVV------------VFRRGNIIEHIFDWSAKLIQE 355
             ++  D+A  GG   D +V               R+ N +E +        Q 
Sbjct: 343 KRLLAVDVARMGGNSNDASVFSLIRLLPKGKQQYERQLNYMEDME---GIDFQT 393


>gi|240851102|ref|YP_002972504.1| phage terminase large subunit [Bartonella grahamii as4aup]
 gi|240268225|gb|ACS51813.1| phage terminase large subunit [Bartonella grahamii as4aup]
          Length = 453

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/291 (12%), Positives = 72/291 (24%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M   +            I+C    +  L  +   E+ + +   P   
Sbjct: 39  GGRGSGKTRSFALMSAVVGYRHGMAGERGIILCARQFQNSLNESSLEEIKRAIESYP--- 95

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        +Y    +     D +   +          +             + DE
Sbjct: 96  ---------FLQDYYDIGDKYIKSKDGRIVYVFAGLDR----NIASIKSMGRVFLCWVDE 142

Query: 200 ASGTPDIINKSILGFFTELNPN---RFWIMTSNTRRLNGWFYDIFNIPLEDW-KRYQIDT 255
           A    +   ++++    E   +     W+   N    N      F        K  +I+ 
Sbjct: 143 AEPVTETAWQTLIPTLREEGKDWNAELWVTW-NPCYENAPVEKRFRNVDNPHIKGAEINW 201

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE---AMSREAID 312
           R         +   +       +       G++ Q     +     +E            
Sbjct: 202 RDNPQFPEKLNRDRMDDLQQRPEQYNHIWEGEYLQAVQGAYYQKCLLEAEMEGRITTVPR 261

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
           D    + +  DI G G   D T +   +        +       E   +  
Sbjct: 262 DPLMQVRIFWDIGGTGAKADATALWVAQ----FIGREIRVLDYYEAQGQPL 308


>gi|83954308|ref|ZP_00963028.1| terminase, large subunit, putative [Sulfitobacter sp. NAS-14.1]
 gi|83841345|gb|EAP80515.1| terminase, large subunit, putative [Sulfitobacter sp. NAS-14.1]
          Length = 408

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/296 (14%), Positives = 80/296 (27%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q++  +    S  L+ 
Sbjct: 15  VIMGGRGAGKTRAGAEWVRAQVEGSRPLDAGRCRRVALVGETIEQVREVMIFGDSGILAC 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                               +        G       A
Sbjct: 75  SPADRRPDWEATRKRL------------------VWPNGAVATVHTAHDPEGLRGPQFDA 116

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +          R  +    T R  G   ++   P      + 
Sbjct: 117 AWVDELAKWKKAEETWDQLQFALRLGEDPRACVT--TTPRNVGVLKNLLASPST-VTTHA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G               IE    R+   
Sbjct: 174 PTEANAANLAGSFLEEVRARYRGT-RLGRQELDGVLLADAEGALWTSERIEAGRVRDVPL 232

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG-CPVG 364
                +++G D    AG G D+  +V           DW A ++ +   +G  P G
Sbjct: 233 --LDRIVVGLDPATTAGAGADECGIVVVGAQTQGPPQDWRAVVLADCTVQGATPSG 286


>gi|160897385|ref|YP_001562967.1| PBSX family phage terminase large subunit [Delftia acidovorans
           SPH-1]
 gi|160362969|gb|ABX34582.1| phage terminase, large subunit, PBSX family [Delftia acidovorans
           SPH-1]
          Length = 433

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/294 (11%), Positives = 71/294 (24%), Gaps = 34/294 (11%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSI----ICIANSETQLKNTLWAEVSKWLSMLP 136
           A   GRG GKT   A M            +    +C       L+++   E  + +   P
Sbjct: 24  ACDGGRGSGKTRSFAKMAAVKGYQYGKAGVTGILLCARQFMNSLEDSSLEECKRAIEDEP 83

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                         + +Y    +     D +                  G      +  +
Sbjct: 84  ------------WLAAYYDVGDKYIKSRDGRITFAFAGLDRNIASIKSKG----RLLLCW 127

Query: 197 NDEASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQ 252
            DEA    D    +++    E         W+   N +R +      F    +   K  +
Sbjct: 128 VDEAEPVTDEAWTTLIPTLREEGTDWNAELWVTW-NPKRKSAPVEKRFKGSSDPRMKYVR 186

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
            + +      +      +       +       G +       +   + ++         
Sbjct: 187 CNWKDNPKFPALLERVRLRDLAERPEQYAHIWEGDYATVIEGAYFASHIVKARQDNRIGR 246

Query: 313 DLYAPLI---MGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
               PL+      DI G G   D   +   +        +       E   +  
Sbjct: 247 VPADPLMTLRAFVDIGGTGARADAFAMWIAQ----FVGKEIRVLDYYEQVGQPL 296


>gi|213029404|ref|ZP_03343851.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 282

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/246 (14%), Positives = 79/246 (32%), Gaps = 22/246 (8%)

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
              C    + +++ +++  +   +     RH F + +  +                 +  
Sbjct: 7   RFCCARQIQNKIEESVYTLLKIQIDRFGLRHRFRILNNKIINRV-------------TGS 53

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
             +    +     +            ++ +EA    +   K +     +     ++I   
Sbjct: 54  EFVFYGLWR----NIEEIKSLEGIDVLWLEEAHALTEYQWKILEPTIRKEGSECWFIF-- 107

Query: 229 NTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           N   +  + +  F   P ED    +I+      +     + I +    D +       G 
Sbjct: 108 NPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGV 167

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHI 345
               +    I  ++IE A+    + D        +G D+A  G DK   V+R G++I   
Sbjct: 168 PESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWA 227

Query: 346 FDWSAK 351
            +W AK
Sbjct: 228 DEWKAK 233


>gi|57867562|ref|YP_189190.1| prophage, terminase, ATPase subunit [Staphylococcus epidermidis
           RP62A]
 gi|57638220|gb|AAW55008.1| prophage, terminase, ATPase subunit, putative [Staphylococcus
           epidermidis RP62A phage SP-beta]
          Length = 599

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 60/414 (14%), Positives = 108/414 (26%), Gaps = 106/414 (25%)

Query: 4   LISTDQKLEQELHEM-LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAV 62
             +T  + EQ +  + +  +    +   FV+ F                  +Q   + A+
Sbjct: 24  KRNTKSRSEQTMENIAVWISFYRENPHRFVLDFMN-----------INLRPFQCVLLWAM 72

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
             H           +F     A RG+GKT L+A   L      PG  II  A +++Q  N
Sbjct: 73  IHH--------QYFMF----LASRGLGKTFLSAVYCLTRCILYPGTKIIITAPTKSQGIN 120

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            L    ++ LS L HR    + + +  P   +           +  +             
Sbjct: 121 VLEKIENELLSPLIHREIESINTGNQKPMIAFH----------NGSWIRVVA-------- 162

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINK-SILGFFTELNPNRFW--IMTSNTRRLNG---- 235
           +           +  DE     + +         T      F       N  R       
Sbjct: 163 SNDNARGHRANLLLVDEFVKVDEDLIDTVFKKMLTSQREPAFLHKAKYKNYPREENTQMY 222

Query: 236 ---------WFYDIFNIPLED-----------------------------WKRYQIDTRT 257
                    W YD                                      K+ + + + 
Sbjct: 223 LSSAWMKSHWAYDSMRSFTRQMLKKKSEDDLKSFVCHIPYYTGVMEKLYSHKQMKAEAQA 282

Query: 258 VEGIDSGFHEGIISR-YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
                  F   + +  +G             F ++    F P   + +A     I +   
Sbjct: 283 EGFNKMKFAMEMEAVWWGETESAFFNFNTIDFNRKLSQAFYPKEVLVQADINNPIKEPKE 342

Query: 317 PLIMGCDIAGEGG---DKTVV------------VFRRGNIIEHIFDWSAKLIQE 355
             ++  D+A  GG   D +V               R+ N +E +        Q 
Sbjct: 343 KRLLAVDVARMGGNSNDASVFSLIRLLPKGKQQYERQLNYMEDME---GIDFQT 393


>gi|211731785|gb|ACJ10115.1| terminase [Bacteriophage APSE-7]
          Length = 469

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/288 (12%), Positives = 78/288 (27%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   +       +C+      +++++ A +   +  L     F +
Sbjct: 12  GGRGGMKTVSFAKIALITAAMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLHARFRV 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +       +        +    H       + +EA   
Sbjct: 71  LNSCI--------------EGINASIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      W    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDTLISTIRKPGSE-LWFSF-NPSEEDGAVYQRFVKPYKAIIDKKGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
            +       + +            +    R    G+      +  I   +++ A+     
Sbjct: 171 NVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYDDALIQPEWVDAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFPPRGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|319408093|emb|CBI81746.1| phage related protein [Bartonella schoenbuchensis R1]
 gi|319408856|emb|CBI82513.1| phage related protein [Bartonella schoenbuchensis R1]
          Length = 444

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/291 (12%), Positives = 70/291 (24%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMML----WLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M                I+C    +  L  +   E+ + +       
Sbjct: 30  GGRGSGKTRSFALMAALKGYEYGMGGISGIILCARQFQNSLAESSLQEIKRAIE------ 83

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        +Y          D +        +S    +          +  + DE
Sbjct: 84  ------TYDFLKDYYCVGESSIKSKDGR----ISFQFSGLDRNIASIKSMGRILLCWVDE 133

Query: 200 ASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED-WKRYQIDT 255
           A    +   ++++    E         W+   N  R N      F    +   K  +++ 
Sbjct: 134 AEPVTETAWQTLIPTLREEGEGWRAELWVTW-NPLRENAPVERRFRFTKDQNIKGVEVNW 192

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAID 312
                         +       +       G + +     +     +   +E        
Sbjct: 193 SDNPLFPQKLQRVRLDDLQNRPESYNHIWEGDYLKAVQGAYFQKEMLAAEQEGRVGRVAR 252

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
           D   P+    DI G G   D T +   +        +       E   +  
Sbjct: 253 DPLMPIRAFWDIGGTGAKADATAIWIAQ----FVGREIRVLDYYEAQGQPL 299


>gi|310722310|ref|YP_003969134.1| terminase subunit [Aeromonas phage phiAS4]
 gi|306021153|gb|ADM79688.1| terminase subunit [Aeromonas phage phiAS4]
          Length = 612

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/376 (12%), Positives = 94/376 (25%), Gaps = 76/376 (20%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ L E      C      F   +         +        +Q + + 
Sbjct: 83  LKRANIKIKWTKEMLAERK---RCKEDIVYFAENYCCIEHIDYGIIRVQ-LRDYQKDMLR 138

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +     N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 139 IMAGNRLMAANLS------------RQLGKTTVVAIFLAHFVCFNSAKNVGILAHKASMS 186

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + L +LP                   E  + S+ + +        +     
Sbjct: 187 AEVLHR-TKQALELLPD-----------FLQPGIVEWNKGSITLGNGCAIGAFSS----- 229

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P  +    +I    +        I+ + T      +Y
Sbjct: 230 --SPDAVRGNSFALIYIDEVAFIPNFNDAWLAIQPVISSG--RHSKILMTTTPNGLNHWY 285

Query: 239 DIFNIP----------LEDWKRYQIDTRTV---------------EGIDSGFHEGIISRY 273
           DI+                +  Y     +V                  D G+     +  
Sbjct: 286 DIWTAAITPNSDGSGSKSGFVPYTATWSSVKERMYSDGSKTDGSDSYFDDGYSWSAKTIA 345

Query: 274 GLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----------IDDLYAPLIMGCD 323
           G   +  + E    F Q      I    + +   +E                   I   D
Sbjct: 346 GSSLEAFQQEHNTAF-QGTSGTLINGFKLSKMTWKEVPASDNFTMFKEPIEGHKYIATLD 404

Query: 324 IA-GEGGDKTVVVFRR 338
            A G G D   +    
Sbjct: 405 SAEGRGQDYHAMHIYD 420


>gi|152982949|ref|YP_001353896.1| hypothetical protein mma_2206 [Janthinobacterium sp. Marseille]
 gi|151283026|gb|ABR91436.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 436

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 74/278 (26%), Gaps = 37/278 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRP--GMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
            + A R  GKT      ++    T          +A    Q K+  W  V ++ +++P  
Sbjct: 28  VVVAHRRAGKTVACVNELIKAALTFHGNDGRFAYVAPFYRQAKSVAWDYVKRFSAVIP-- 85

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
                             + E  + ID                D            V  D
Sbjct: 86  ---------------GISINESELRID----YPNGSRIQLFGADNADALRGLFFDGVVAD 126

Query: 199 EASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDT 255
           E       +    I     +      W +   T +    F++I+      EDW    I  
Sbjct: 127 EYGDWKPSVWGYVIRPALADRGG---WAVIIGTPKGRNQFWEIYQHAGVNEDWLCLTIRA 183

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
                +     E +      D    R E+   F              +        DDLY
Sbjct: 184 SESGLLPPKEIEALQLELTED--AWRQEMECDFDAALPGAIFGKEIWQAEQDGRVKDDLY 241

Query: 316 AP---LIMGCDIAGEGGDKTVVVFRR-GNIIEHIFDWS 349
            P   +    D+     D T + + + G  +  I  +S
Sbjct: 242 DPELKVHAVLDLGFT--DDTAIWWFQVGKELRIIDCYS 277


>gi|163868971|ref|YP_001610200.1| hypothetical protein Btr_1983 [Bartonella tribocorum CIP 105476]
 gi|161018647|emb|CAK02205.1| phage-related protein [Bartonella tribocorum CIP 105476]
          Length = 453

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/291 (13%), Positives = 72/291 (24%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M   +            I+C    +  L  +   E+ + +   P   
Sbjct: 39  GGRGSGKTRSFALMSAVVGYRHGMAGERGIILCARQFQNSLNESSLEEIKRAIEAYP--- 95

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        +Y    +     D +   +          +             + DE
Sbjct: 96  ---------FLQDYYEIGDKYIKSKDGRIAYVFAGLDR----NIASIKSMGRVFLCWVDE 142

Query: 200 ASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLE-DWKRYQIDT 255
           A    +   ++++    E         W+   N    N      F      + K  +I+ 
Sbjct: 143 AEPVTETAWQTLIPTLREEGDDWNAELWVTW-NPYHENAPVEKRFRNVDNPNIKGVEINW 201

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEE---AMSREAID 312
           R         +   +S      +       G + Q     +     +E            
Sbjct: 202 RDNPKFPEKLNRDRLSDLQQRPEQYNHIWEGGYLQAVQGAYYQKCLLEAEMEGRITTVPR 261

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
           D    + +  DI G G   D T +   +        +       E   +  
Sbjct: 262 DPLMQVRIFWDIGGTGAKADATALWVAQ----FVGREIRVLDYYEAQGQPL 308


>gi|254485756|ref|ZP_05098961.1| phage DNA Packaging Protein [Roseobacter sp. GAI101]
 gi|214042625|gb|EEB83263.1| phage DNA Packaging Protein [Roseobacter sp. GAI101]
          Length = 452

 Score = 93.9 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/296 (14%), Positives = 79/296 (26%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +  ++             +  +  +  Q++  +    S  L+ 
Sbjct: 59  VIMGGRGAGKTRAGAEWVRSMVEGARPLDAGRCRRVALVGETIEQVREVMIFGDSGILAC 118

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                               S        G       A
Sbjct: 119 SPADRRPDWEATRKRL------------------VWPNGAVASVHTAHDPEGLRGPQFDA 160

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +          R  +    T R       +   P      + 
Sbjct: 161 AWVDELAKWKKAEETWDQLQFALRLGEDPRVCVT--TTPRNVDVLKKLLASPST-VTTHA 217

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G               +E    R    
Sbjct: 218 PTEANAANLAGSFLEEVRARYRGT-RLGRQELDGVLLADAEGALWTSEMLERG--RIEKL 274

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG-CPVG 364
             +  +++G D    AG G D+  +V           +W A ++ +   +G  P G
Sbjct: 275 PTFDRIVVGVDPATTAGAGSDECGIVVVGAQTQGAPQNWRAVVLADCTAQGATPSG 330


>gi|211731761|gb|ACJ10100.1| terminase [Bacteriophage APSE-4]
          Length = 469

 Score = 93.9 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/288 (11%), Positives = 80/288 (27%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   +       +C+      +++++ A +   +  L  +  F +
Sbjct: 12  GGRGGMKTVSFAKIALLTAAMHK-RRFLCLREFINSIEDSVHAVLQAEVETLGLQVRFRV 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +       +        +    H       + +EA   
Sbjct: 71  LNSCI--------------EGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      W    N    +G  Y  F  P             ++    
Sbjct: 113 SEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYRRFVKPYKAIIDKQGYYEDDEVYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           ++       + +            +    R    G+      +  I   +++ A+     
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYGDALIQPEWVDAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D A  G D+  +  R G +IE    WS   + +  
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADAT 278


>gi|213423381|ref|ZP_03356369.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 414

 Score = 93.5 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/244 (14%), Positives = 79/244 (32%), Gaps = 22/244 (9%)

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
            C    + +++ +++  +   +     RH F + +  +                 +    
Sbjct: 3   CCARQIQNKIEESVYTLLKIQIDRFGLRHRFRILNNKIINRV-------------TGSEF 49

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNT 230
           +    +     +            ++ +EA    +   K +     +     ++I   N 
Sbjct: 50  VFYGLWR----NIEEIKSLEGIDVLWLEEAHALTEYQWKILEPTIRKEGSECWFIF--NP 103

Query: 231 RRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
             +  + +  F   P ED    +I+      +     + I +    D +       G   
Sbjct: 104 GLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPE 163

Query: 290 QQEVNNFIPHNYIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFD 347
             +    I  ++IE A+    + D        +G D+A  G DK   V+R G++I    +
Sbjct: 164 SDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADE 223

Query: 348 WSAK 351
           W AK
Sbjct: 224 WKAK 227


>gi|212703250|ref|ZP_03311378.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
 gi|212673294|gb|EEB33777.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
          Length = 330

 Score = 93.5 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 60/173 (34%), Gaps = 15/173 (8%)

Query: 197 NDE-ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-------IPLEDW 248
            DE A   P++  + +     +   +    +   T +    F +++             W
Sbjct: 1   MDEVAQMKPEVWGEVVQPALADRRGS---AVFIGTPKGANLFAELYQRGMAAQAQGDAAW 57

Query: 249 KRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSR 308
                   + + + +   E +        +  R E+L  F     +  IP   + EA +R
Sbjct: 58  CALSYPVTSTDVLPAEDVERLRRELSD--NAFRQEMLCDFTASSDDILIPLPDVLEAEAR 115

Query: 309 EAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
           +   D     P+I+G D+A  G D +V+V R+G  ++           +    
Sbjct: 116 QLAWDDVGGMPVILGVDVARFGADSSVIVRRQGLKVDGPVVMRGLDNMQLADR 168


>gi|166012063|ref|ZP_02232961.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167427125|ref|ZP_02318878.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|2996304|gb|AAC13184.1| P-loop protein [Yersinia pestis KIM 10]
 gi|165988997|gb|EDR41298.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167053876|gb|EDR63708.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
          Length = 402

 Score = 93.5 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 37/257 (14%), Positives = 71/257 (27%), Gaps = 37/257 (14%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  FK  + AGR  GK+ L+   ++   +      +  +A +    +  LW ++ + L  
Sbjct: 7   PHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQMARQILWDDLQEVLPR 65

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
              R   +     +                            + +  D            
Sbjct: 66  KWVRKKNDTTMTIV---------------------LKNGSEIALKGADKPDTLRGVALHF 104

Query: 195 VFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLE------- 246
           V  DE     PD   K +    +        ++     +    F+ ++ I          
Sbjct: 105 VVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTP-KGFSEFHKLWTIGQNKDLQRKG 161

Query: 247 DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAM 306
            WK +Q  T     + S   E   +    D      E L  F       + P +      
Sbjct: 162 QWKSWQFVTADSPFVPSAEIEAAKNDM--DPKSFAQEYLASFENMSGRVYYPFD--RNVH 217

Query: 307 SREAIDDLYAPLIMGCD 323
            +    +   P+ +G D
Sbjct: 218 VKPLQFNPKLPIWVGQD 234


>gi|309797383|ref|ZP_07691776.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
 gi|308119007|gb|EFO56269.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
          Length = 418

 Score = 93.1 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 75/273 (27%), Gaps = 37/273 (13%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMKVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L     R   +     +                            + 
Sbjct: 66  MARQILWDDLQEVLPRKWVRKKNDTTMTIV---------------------LKNGSEIAL 104

Query: 179 ERPDTFVGPHNTHGMAVFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  D            V  DE      D   K +    +        ++     +    F
Sbjct: 105 KGADKPDTLRGVALHFVVLDEFQDMKADTWYKVLRPTLSS--TRGGALIIGTP-KGFSEF 161

Query: 238 YDIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
           + ++ I           WK +Q  T     + +   E   +    D      E L  F  
Sbjct: 162 HKLWTIGQNVELQRKGQWKSWQFVTADSPFVPTAEIEAAKNDM--DPKSFAQEYLASFEN 219

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
                + P +       +    +   P+ +G D
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPRLPIWVGQD 250


>gi|293411885|ref|ZP_06654610.1| predicted protein [Escherichia coli B354]
 gi|220980013|emb|CAP72205.1| Hypothetical protein [Escherichia coli LF82]
 gi|291469440|gb|EFF11929.1| predicted protein [Escherichia coli B354]
 gi|323934319|gb|EGB30739.1| PBSX family protein phage terminase [Escherichia coli E1520]
          Length = 418

 Score = 93.1 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 75/273 (27%), Gaps = 37/273 (13%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMKVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L     R   +     +                            + 
Sbjct: 66  MARQILWDDLQEVLPRKWVRKKNDTTMTIV---------------------LKNGSEIAL 104

Query: 179 ERPDTFVGPHNTHGMAVFNDEAS-GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  D            V  DE      D   K +    +        ++     +    F
Sbjct: 105 KGADKPDTLRGVALHFVVLDEFQDMKADTWYKVLRPTLSS--TRGGALIIGTP-KGFSEF 161

Query: 238 YDIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQ 290
           + ++ I           WK +Q  T     + +   E   +    D      E L  F  
Sbjct: 162 HKLWTIGQNVELQRKGQWKSWQFVTADSPFVPTAEIEAAKNDM--DPKSFAQEYLASFEN 219

Query: 291 QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
                + P +       +    +   P+ +G D
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPRLPIWVGQD 250


>gi|289805729|ref|ZP_06536358.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 257

 Score = 92.7 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 82/233 (35%), Gaps = 11/233 (4%)

Query: 124 LWAEVSKWLSMLPHR--HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
           ++A +++  + L +R   ++++Q         +  L  + +   +    +    +     
Sbjct: 14  VFAALARSRTKLKNRFTRFYKIQIDRFGLRHRFRILNNKIINRVTGSEFVFYGLWR---- 69

Query: 182 DTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
           +            ++ +EA    +   K +     +     ++I   N   +  + +  F
Sbjct: 70  NIEEIKSLEGIDVLWLEEAHALTEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNF 127

Query: 242 N-IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
              P ED    +I+      +     + I +    D +       G     +    I  +
Sbjct: 128 VVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLS 187

Query: 301 YIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           +IE A+    + D        +G D+A  G DK   V+R G++I    +W AK
Sbjct: 188 WIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAK 240


>gi|170752064|ref|YP_001758324.1| PBSX family phage terminase large subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658586|gb|ACB27641.1| phage terminase, large subunit, PBSX family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 440

 Score = 92.7 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 35/302 (11%), Positives = 76/302 (25%), Gaps = 32/302 (10%)

Query: 64  VHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNT 123
                      P  +K A   GRG  K+      ++ L + R  + ++C    +  +  +
Sbjct: 4   EFPEKLDFLFEPHRYKIAY-GGRGGAKSWGFGRALVILGAQRK-LRVLCAREFQNSIAES 61

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
             A +++ + +L   H ++ Q   +  +     + +                    R + 
Sbjct: 62  AHALLAQQIDLLGLSHLYDTQEKRILGTNGTEFIFK------------------GLRHNV 103

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-N 242
                       + +EA          ++    +      WI   NT       Y  F  
Sbjct: 104 ASVKSTEGVDVCWVEEARTVSKTSWDVLIPTIRKEGSE-IWISF-NTELAEDETYKRFVA 161

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
            P    +  +I             +  +     D         G            +  +
Sbjct: 162 KPPTGARVVKIGWEDNPWFPDVLRQEALDLKARDPIAYETVWGGNCKAVLDGAIYANEIL 221

Query: 303 ---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
                    +   D   P+    D+     DKT + F +        ++      E    
Sbjct: 222 AATTAKRFTKVPYDPTKPVHTFWDLGR--ADKTSIWFAQIVGF----EFRLIDFYENRGH 275

Query: 360 GC 361
             
Sbjct: 276 AL 277


>gi|121591052|gb|ABH10668.2| terminase subunit [Klebsiella phage KPP95]
          Length = 302

 Score = 92.7 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 35/282 (12%), Positives = 80/282 (28%), Gaps = 47/282 (16%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
             +Q + +E +             T    +    R +GKTT+ A  +   +      ++ 
Sbjct: 44  RDYQRDMLEIMAA--------KRMTCCNLS----RQLGKTTVVAIFLAHFVCFNKDKAVG 91

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
            +A+  +     L     + + +LP                   E  + S+ +D+     
Sbjct: 92  ILAHKGSMSAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI- 138

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSN 229
                      +           ++ DE +  P+      +I    +    ++  I+ + 
Sbjct: 139 ------GAYASSPDAVRGNSFAMIYIDECAFIPNFIDAWLAIQPVISSGRRSK--IIITT 190

Query: 230 TRRLNGWFYDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSD 278
           T      FYDI+   +E           W   +       +  D G+   + +      +
Sbjct: 191 TPSGLNHFYDIWTAAVEGKSGFTPYTAIWNSVKERLYNDEDMFDDGWQWSLQTISASSLE 250

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIM 320
             + E   +F        I    +      E   D +    +
Sbjct: 251 QFKQEHCAEFHGTS-GTLISGMKLANMDWIEVTPDSHGFYNL 291


>gi|18496890|ref|NP_569740.1| putative terminase gp4 [Mycobacterium phage TM4]
 gi|4336041|gb|AAD17572.1| putative terminase gp4 [Mycobacterium phage TM4]
          Length = 474

 Score = 92.3 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 89/354 (25%), Gaps = 71/354 (20%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
               WQ +  + +      +       +F  +I   R  GKT L   ++  L    P  +
Sbjct: 39  GFDLWQDDLGKLICA--KRDDGLYAADMFAMSI--PRQTGKTYLLGALVFALCIKTPNTT 94

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           +I  A+       T  +                 Q L+         L   +        
Sbjct: 95  VIWTAHRTRTAAETFRSM----------------QGLAKRDKIAPHILNVHTGNGKEAVL 138

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                       +   G        +  DEA    +     ++   T   PN   ++   
Sbjct: 139 FKNGSRILFGARERGFGRGFAGVDVLIFDEAQILTENAMDDMVPA-TNAAPNPLILLAGT 197

Query: 230 TRRLNGW------------------------FYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
             +                              D    P +  +  +++        +  
Sbjct: 198 PPKPTDPGEVFTVMRLDALAGDVDDVGYVEISADEDADPDDRSQWRKMNPSYPHRTSARA 257

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----IDDLYAPLIMG 321
              +    G +S   + E +G +P+      +    ++     +      +D  AP  + 
Sbjct: 258 ILRMRKALGDES--FKREAMGIWPKVS----VHQPVVKSGRWHDLFDLGPEDGEAPNALA 311

Query: 322 CDIAGE-----GGDKTVVVFRRGNIIEHIFDWSAKLI-------QETNQEGCPV 363
            D++       G     ++   G  +E +  W+            E      PV
Sbjct: 312 VDMSHGLAISVGACW--LMDDDGRHVEEV--WAGTDTAAAVDWIAERAGRRIPV 361


>gi|240850562|ref|YP_002971962.1| phage terminase, large subunit [Bartonella grahamii as4aup]
 gi|240267685|gb|ACS51273.1| phage terminase, large subunit [Bartonella grahamii as4aup]
          Length = 441

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/268 (14%), Positives = 74/268 (27%), Gaps = 30/268 (11%)

Query: 84  AGRGIGKTTLNAWMMLW--LISTRPG--MSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M         R G   +I+C    +  L  +   E+ + +       
Sbjct: 27  GGRGSGKTRSFALMAALKGYQFGREGISGTILCARQFQNSLAESSLEEIKRAIE------ 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                 L  +     + +      I           +S    +          +  + DE
Sbjct: 81  --AHDFLKDYYKVGESSIKSIDGRI--------AFQFSGLDRNIASIKSMGRILLCWVDE 130

Query: 200 ASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED-WKRYQIDT 255
           A    +   ++++    E         W+   N  R N      F     +  KR +I+ 
Sbjct: 131 AEPVTETAWQTLIPTLREEGEGWRAELWVTW-NPLRENAPVEKRFRFSDNEAIKRVEINW 189

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAID 312
                     +E  +       +  +    G + +     +     +   +E        
Sbjct: 190 SDNPKFPKILNEARLDDLRNRPETYKHIWEGDYLKAVQGAYYQKEMLAAEQEGRIGRVAR 249

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRR 338
           D    +    DI G G   D T +   +
Sbjct: 250 DPLMQIRAFWDIGGTGAKADATAIWIAQ 277


>gi|291334416|gb|ADD94071.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1035]
 gi|291334470|gb|ADD94124.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1161]
          Length = 223

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/243 (12%), Positives = 67/243 (27%), Gaps = 33/243 (13%)

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQS 161
           +S         IA +  Q K+  W  + ++ + +P+                  +  E  
Sbjct: 1   MSKLKNPRFAYIAPTFKQAKSIAWDYMKQFTAKIPN-----------------TKFNETE 43

Query: 162 MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNP 220
           + +D           +    +   G    +      DE +     +  + I    +  + 
Sbjct: 44  LRVD----LPNGSRITLLGAENSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALS--DR 97

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
             + +       +N  FYD++      EDW  Y+      + +D    E      G    
Sbjct: 98  KGYCVFIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK- 156

Query: 279 VARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVV 335
               E    +                 ++        D   P+    D+     D + ++
Sbjct: 157 -YLQEFECDWIANIEGAIYGEEIAKIEDKNQIARVPYDPTLPVSTAWDLGV--ADHSSII 213

Query: 336 FRR 338
           F +
Sbjct: 214 FFQ 216


>gi|87201130|ref|YP_498387.1| hypothetical protein Saro_3118 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136811|gb|ABD27553.1| protein of unknown function DUF264 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 440

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 85/277 (30%), Gaps = 31/277 (11%)

Query: 68  SNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
                + P+ ++   + AGRG GKT L A  +  +    P   I  +  S  + ++ +  
Sbjct: 42  RQSQQAPPSDWRVWLVMAGRGFGKTRLGAEWVRKIAEEDPEARIALVGASLHEARSVMVE 101

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
             S  LS                 + W   + E S+             YS   P++   
Sbjct: 102 GESGLLS---------------IDAPWRRPVFESSVRRLVWPNGAQAFLYSAGEPES--- 143

Query: 187 PHNTHGMAVFNDEASGTPDI------INKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
                    + DE +   +          ++L         R       T R       I
Sbjct: 144 LRGPQHSHAWCDEIAKWDNGSNRAMATWDNLLMGLRLGRDPRLVAT--TTPRPVPLVARI 201

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
            +   +            + +   F E +   +G  + + R E+LG+  +  V       
Sbjct: 202 MDEGDDVVVTRGSTFENQDNLPRRFVEAMRRTFGGTT-LGRQELLGEMIEDLVGALWSRA 260

Query: 301 YIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF 336
            IE A  RE        +++G D  A   GD   ++ 
Sbjct: 261 LIENA--REDAAPAMTRVVVGVDPPASAHGDACGIIV 295


>gi|292905266|ref|YP_003541137.1| hypothetical protein Ava_D0014 [Anabaena variabilis ATCC 29413]
 gi|75705004|gb|ABA24679.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 484

 Score = 91.2 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 51/353 (14%), Positives = 89/353 (25%), Gaps = 49/353 (13%)

Query: 26  LSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAG 85
             F  F                      W  E +  +       V          +I A 
Sbjct: 34  NDFAYFAEYV-------TGKTAAEHHLEWITELVTGISSQTLELVAGD-----NLSILAP 81

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM----------L 135
           RG  K+T  A  + W+I   P + II ++ SE+   +     + + +            L
Sbjct: 82  RGSAKSTWIAMWVAWVIGHNPSIQIIYVSYSESVALSRS-RIIKRIIESPKYREVFPNVL 140

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P + W +              L        +          S+      +   +      
Sbjct: 141 PGKRWSDTDWEIRKDFAGVDSLDSDYTFYATGITGSITSRRSDLVVYDDIIKSSESIENP 200

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ--- 252
              E        ++ I                    R +      F       +  Q   
Sbjct: 201 EVRE--KITTNYSEVIRPTLKPGGRQVN---IGTRFRADDIHCTDFIPAKGWKQIVQQAI 255

Query: 253 ---IDTRTVEGIDSGFHEGIISRYGLDSDV-ARIEILGQFPQQEVNNFIPHNYIEEAMSR 308
               D + V      F    +     DS V    +   +  +    +  P  +I+     
Sbjct: 256 VDDDDGKEVSYWPERFTLEELQALREDSPVAFSFQYQNRVMRSSETSIDPL-WIKHG--- 311

Query: 309 EAIDDLYAPLIMGCDIA---GEGGDKTVVVF--RRGNIIEHIF----DWSAKL 352
               D +  L +G D++    E  D TV V   R GN    +      WS  +
Sbjct: 312 -EFPDHFDSLCIGGDLSASLRERADYTVFVLGGRVGNKFYILDIRRGRWSGNI 363


>gi|109290130|ref|YP_656379.1| gp17 terminase subunit [Aeromonas phage 25]
 gi|104345803|gb|ABF72703.1| gp17 terminase subunit [Aeromonas phage 25]
          Length = 612

 Score = 91.2 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/376 (11%), Positives = 92/376 (24%), Gaps = 76/376 (20%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     +  ++ L E      C      F   +         +        +Q + + 
Sbjct: 83  LKRANIKIKWTKEMLAERK---RCKEDIVYFAENYCCIEHIDYGIIRVQ-LRDYQKDMLR 138

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +     N S            R +GKTT+ A  +   +      ++  +A+  +  
Sbjct: 139 IMAGNRLMAANLS------------RQLGKTTVVAIFLAHFVCFNSAKNVGILAHKASMS 186

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              L     + L +LP                   E  + S+ + +        +     
Sbjct: 187 AEVLHR-TKQALELLPD-----------FLQPGIVEWNKGSITLGNGCAIGAFSS----- 229

Query: 181 PDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
             +           ++ DE +  P  +    +I    +        I+ + T      +Y
Sbjct: 230 --SPDAVRGNSFALIYIDEVAFIPNFNDAWLAIQPVISSG--RHSKILMTTTPNGLNHWY 285

Query: 239 DIFNIP----------LEDWKRYQIDTRTVEGIDSG-----------FHEGIISRYGLDS 277
           DI+                +  Y     +V+                    I+ +     
Sbjct: 286 DIWTAAITPNSDGSGSKSGFVPYTATWSSVKERMYSDGSKTDGAIHILTTDILGQPRQSP 345

Query: 278 ----DVARIEILGQFPQQEVNNFIPHNYIEEAMSREA----------IDDLYAPLIMGCD 323
                  + E    F Q      I    + +   +E                   I   D
Sbjct: 346 VLALRAFQQEHNTAF-QGTSGTLINGFKLSKMTWKEVPASDNFTMFKEPIEGHKYIATLD 404

Query: 324 IA-GEGGDKTVVVFRR 338
            A G G D   +    
Sbjct: 405 SAEGRGQDYHAMHIYD 420


>gi|294338167|emb|CBJ94203.1| Putative phage DNA packaging protein (terminase) [Campylobacter
           phage CPt10]
          Length = 731

 Score = 91.2 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/307 (14%), Positives = 87/307 (28%), Gaps = 53/307 (17%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
             HC+      +   +   + +     K+T  +  +  L   +  ++I  +A S    + 
Sbjct: 259 YDHCYDLTLEHHHLYYTNGVLS-HNSSKSTTTSVKLAHLYCFKKDINIGIVAYSGNSARE 317

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            L       + +             +          + S+  ++    +T    S     
Sbjct: 318 FLDKTKKMLIGL------------PIWMQPGTVTWNKGSIECENNIKILTDVPSS----- 360

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINKSILGFF--TELNPNRFWIMTSNTRRLNGWFYDI 240
                  T    +  DE +                ++       ++  +T +    FYDI
Sbjct: 361 --DAFRGTSTNIIVVDECAYLDPAGWIDFTDGVLPSQAGLAFKKLVILSTPKGKNHFYDI 418

Query: 241 FNIPLE-------DWKRYQIDTRTVEGI--------DSGFHEGIISRYGLDSDVARIEIL 285
           +    +        + R+++D R V              F +  I   GL   V      
Sbjct: 419 WQGAGDTLETSINGFVRHRVDWRLVPRFKSDGTKYDPEEFKQQQIKTGGL--VVWNSAYE 476

Query: 286 GQF--------PQQEVNNFIPHNYIEEAMSRE------AIDDLYAPLIMGCDIAGEGGDK 331
            +F        P + ++ + P   IE    ++               +MG D A EG D 
Sbjct: 477 CKFEGSAMTLIPSEILDTYKPQEPIEVDNIKDSKILIYEEPIPGHKYVMGVDTAKEGADF 536

Query: 332 TVVVFRR 338
           T V    
Sbjct: 537 TGVQIFD 543


>gi|294337972|emb|CBJ93810.1| putative phage DNA packaging protein (terminase) [Campylobacter
           phage CP220]
          Length = 744

 Score = 91.2 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/307 (14%), Positives = 87/307 (28%), Gaps = 53/307 (17%)

Query: 63  DVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
             HC+      +   +   + +     K+T  +  +  L   +  ++I  +A S    + 
Sbjct: 259 YDHCYDLTLEHHHLYYTNGVLS-HNSSKSTTTSVKLAHLYCFKKDINIGIVAYSGNSARE 317

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            L       + +             +          + S+  ++    +T    S     
Sbjct: 318 FLDKTKKMLIGL------------PIWMQPGTVTWNKGSIECENNIKILTDVPSS----- 360

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINKSILGFF--TELNPNRFWIMTSNTRRLNGWFYDI 240
                  T    +  DE +                ++       ++  +T +    FYDI
Sbjct: 361 --DAFRGTSTNIIVVDECAYLDPAGWIDFTDGVLPSQAGLAFKKLVILSTPKGKNHFYDI 418

Query: 241 FNIPLE-------DWKRYQIDTRTVEGI--------DSGFHEGIISRYGLDSDVARIEIL 285
           +    +        + R+++D R V              F +  I   GL   V      
Sbjct: 419 WQGAGDTLETSINGFVRHRVDWRLVPRFKSDGTKYDPEEFKQQQIKTGGL--VVWNSAYE 476

Query: 286 GQF--------PQQEVNNFIPHNYIEEAMSRE------AIDDLYAPLIMGCDIAGEGGDK 331
            +F        P + ++ + P   IE    ++               +MG D A EG D 
Sbjct: 477 CKFEGSAMTLIPSEILDTYKPQEPIEVDNIKDSKILIYEEPIPGHKYVMGVDTAKEGADF 536

Query: 332 TVVVFRR 338
           T V    
Sbjct: 537 TGVQIFD 543


>gi|49475696|ref|YP_033737.1| Phage related protein [Bartonella henselae str. Houston-1]
 gi|49238503|emb|CAF27734.1| Phage related protein [Bartonella henselae str. Houston-1]
          Length = 441

 Score = 91.2 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 78/299 (26%), Gaps = 37/299 (12%)

Query: 79  KCAISA---GRGIGKTTLNAWMMLW----LISTRPGMSIICIANSETQLKNTLWAEVSKW 131
           K A+ A   GRG GKT   A M               +I+C    +  L  +   E+ + 
Sbjct: 19  KAAVRAAWGGRGSGKTRSFALMAALKGYQFGMGGISGTILCARQFQNSLAESSLEEIKRA 78

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +                    +Y         ID +        +S    +         
Sbjct: 79  IE------------GHDFLKDYYKVGESSIKSIDGR----IAFQFSGLDRNIASIKSMGR 122

Query: 192 GMAVFNDEASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED- 247
            +  + DEA    +   ++++    E         W+   N  R N      F     + 
Sbjct: 123 ILLCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTW-NPLRDNAPVERRFRFSNNEA 181

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EE 304
            KR +I+           +E  +       +  +    G +       +     +   +E
Sbjct: 182 IKRVEINWSDNPKFPKILNEARLDDLKNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQE 241

Query: 305 AMSREAIDDLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
                   D    +    DI G G   D T +   +        +       E   +  
Sbjct: 242 GRIGRVARDPLMQMRAFWDIGGTGAKADATAIWIAQ----FVGREIRVLDYYEAQGQPL 296


>gi|80159854|ref|YP_398598.1| conserved phage-related protein [Clostridium phage c-st]
 gi|78675444|dbj|BAE47866.1| conserved phage-related protein [Clostridium phage c-st]
          Length = 580

 Score = 91.2 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/388 (12%), Positives = 100/388 (25%), Gaps = 66/388 (17%)

Query: 6   STDQKLEQE--LHEMLMHAECVLSFKNFVMRF--FPWGIKGKPLEHFSQPHRWQLEFMEA 61
           S D   +++  LH              +      F   + G  L  F      Q   + A
Sbjct: 27  SYDPIKDKKDGLHTEEWEKYI----SYYRKYIDKFCIEVLGLKLYLF------QRLILRA 76

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK 121
           +  + +              +   RG+GK+ L+A   +       G+     +    Q +
Sbjct: 77  MARNQY------------VMLICCRGLGKSWLSAVFFVASCILYKGLKCGIASGQGQQAR 124

Query: 122 NTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERP 181
           N +  +V   L+  P                      +  +   +               
Sbjct: 125 NVIIQKVKGELAKNP-------SIAREIVFPIKTGADDCVVNFRNGSEIRAIVLGR---- 173

Query: 182 DTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFT----------ELNPNRFWIMTSNT- 230
           +   G  +     +  DE     D +  +IL   T                  I  S+  
Sbjct: 174 NQGDGARSWRFHYLLVDECRLVSDKVINTILIPMTKTKRAVAIHHNKREKGKVIFISSAY 233

Query: 231 ------RRLNGWFYDIFNIPLEDWKRYQIDTR---TVEGIDSGFHEGIISRYGLDSDVAR 281
                  +   +F D  +    ++    +D R        D    +   ++  +  +  +
Sbjct: 234 LKTSDLYKRFKYFCDKMSSGANNYFVCSLDYRVGIEAGIFDQDDIDEERNKPDMTIEEFQ 293

Query: 282 IEILGQFPQQEVNNFIPHNYIEEAM-----SREAIDDLYAPLIMGCDIAGEG---GDKTV 333
            E  G F      ++ P+     A               +  I+  D+A  G    D   
Sbjct: 294 YEYEGIFVGSSGESYFPYETTTPARVLGRGEITQPKKSKSEYIITHDVAISGASDSDNAC 353

Query: 334 VVFRRGNIIEHIFDWSAKLIQETNQEGC 361
               +    +    +  +++      G 
Sbjct: 354 THVIK-LKPKPNGTYVKEVVYTKTHNGI 380


>gi|163868206|ref|YP_001609414.1| phage related protein [Bartonella tribocorum CIP 105476]
 gi|163869068|ref|YP_001610302.1| hypothetical protein Btr_2286 [Bartonella tribocorum CIP 105476]
 gi|161017861|emb|CAK01419.1| phage related protein [Bartonella tribocorum CIP 105476]
 gi|161018749|emb|CAK02307.1| phage-related protein [Bartonella tribocorum CIP 105476]
          Length = 442

 Score = 90.8 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/291 (13%), Positives = 75/291 (25%), Gaps = 34/291 (11%)

Query: 84  AGRGIGKTTLNAWMMLW----LISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M               +I+C    +  L  +   E+ + +       
Sbjct: 27  GGRGSGKTRSFALMAALKGYQFGMQGISGTILCARQFQNSLAESSLEEIKRAIE------ 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                 LS +     A +      I           +S    +          +  + DE
Sbjct: 81  --AHDFLSEYYKVGEASIKSNDGRI--------AFQFSGLDRNIASIKSMGRILLCWVDE 130

Query: 200 ASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED-WKRYQIDT 255
           A    +   ++++    E         W+   N  R N      F     +  KR +I+ 
Sbjct: 131 AEPVTETAWQTLIPTLREEGDGWRAELWVTW-NPLRDNAPVESRFRFSDNEAIKRVEINW 189

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAID 312
                     +E  +       +  +    G +       +     +   +E        
Sbjct: 190 SDNPKFPKILNEARLDDLRNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQEGRIGRVAR 249

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
           D    +    DI G G   D T +   +        +       E   +  
Sbjct: 250 DPLMQIRAFWDIGGTGAKADATAIWIAQ----FVGREIRVLDYYEAQGQPL 296


>gi|161525001|ref|YP_001580013.1| hypothetical protein Bmul_1828 [Burkholderia multivorans ATCC
           17616]
 gi|189350256|ref|YP_001945884.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
 gi|160342430|gb|ABX15516.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334278|dbj|BAG43348.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
          Length = 531

 Score = 90.8 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 76/279 (27%), Gaps = 22/279 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G + L   +   +     G++    +  E         E    +       W   + 
Sbjct: 101 RDMGMSWLTVGLADTICLFHEGVAAGFGSRKE---------EYVDKIGSPKSLFWKAREF 151

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
           L L P+ +       +     +       +         +G           DE++    
Sbjct: 152 LRLLPAEFRGSWDIGTHAPHMRIIFPDTGSVITGESGDGIG-RGDRASFYIVDESAFLER 210

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
                     T           S    +   F    +      K +    R     D  +
Sbjct: 211 PQLVDASLSATTNCRQD----ISTPNGMGNSFAQRRH--SGKVKVFTFHWRDDPRKDDAW 264

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +        LD  V   EI   +        IP  +++ A+        +       G D
Sbjct: 265 Y--AKQCAELDPVVVAQEIDINYAASVEGVVIPSAWVQAAIGAHLKLGIEPSGTRRGGLD 322

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSAK--LIQETNQEG 360
           +A EG DK     R G ++  +  WS K   I ET ++ 
Sbjct: 323 VADEGKDKNAFAGRYGFLLNFLRSWSGKGGDIYETVEKT 361


>gi|221199508|ref|ZP_03572552.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2M]
 gi|221205590|ref|ZP_03578605.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2]
 gi|221174428|gb|EEE06860.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2]
 gi|221180793|gb|EEE13196.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2M]
          Length = 425

 Score = 90.8 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 80/295 (27%), Gaps = 34/295 (11%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P     ++  GRG GKT   A  +L   + +P + ++C    +  +K +++A +   +
Sbjct: 11  FEPQWRFISVRGGRGSGKTVNFARALLIRATQKP-LRVLCTREVQDSIKESVYATLVSEM 69

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
             +     F++ S  + P    A                  R  S+   D          
Sbjct: 70  KKMGLESHFDVLSNEIRPKLGGA---------------FIFRGLSDMTADNVKSL--ADI 112

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWKR 250
              + +EA    +   + +            W+   N      + Y              
Sbjct: 113 DIAWVEEAQTITENSFRKLTPSIRAPGSQ-IWLSW-NPELETDFIYQKVVIEGLPNCASL 170

Query: 251 YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE---EAMS 307
           + ++                   G D D+ R   LG            +   +   E   
Sbjct: 171 F-VNFDQNPWFPDELRLEEQDMKGKDPDMHRHVWLGMPLPAVAGAIYFNEISQMESEGRL 229

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHI-FDWSAKLIQETNQEGC 361
                D      +  D+     D T        +++ +  ++      E  ++  
Sbjct: 230 LNIPIDDGLNTYIIMDLGF--NDFTSC-----PVVQQVGGEFRIVDFFENRRKPL 277


>gi|211731828|gb|ACJ10140.1| terminase [Bacteriophage APSE-6]
          Length = 469

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/288 (12%), Positives = 77/288 (26%), Gaps = 35/288 (12%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG  KT   A + L   S       +C+      +++++ A +   +  L  +  F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQVRFRV 70

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
            +  +                 +       +        +    H       + +EA   
Sbjct: 71  LNSCI--------------EGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------------EDWKRY 251
            +    +++    +      +    N    +G  Y  F  P             +D    
Sbjct: 113 SEKSLDTLIPTIRKPGSELRFSF--NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
            +       +              +    R    G+      +  I   ++  A+     
Sbjct: 171 NVSYLDNPWLPVELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVGAAIDAHIK 230

Query: 312 D--DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                    ++  D AG G D+  +  R G +IE    W    + +  
Sbjct: 231 LGFKPSGIRVVTFDPAGSGQDEKALSKRYGVLIEDCVSWLEGDVADAT 278


>gi|310815629|ref|YP_003963593.1| Putative large terminase [Ketogulonicigenium vulgare Y25]
 gi|308754364|gb|ADO42293.1| Putative large terminase [Ketogulonicigenium vulgare Y25]
          Length = 427

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/294 (12%), Positives = 75/294 (25%), Gaps = 36/294 (12%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLIST-RPG----- 107
           Q+  +  +               ++  +   GRG GKT   A  +  ++   RP      
Sbjct: 8   QIAALPWLFEFWALPHQLPPSGDWRTWVIMGGRGAGKTRAGAEWVRSMVEGPRPDTPGRA 67

Query: 108 MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSK 167
             +  IA +  Q +  +    S  ++  P     E  +                      
Sbjct: 68  KRVGLIAQTMDQAREVMVFGDSGLMACCPPARRPEWIAGRAMLR---------------- 111

Query: 168 HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWI 225
                                     A++ DE +           ++      +  R  +
Sbjct: 112 --WPNGAEARLFSAHDPEALRGPQFDAIWADEVAKWRLAQEAWDMLVMGLRLGDDPRACL 169

Query: 226 MTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
               T    G F             +         +  GF    +      S + R E+ 
Sbjct: 170 ---TTTPRGGPFLRKLLAQSGTVMTHAPTRANRANLAPGFV-AAVEAMFEGSHLGRQELD 225

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
           G    +      P + ++ A+ R+A       +++  D       G D   ++ 
Sbjct: 226 GLLVDEAEGTLWPQHLLDAALQRQAPP--LDRIVVAVDPPVTGHAGSDACGIIV 277


>gi|319405798|emb|CBI79424.1| phage related protein [Bartonella sp. AR 15-3]
          Length = 441

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 80/299 (26%), Gaps = 37/299 (12%)

Query: 79  KCAISA---GRGIGKTTLNAWMMLW----LISTRPGMSIICIANSETQLKNTLWAEVSKW 131
           + A+ A   GRG GKT   A M               +I+C    +  L  +   E+ + 
Sbjct: 19  RAAVRAAWGGRGSGKTRSFALMAALKGYQFGMGGISGTILCARQFQNSLAESSLEEIKRA 78

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +             L  +     + +  +   I           +S    +         
Sbjct: 79  VE--------AHDFLKDYYKVGESTIKSKDGRI--------SFQFSGLDRNIASIKSMGR 122

Query: 192 GMAVFNDEASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED- 247
            +  + DEA    +   ++++    E         W+   N  R N      F     + 
Sbjct: 123 ILLCWVDEAEPVTETAWQTLIPTLREEGDGWRAELWVTW-NPLRENAPVERRFRFSENEG 181

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EE 304
            K  +I+           +E  +      ++  +    G + +     +     +   +E
Sbjct: 182 IKGVEINWSDNPKFPQILNEARLDDLKNRAESYQHIWEGGYLKAVQGAYFQKEMLAAEQE 241

Query: 305 AMSREAIDDLYAPLIMGCDIAGEG--GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
                   D    L    DI G G   D T +   +        +       E   +  
Sbjct: 242 GRIGRVARDPLMQLRAFWDIGGTGAKADATAIWIAQ----FVGREIRVLDYYEAQGQPL 296


>gi|332091158|gb|EGI96248.1| phage terminase large subunit [Shigella dysenteriae 155-74]
          Length = 346

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 58/161 (36%), Gaps = 5/161 (3%)

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
            ++ +EA    +   K +     +     ++I   N   +  + +  F   P E     +
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEGTLIRK 58

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           I+      +     + I +    D D  +    G     +    I  ++IE A+      
Sbjct: 59  INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 118

Query: 313 --DLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
             +      +G D+A  G DK   V+R G+++    +W AK
Sbjct: 119 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAK 159


>gi|240850378|ref|YP_002971772.1| phage terminase, large subunit [Bartonella grahamii as4aup]
 gi|240267501|gb|ACS51089.1| phage terminase, large subunit [Bartonella grahamii as4aup]
          Length = 444

 Score = 90.0 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/268 (14%), Positives = 73/268 (27%), Gaps = 30/268 (11%)

Query: 84  AGRGIGKTTLNAWMMLW--LISTRPG--MSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M         R G   +I+C    +  L  +   E+ + +       
Sbjct: 29  GGRGSGKTRSFALMAALKGYQFGREGISGTILCARQFQNSLAESSLEEIKRAIE------ 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                 L  +     + +      I           +S    +          +  + DE
Sbjct: 83  --AHDFLKDYYKVGESSIKSIDGRI--------AFQFSGLDRNIASIKSMGRILLCWVDE 132

Query: 200 ASGTPDIINKSILGFFTELN---PNRFWIMTSNTRRLNGWFYDIFNIPLED-WKRYQIDT 255
           A    +   ++++    E         W+   N  R N      F     +  KR +I+ 
Sbjct: 133 AEPVTETAWQTLIPTLREEGEGWRAELWVTW-NPLRENAPVEKRFRFSDNEAIKRVEINW 191

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAID 312
                     +E  +       +  +    G +       +     +   +E        
Sbjct: 192 SDNPKFPKILNEARLDDLRNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQEGRIGRVAR 251

Query: 313 DLYAPLIMGCDIAGEG--GDKTVVVFRR 338
           D    +    DI G G   D T +   +
Sbjct: 252 DPLMQIRAFWDIGGTGAKADATAIWIAQ 279


>gi|83950455|ref|ZP_00959188.1| Putative large terminase [Roseovarius nubinhibens ISM]
 gi|83838354|gb|EAP77650.1| Putative large terminase [Roseovarius nubinhibens ISM]
          Length = 434

 Score = 90.0 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 80/296 (27%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
           AI  GRG GKT   A  +   +             I  +  +  Q++  +    S  L+ 
Sbjct: 41  AIMGGRGAGKTRAGAEWVRAAVEGATPGAPGRCRRIALVGETVDQVREVMIFGESGILAC 100

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E Q+                               +                 
Sbjct: 101 SPPDRRPEWQASRRRL------------------VWPNGAEAAVFSAHDPEALRGPQFDG 142

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  +  +    T R  G   D+   P       Q
Sbjct: 143 AWLDEMAKWKKARATWDMLQFALRLGDDPQICVT--TTPRNVGVLKDVLAAPS--TVVTQ 198

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
             T       +      +    + + + R E+ G   ++          ++ A  R +  
Sbjct: 199 APTEANRAHLAESFLAEVRARYVGTRLGRQELDGILLEEAEGALWSLAALDAA--RVSKL 256

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC-PVG 364
              + +++  D       G D+  ++    +    + +W A ++ + +  G  P G
Sbjct: 257 PELSRIVVAVDPPVTGHAGSDECGIIVAGVDQSGPVQEWRAYVLADRSVSGMSPTG 312


>gi|218296139|ref|ZP_03496908.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
 gi|218243516|gb|EED10045.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
          Length = 426

 Score = 90.0 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 48/305 (15%), Positives = 91/305 (29%), Gaps = 40/305 (13%)

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H            F   +  GR  GKTTL   +     + R G ++   A   + L    
Sbjct: 13  HPAQREVVGAAKRFNL-LRCGRRWGKTTLLLRLAAQAAAER-GQAVGWFAPIYSLLAPA- 69

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           + E+ +       R     Q +  + SG   E                            
Sbjct: 70  YEELLRRTRPGVVRAAERPQPVIRYVSGGRIEFWSLDSKDVPG----------------- 112

Query: 185 VGPHNTHGMAVFNDEASGTP---DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
                        DEA+  P    +  ++IL    +   + +    ++T +    FY+++
Sbjct: 113 ---RGRAYDLAIIDEAAFAPSLARVWEEAILPTLLDRLGSAW---IASTPKGRNAFYELW 166

Query: 242 NIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPH 299
           N+ L+D  W  +   +     +       + +    +    R EIL ++           
Sbjct: 167 NLTLDDPAWAHFHEPSHRNPFLSQEELARMAATMTRE--RYRQEILAEWVD-AEGRVFSE 223

Query: 300 NYIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH---IFDWSAKLIQ 354
           + +E A+  +  +D         G D+A    D T V   R         +  W      
Sbjct: 224 DALEAALLLQGPEDPRPGERYAAGVDLARS-QDYTAVAVLRLGAQLELVRVERWRGLSYT 282

Query: 355 ETNQE 359
            T ++
Sbjct: 283 LTARK 287


>gi|163792602|ref|ZP_02186579.1| hypothetical protein BAL199_17183 [alpha proteobacterium BAL199]
 gi|159182307|gb|EDP66816.1| hypothetical protein BAL199_17183 [alpha proteobacterium BAL199]
          Length = 422

 Score = 90.0 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/274 (15%), Positives = 79/274 (28%), Gaps = 27/274 (9%)

Query: 68  SNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
                     ++   I AGRG GKT   A  +  L  +     I  +A +    ++ +  
Sbjct: 30  RPKQLPPAGDWRVWLILAGRGFGKTRTGAEWVRGLAESGRARRIALVAETAADARDVMIE 89

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
             S  L+        + +      +                         +    D    
Sbjct: 90  GESGLLACCAPWGRPKYEPSKRRVT------------------WPNGAIATSFSADDPDQ 131

Query: 187 PHNTHGMAVFNDEASGTP-DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
                  A + DE +    +    +++         R   + + T +   W   +   P 
Sbjct: 132 LRGPQFDAAWADEIAKWRYEAAWDNLMLGLRLGADPR--CVATTTPKPRAWLARLMADP- 188

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
                          +  GF + I++RY     + R EI G+F  +          IE A
Sbjct: 189 GTVVTRGATRENAGNLAPGFLDQILARYAGT-RLGRQEIDGEFLTEIPGALWTRTLIEGA 247

Query: 306 MSREAIDDLYAPLIMGCDIAGEGG---DKTVVVF 336
            +        A +I+  D A   G   D+T +V 
Sbjct: 248 RALPGAVPGLARIIVAVDPAVTSGSDSDETGIVV 281


>gi|304360765|ref|YP_003856886.1| gp8 [Mycobacterium phage Angelica]
 gi|302858349|gb|ADL71097.1| gp8 [Mycobacterium phage Angelica]
          Length = 473

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 42/351 (11%), Positives = 84/351 (23%), Gaps = 68/351 (19%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            +WQ +  + V      +       +F  +I   R  GKT     ++       PG ++I
Sbjct: 43  DQWQDDLGKLVCA--KRSDGLYAADMFAMSI--PRQTGKTYFLGAIVFAFCKMNPGTTVI 98

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+       T  +                 Q+L+         L   +          
Sbjct: 99  WTAHRTRTAAETFKSM----------------QALAKREQIAPHILNVHTGNGKEAVLFT 142

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                     +   G        +  DEA    +     ++   T  +PN   +      
Sbjct: 143 NGSRILFGAREKGFGRGFAKVDVLIFDEAQILSENAMDDMIPA-TNASPNGLILFAGTPP 201

Query: 232 RLNGW------------------------FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHE 267
           +                              D  + P E+    +++        +    
Sbjct: 202 KPTDPGEVFTNLRMDALNGESDDVAYVEISADENDDPDEESTWRKMNPSYPHRTSARAIR 261

Query: 268 GIISRYGLDSDVARIEILGQFPQ-QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAG 326
            +      DS   R E +G + +       I      +       +    P  +G D++ 
Sbjct: 262 RMRKALSWDS--FRREAMGIWDKISVHAQVIKAGLWRDLADPLGPEPGAKPASLGVDMSH 319

Query: 327 EGGDKTVV-----VFRRGN--IIEHIFDWSAKLIQ-------ETNQEGCPV 363
            G     +              +E +  W+            E      PV
Sbjct: 320 GG----AISIGGCWLIDDELRHVEQV--WAGTDTAAAVEFIVERAGRRIPV 364


>gi|329888629|ref|ZP_08267227.1| phage DNA packaging protein [Brevundimonas diminuta ATCC 11568]
 gi|328847185|gb|EGF96747.1| phage DNA packaging protein [Brevundimonas diminuta ATCC 11568]
          Length = 411

 Score = 89.2 bits (219), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 74/277 (26%), Gaps = 21/277 (7%)

Query: 58  FMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSE 117
             E +               F+ A   GRG  K+       ++   T P + ++ +    
Sbjct: 2   IYEPIPAFRFLTAKPLGSYRFRAA-HGGRGSAKSWSVVDAAIFHTVTTPRLRVVFLREIM 60

Query: 118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
             L  +    V K L                   G Y   +  +         +    + 
Sbjct: 61  ANLTESSLELVRKRLEHFG-------------LLGSYFREVNGTFQGLGGQKIMFIGLWK 107

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
             +P+               +EA          +L        +  W +  N R      
Sbjct: 108 GGKPEGIKSLEGAG--LTILEEAQEVRQASLDVLLPTILRTAISELWAIW-NPRLDTDPI 164

Query: 238 YDIFNIPL--EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNN 295
              F  P+  +     +I+            E +   +  D   A    LG +       
Sbjct: 165 DVFFRGPVKPKGAIVRKINYDQNPHFPDALRELMELDFSKDKLRAAWIWLGGYMPSVQGA 224

Query: 296 FIPHNYIEEAMS--REAIDDLYAPLIMGCDIAGEGGD 330
                 ++EA    R A +  +  +++G D +G G D
Sbjct: 225 IWNREGLDEAWREGRHAPEGSWGRVVVGVDPSGGGDD 261


>gi|312126991|ref|YP_003991865.1| hypothetical protein Calhy_0759 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777010|gb|ADQ06496.1| conserved hypothetical protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 444

 Score = 89.2 bits (219), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 48/288 (16%), Positives = 84/288 (29%), Gaps = 35/288 (12%)

Query: 79  KCAIS-AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
           K  I  AGR  GK+T+    ++   +T+        A S  Q K   + E  +      +
Sbjct: 48  KVQIKVAGRRFGKSTVTLIDVVHECATKTKQVWYITAPSIDQAK-IYFQEFEQ--RAANN 104

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                +                  + + +    +   T         V         V  
Sbjct: 105 SLLDALVKDFKWSPFP-------EITLINGSKILGRSTSR-----NGVYLRGKGADGVAI 152

Query: 198 DEASGTPDIIN-KSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED----WKRYQ 252
            EA+   D +    I     + N     +    T     + Y +F   L D    +K + 
Sbjct: 153 TEAAFIKDKVYHDVIRAMVLDRNG---VLRLETTPNGMNYVYKLFQEGLNDSTGYYKSFH 209

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY---IEEAMSRE 309
                 E +D    E I           RIE L +F + + +   P N    + +    +
Sbjct: 210 ATVYDNERLDREELERIRREIPE--LAWRIEYLAEFVE-DDSFIFPWNLLCEVFDDYELK 266

Query: 310 AIDDLYAPLIMGCDIAGEGGDKTVVVF----RRGNIIEHIFDWSAKLI 353
                     +G D+A    D TV++     R    I     +  +L 
Sbjct: 267 KEPQNGHRYSIGVDLAKY-QDYTVIIVLDITREPYQIVEYHRYQGRLY 313


>gi|315655961|ref|ZP_07908859.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 51333]
 gi|315490025|gb|EFU79652.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 51333]
          Length = 460

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/319 (13%), Positives = 88/319 (27%), Gaps = 43/319 (13%)

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
           H  ++ +       +  +  GRG GKT   A ++       PG  I  +A  E+ +++  
Sbjct: 43  HARASQHPPTGAWTEWLLMTGRGWGKTRTAAELVRDWA-KNPGTQIAVVAKKESLVRSIC 101

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           +             H       +   +   +      +            T      +  
Sbjct: 102 FE-----HKTSGLLHVIPKSDQARFNASGGSGRFFLQLK--------NGSTIYGFGAEVP 148

Query: 185 VGPHNTHGMAVFNDEASGT----PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
                      + DE +         +   +     E       ++ S T +      D+
Sbjct: 149 DNLRGFAFDKAWFDEFAAWNKQTAQEVYDMMWYDLRE--SPSPQMVISTTPKPLKHVRDL 206

Query: 241 FNIPLEDWKRYQIDTRTV-EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPH 299
            + P       +  T+     + +   E +   YG    + R E+ G+  +         
Sbjct: 207 VSKP--GVVITRGHTKDNLPNLSAIALEKLERDYGKT-RLGRQELAGELIESIEGALWDV 263

Query: 300 NYIEEAMSREAIDDLYAPLIMGCDIAG---EGGDKTVV---------------VFRRGNI 341
              ++ + R         +++G D A    EG D T                     G I
Sbjct: 264 TMFQDPVFRPDTMPPLEDIVVGVDPAVRSSEGADMTAFTVAARAEDAPGMFPDHLNHGYI 323

Query: 342 IEHI-FDWSAKLIQETNQE 359
           +E I   ++ +       E
Sbjct: 324 LEAIQGHYTPRDAMAKAGE 342


>gi|294677220|ref|YP_003577835.1| terminase-like family protein [Rhodobacter capsulatus SB 1003]
 gi|294476040|gb|ADE85428.1| terminase-like family protein [Rhodobacter capsulatus SB 1003]
          Length = 455

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 80/292 (27%), Gaps = 31/292 (10%)

Query: 81  AISAGRGIGKTTLNAWMMLWL------ISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +             P   +  +  +  Q+++ +    S  L+ 
Sbjct: 61  VIMGGRGAGKTRAGAEWVRMQVEGAGPADAGPAHRVALVGETFDQVRDVMIFGESGILAC 120

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                             T                  A
Sbjct: 121 SPPDRRPEWEATKRRL------------------VWANGATAQAYSAQEPEALRGPQFDA 162

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            + DE +          +  F          + + T R  G    I N P      +   
Sbjct: 163 AWVDELAKWRRAEETWDMLQFALRLGKHPQQVITTTPRNVGVLKAILNNPST-VVTHAPT 221

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +   F   + +RY     + R E+ G   +           +E    R A    
Sbjct: 222 EANRAYLAESFLAEVQARYAGT-RLGRQELEGVLLEDVEGALWTTAQLEGL--RLASPPA 278

Query: 315 YAPLIMGCDIA---GEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPV 363
              +++  D A   G G D+  +V         + DW A ++++ +  G P 
Sbjct: 279 MDRVVVALDPAVTGGAGSDECGIVVAGAVTRGPVQDWRAFVLEDASVRGRPT 330


>gi|163716617|gb|ABY40529.1| putative TerL [Burkholderia phage Bups phi1]
          Length = 531

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/368 (13%), Positives = 93/368 (25%), Gaps = 49/368 (13%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGI------------KGKP 44
           P  +   +   + L  +  +   + + + F           WG+               P
Sbjct: 12  PDYVQVFEWRAERLQRIRANPGVLPALRAFYRDNPAQFIIDWGMTFDPRNVERGLPATIP 71

Query: 45  LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST 104
              F +   W       +                K      R +G + L   +   +   
Sbjct: 72  FLLFPKQEDW-------IAWFMERWRAREPGITEKT-----RDMGMSWLTVGLADTVCLF 119

Query: 105 RPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGI 164
             G++    +  E         E    +       W   + L L P+ +       +   
Sbjct: 120 HEGVAAGFGSRKE---------EYVDKIGSPKSLFWKAREFLRLLPAEFRGSWDIGTHAP 170

Query: 165 DSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFW 224
             +       +         +G           DE++              T        
Sbjct: 171 HMRIIFPDTGSVITGESGDGIG-RGDRASFYVVDESAFLERPQLVDASLSATTNCRQD-- 227

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
              S    +   F    +      K +    R     D  ++   ++    D  V   EI
Sbjct: 228 --ISTPNGMGNSFAQRRH--SGKIKVFTFHWRDDPRKDDAWYAKQVAEL--DPVVVAQEI 281

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNII 342
              +        IP  +++ A+        +       G D+A EG DK     R G ++
Sbjct: 282 DINYAASVEGVVIPSAWVQAALGAHVKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLL 341

Query: 343 EHIFDWSA 350
           EH+  WS 
Sbjct: 342 EHLESWSG 349


>gi|205374899|ref|ZP_03227691.1| hypothetical protein Bcoam_17870 [Bacillus coahuilensis m4-4]
          Length = 500

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/384 (11%), Positives = 94/384 (24%), Gaps = 87/384 (22%)

Query: 11  LEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNV 70
            E+EL+E+   A  ++ F N    +F    +G           +Q +F+  +  H  +  
Sbjct: 6   TEEELNELEKCANDIVYFAN-TYIWFNDKKRGIVQFEAY---PFQADFLLDLCEHQKN-- 59

Query: 71  NNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSK 130
                      +   R +G +       L           + ++  ++   + L      
Sbjct: 60  ----------IVLKSRQMGLSWTALIWALHRCLFFFDQKGLILSMDKSAADDAL------ 103

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
                 +R       L     G   +  +  +            +  +    T     + 
Sbjct: 104 ------NRIKVMYDYLPDFLKGDLGDNSKSIIE------FKDMNSMIKSVAMTESAGRSD 151

Query: 191 HGMAVFNDEASG-----TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
                  DE +       P  +  S+            +I  S        F+  +    
Sbjct: 152 TPTFAIWDEMAFPRKGVDPYKVWDSLKPAL---GETGKFIGISTPNGFGNLFHRFWTQGE 208

Query: 246 ED-WKRYQIDTRTVEGI--------------------DSGFHEGII--------SRYGLD 276
           E  +++ QI   +                         +   E +             +D
Sbjct: 209 ERGFRKTQIHWTSRPDRVGSIELFNELEERRKRRLQPTTEQVERVKAVSHWYEMECKDMD 268

Query: 277 SDVARIEILGQFPQQE-------------VNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
            D    E    F                  N     N + + + +    +     I   D
Sbjct: 269 DDKFSQEYEMNFLNSGRPAFSISKVLKQFDNVLDKFNKLNDHIEQYKKPEAGVEYIAAFD 328

Query: 324 IA-GEGGDKTV--VVFRRGNIIEH 344
            + G GGD     +  R G  +  
Sbjct: 329 TSEGTGGDNNAFGIFTRDGEQVLE 352


>gi|213426918|ref|ZP_03359668.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 374

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 59/171 (34%), Gaps = 5/171 (2%)

Query: 184 FVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN- 242
                      ++ +EA    +   K +     +     ++I   N   +  + +  F  
Sbjct: 19  EEIKSLEGIDVLWLEEAHALTEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVV 76

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
            P ED    +I+      +     + I +    D +       G     +    I  ++I
Sbjct: 77  DPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWI 136

Query: 303 EEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           E A+    + D        +G D+A  G DK   V+R G++I    +W AK
Sbjct: 137 EAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAK 187


>gi|226940459|ref|YP_002795533.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715386|gb|ACO74524.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 272

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 46/116 (39%), Gaps = 2/116 (1%)

Query: 239 DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP 298
                    W   QID+RTVEG +          YG +SD  ++ + G FP      FI 
Sbjct: 5   KCGRRFRHRWVARQIDSRTVEGTNKEQIAKWAEDYGEESDFFKVRVRGMFPSMSARQFIS 64

Query: 299 HNYIEEAMSREAIDD--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
              +  A  R    +   YAP I+  D A EG D+ V+  R+G     +   +   
Sbjct: 65  ETDVSAAYGRALRPEQYQYAPKILTVDPAWEGDDEFVIGLRQGLSFRVLHTMAKND 120


>gi|6467533|gb|AAF13179.1|AF181080_1 putative gene transfer agent large terminase [Rhodobacter
           capsulatus]
          Length = 393

 Score = 88.5 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 79/292 (27%), Gaps = 35/292 (11%)

Query: 83  SAGRGIGKTTLNAWMMLWL------ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +             P   +  +  +  Q+++ +    S  L+  P
Sbjct: 1   MGGRGAGKTRAGAEWVRMQVEGAGPADAGPAHRVALVGETFDQVRDVMIFGESGILACSP 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                E ++                             T                  A +
Sbjct: 61  PDRRPEWEATKRRL------------------VWANGATAQAYSAQEPEALRGPQFDAAW 102

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +     +     +              + + T R  G    I N P      +   
Sbjct: 103 VDELAKWRRAEETWDMLQFALRLG--KHPQQVITTTPRNVGVLKAILNNPST-VVTHAPT 159

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +   F   + +RY     + R E+ G   +           +E    R A    
Sbjct: 160 EANRAYLAESFLAEVQARYAGT-RLGRQELEGVLLEDVEGALWTTAQLEGL--RLASPPA 216

Query: 315 YAPLIMGCDIA---GEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPV 363
              +++  D A   G G D+  +V         + DW A ++++ +  G P 
Sbjct: 217 MDRVVVALDPAVTGGAGSDECGIVVAGAVTRGPVQDWRAFVLEDASVRGRPT 268


>gi|94497317|ref|ZP_01303888.1| hypothetical protein SKA58_07183 [Sphingomonas sp. SKA58]
 gi|94423180|gb|EAT08210.1| hypothetical protein SKA58_07183 [Sphingomonas sp. SKA58]
          Length = 437

 Score = 88.5 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/276 (13%), Positives = 74/276 (26%), Gaps = 23/276 (8%)

Query: 64  VHCHSNVNNSNPTIFKCAIS-AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN 122
                    +    ++  +  AGRG GKT   A  +  +    P   I  +  S  + ++
Sbjct: 37  DFLARPGQRAPAGDWRIWLMMAGRGFGKTRAGAEWVRGIAEADPAARIALVGASLGEARS 96

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            +    S  L++ PH             +                               
Sbjct: 97  VMVEGESGLLAIAPHWARPAYAPALRRLT------------------WPNGAVAMLFGAA 138

Query: 183 TFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN 242
              G         + DE +                       ++ + T R       +  
Sbjct: 139 DPEGLRGPQFSHGWADEIAKWASGEAAWHNLMMGMRLGRDPRVLVTTTPRPVPLVRSLVA 198

Query: 243 IPLEDWKRYQIDTRTVE-GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
              +D    +  T   E  +  GF   + + YG    + R E+ G+  ++          
Sbjct: 199 RDGDDVVVTRGRTADNEANLAPGFVAAMTAGYGGT-RLGRQELDGELIEEVEGALWTRAL 257

Query: 302 IEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF 336
           IE+         +   +++  D  A  GGD   +V 
Sbjct: 258 IEQCRVVHV-PGVLTRVVVAVDPPASVGGDACGIVV 292


>gi|326633035|ref|YP_004306624.1| terminase large subunit [Enterobacteria phage SPC35]
 gi|321272229|gb|ADW80121.1| terminase large subunit [Enterobacteria phage SPC35]
          Length = 438

 Score = 88.5 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 80/278 (28%), Gaps = 41/278 (14%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
           N        F  A  + R +GK+ + A+ + +L    P + ++ +A + + L N  W+++
Sbjct: 47  NALEDPRHRFVTACVS-RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGWSQI 103

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
              +     +   E                   + + +            +         
Sbjct: 104 RGLIKKYGLQTERENAKDK-------------EIELANGSLFKLASAAQADSAV------ 144

Query: 189 NTHGMAVFNDEASGTP---DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
                 +  DEA+ +    D     +     + N         +T R   WF + +    
Sbjct: 145 GRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKAL---FISTPRGGNWFKEFYAYGF 201

Query: 246 ED----WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
           +D    W       R     D    E          +  R E    F   E   F   N 
Sbjct: 202 DDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSK--NYFRQEYEADFSVFEGQIFDTFNA 259

Query: 302 IE-----EAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
           I+     + M     DD     ++G D+     D T V
Sbjct: 260 IDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAV 295


>gi|289581321|ref|YP_003479787.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
 gi|289530874|gb|ADD05225.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
          Length = 602

 Score = 88.5 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/374 (10%), Positives = 92/374 (24%), Gaps = 93/374 (24%)

Query: 38  WGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWM 97
           W                Q +    +  +             +  +    G+GK+ + A +
Sbjct: 27  WLEDAIEDYLGITVTGAQAQICRGIAANE------------RLLVVTANGLGKSYILAAI 74

Query: 98  MLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAEL 157
            +  ++ R        + +E ++K T    V                +    P  + +  
Sbjct: 75  TIVWLTVRYPACSFATSGTERKMKRTYCKPVENLHG----------DARVPLPGEYKSRP 124

Query: 158 LEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG--TPDIINKSILGFF 215
               +  + +H+       S +      G H  +      +EA        +  ++    
Sbjct: 125 ERIEIDGEPEHFFEAA---SPQDAGELEGVHAAY-TLAIIEEADKKDVDAEVLDAMKSLV 180

Query: 216 TELNPNRFWIMTSNTRRLNG----WFYDIFNIPLEDWKRYQIDTRTVEGIDSGF------ 265
           T+       I  +N  +          D  + P   W+  +  +     +          
Sbjct: 181 TDEQDRI--IAIANPPKDETNSIYPILDEQDDPTSKWEVLEFSSFDSHNVQVELGNVDDE 238

Query: 266 ----------HEGIISRYGLDSD------------------------------------- 278
                      +     Y  +                                       
Sbjct: 239 KVDGLASLHKIQDDWEDYNKEPWPGAETARTLSAPKLDADGNPVFSHSDALEDNPEFRTD 298

Query: 279 ---VARIEILGQFPQQ--EVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTV 333
                     G  P      N     + +  A  R+       P   G D+A +GGD+T 
Sbjct: 299 LDQRWYRRRAGIIPPGGASKNRPFTIDDVNAAWGRDWQPV-GRPQATGIDVARDGGDRTP 357

Query: 334 VVFRRGNIIEHIFD 347
           V+   G+++E  ++
Sbjct: 358 VISVDGDVLEVRYE 371


>gi|46401884|ref|YP_006983.1| terminase, large subunit [Enterobacteria phage T5]
 gi|45775062|gb|AAS77194.1| terminase, large subunit [Enterobacteria phage T5]
 gi|59897286|gb|AAX12081.1| ORF144 [Enterobacteria phage T5]
          Length = 438

 Score = 88.5 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 80/278 (28%), Gaps = 41/278 (14%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
           N        F  A  + R +GK+ + A+ + +L    P + ++ +A + + L N  W+++
Sbjct: 47  NALEDPRHRFVTACVS-RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGWSQI 103

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
              +     +   E                   + + +            +         
Sbjct: 104 RGLIKKYGLQTERENAKDK-------------EIELANGSLFKLASAAQADSAV------ 144

Query: 189 NTHGMAVFNDEASGTP---DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
                 +  DEA+ +    D     +     + N         +T R   WF + +    
Sbjct: 145 GRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKAL---FISTPRGGNWFKEFYAYGF 201

Query: 246 ED----WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
           +D    W       R     D    E          +  R E    F   E   F   N 
Sbjct: 202 DDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSK--NYFRQEYEADFSVFEGQIFDTFNA 259

Query: 302 IE-----EAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
           I+     + M     DD     ++G D+     D T V
Sbjct: 260 IDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAV 295


>gi|319789040|ref|YP_004150673.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
 gi|317113542|gb|ADU96032.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
          Length = 419

 Score = 88.1 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 52/319 (16%), Positives = 109/319 (34%), Gaps = 51/319 (15%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIIC 112
            +Q+E ++ +D H  S             I   R  GK+ + ++      +T+P  +I+ 
Sbjct: 6   PYQIEIVKGIDSHKFS------------VIKMARQTGKSFVVSYWATRRATTKPNHAIVV 53

Query: 113 IANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWY--AELLEQSMGIDSKHYT 170
           ++ +E Q K            +   +    ++++ L    ++   EL +  +   +    
Sbjct: 54  VSPTERQSK------------LFVDKVKLHIKAMRLTGVKFFEDTELKKLEVNFPNGSQI 101

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTS 228
           I         P    G     G  V  DE +       + +++    T    +   +  S
Sbjct: 102 IA-------LPANPDGIRGFSGD-VIMDEVAFFKNWQEVYRAVFPIIT-RKKDYKLVAIS 152

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYG--LDSDVARIEILG 286
                N  FY +++I   + K ++      E +  G    +        + D  R E L 
Sbjct: 153 TPFGKNDLFYYLWSISENNPKWFRYSLNIFEAVAKGLKVDVEELRAGIKNEDAWRTEYLV 212

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAID------DLYAPLIMGCDIAGEGGDKTVVVFR--- 337
           +F  +  +  +P+  I++    +         +L   L  G D+     D TV+      
Sbjct: 213 EFIDEA-DAVLPYELIQKCEMPKEELLVEDIKELKGELYCGVDVGRR-KDLTVITLLEKL 270

Query: 338 -RGNIIEHIFDWSAKLIQE 355
                +  I + S K  +E
Sbjct: 271 GDVLYVRRIEELSKKPFRE 289


>gi|167725769|ref|ZP_02409005.1| hypothetical protein BpseD_42528 [Burkholderia pseudomallei DM98]
          Length = 517

 Score = 88.1 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 73/267 (27%), Gaps = 20/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G + L   +   +     G++    +  E         E    +       W   + 
Sbjct: 87  RDMGMSWLTVGLADTVCLFHEGVAAGFGSRKE---------EYVDKIGSPKSLFWKAREF 137

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
           L L P+ +       +     +       +         +G           DE++    
Sbjct: 138 LRLLPAEFRGSWDIGTHAPHMRIIFPDTGSVITGESGDGIG-RGDRASFYVVDESAFLER 196

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
                     T           S    +   F    +      K +    R     D  +
Sbjct: 197 PQLVDASLSATTNCRQD----ISTPNGMGNSFAQRRH--SGKIKVFTFHWRDDPRKDDAW 250

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +   ++    D  V   EI   +        IP  +++ A+        +       G D
Sbjct: 251 YAKQVAEL--DPVVVAQEIDINYAASVEGVVIPSAWVQAALGAHVKLGIEPSGTRRGGLD 308

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G ++EH+  WS 
Sbjct: 309 VADEGKDKNAFAGRYGFLLEHLESWSG 335


>gi|238027169|ref|YP_002911400.1| hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
 gi|237876363|gb|ACR28696.1| Hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
          Length = 531

 Score = 88.1 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 48/368 (13%), Positives = 92/368 (25%), Gaps = 49/368 (13%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGI------------KGKP 44
           P  +   +   + L  +  +   + + + F           WG+               P
Sbjct: 12  PDYVQVFEWRAERLQRIRANPGVLPALRAFYRDNPAQFIIDWGMTFDPRNVERGLPATIP 71

Query: 45  LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST 104
              F +   W       +                K      R +G + L   +   +   
Sbjct: 72  FLLFPKQEDW-------IAWFMERWRAREPGITEKT-----RDMGMSWLTVGLADTICLF 119

Query: 105 RPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGI 164
             G++    +  E         E    +       W   + L L P+ +       +   
Sbjct: 120 HEGVAAGFGSRKE---------EYVDKIGSPKSLFWKAREFLRLLPAEFRGSWDIGTHAP 170

Query: 165 DSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFW 224
             +       +         +G           DE++              T        
Sbjct: 171 HMRIIFPDTGSVITGESGDGIG-RGDRASFYVVDESAFLERPQLVDASLSATTNCRQD-- 227

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
              S    +   F    +      K +    R     D  ++   ++    D  V   EI
Sbjct: 228 --ISTPNGMGNSFAQRRH--SGKIKVFTFHWRDDPRKDDAWYAKQVAEL--DPVVVAQEI 281

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNII 342
              +        IP  +++ A+                G D+A EG DK     R G ++
Sbjct: 282 DINYAASVEGVVIPSAWVQAALGAHVKLGISPSGARRGGLDVADEGKDKNAFAGRYGFLL 341

Query: 343 EHIFDWSA 350
           EH+  WS 
Sbjct: 342 EHLESWSG 349


>gi|18640524|ref|NP_570365.1| DNA packaging protein B [Synechococcus phage P60]
 gi|18478754|gb|AAL73303.1| DNA packaging protein B [Synechococcus phage P60]
          Length = 258

 Score = 88.1 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/271 (15%), Positives = 70/271 (25%), Gaps = 44/271 (16%)

Query: 20  MHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFK 79
           +  +    F+ F+     W     P     +P R QL     +  +             +
Sbjct: 6   LETQIKEDFRVFLTLV--WRELDLP-----KPTRAQL----HIADYLQHGPK-------R 47

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
             ISA RG+GK+ + A  +LW++   P   I+ I+ S+ +  N         L +    H
Sbjct: 48  LQISAFRGVGKSWITAAFVLWVLFNDPDKKIMVISASKERADNFSIFCQKLILDISWLNH 107

Query: 140 WFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPH 188
                S        +     +       K   IT +              E P       
Sbjct: 108 LGPKDSDQRWSRISFDVGPAKPHQAPSVKSVGITGQMTGSRAHLMIFDDVEVPANSATDM 167

Query: 189 NTHGMAVFNDEASGT--------------PDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
               +     EA                 P                   W  T+  + L 
Sbjct: 168 QREKLLQLVTEAESILTPDDDSRILFLGTPQSTFTIYRKLAERSYRPFVWPCTAYPKDLI 227

Query: 235 GWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
                    P    K  + + R     DS F
Sbjct: 228 RLM-RALPSPQHWLKTSRKEWRKDPPTDSRF 257


>gi|304360860|ref|YP_003856980.1| gp8 [Mycobacterium phage CrimD]
 gi|302858609|gb|ADL71354.1| gp8 [Mycobacterium phage CrimD]
          Length = 473

 Score = 87.7 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/351 (12%), Positives = 86/351 (24%), Gaps = 68/351 (19%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            +WQ +  + V      +       +F  +I   R  GKT     ++  L    PG ++I
Sbjct: 43  DQWQDDLGKLVCA--KRSDGLYAADMFAMSI--PRQTGKTYFLGAIVFALCKMTPGTTVI 98

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+       T  +                 Q+L+         L   +          
Sbjct: 99  WTAHRTRTAAETFKSM----------------QALAKREQIAPHILNVHTGNGKEAVLFT 142

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                     +   G        +  DEA    +     ++   T  +PN   +      
Sbjct: 143 NGSRILFGAREKGFGRGFAKVDVLIFDEAQILSENAMDDMVPA-TNASPNGLILFAGTPP 201

Query: 232 RLNGW------------------------FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHE 267
           +                              D  + P E+    +++        +    
Sbjct: 202 KPTDPGEVFTNLRLDAINGESDDVAYVEISADENDDPDEESTWRKMNPSYPHRTSARAIR 261

Query: 268 GIISRYGLDSDVARIEILGQFPQ-QEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAG 326
            +      DS   R E +G + +       I  +   +       +    P  +G D++ 
Sbjct: 262 RMRKALSWDS--FRREAMGIWDKISVHAQVIKPSLWRDLADPLGPEPGAKPASLGVDMSH 319

Query: 327 EGGDKTVV-----VFRRGN--IIEHIFDWSAKLIQ-------ETNQEGCPV 363
            G     +              +E +  W+            E      PV
Sbjct: 320 GG----AISIGGCWLIDDELRHVEQV--WAGTDTAAAVEFIVERAGRRIPV 364


>gi|291334530|gb|ADD94183.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C1201]
 gi|291334650|gb|ADD94297.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C695]
          Length = 223

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/242 (11%), Positives = 63/242 (26%), Gaps = 33/242 (13%)

Query: 102 ISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQS 161
           +          IA +  Q K+  W  + ++   +P                   +  E  
Sbjct: 1   MCPHKNPRFAYIAPTFKQAKSIAWDYMKQFTDKIP-----------------STKFNETE 43

Query: 162 MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNP 220
           + +D           +    +   G    +      DE +     +  + I    +  + 
Sbjct: 44  LRVD----LPNGARITLLGAENSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALS--DR 97

Query: 221 NRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
             + +       +N  FYD++      EDW  Y+      + +D    +      G    
Sbjct: 98  KGYCVFIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASETKIVDQEELDKAKEVMGEKK- 156

Query: 279 VARIEILGQFPQQEVNNFIPHN---YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVV 335
               E    +                 ++        D   P+    D+     D + ++
Sbjct: 157 -YLQEFECDWIANIEGAIYGEEIAKLDDKKQLARVPYDPTLPVSTAWDLGV--ADHSSII 213

Query: 336 FR 337
           F 
Sbjct: 214 FF 215


>gi|260433583|ref|ZP_05787554.1| putative phage terminase, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417411|gb|EEX10670.1| putative phage terminase, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 504

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/336 (12%), Positives = 98/336 (29%), Gaps = 46/336 (13%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMML---WLISTRPGMSIICIANS 116
            +  + +  ++ +        + + GRG GK+TL+A + L       +      I IA  
Sbjct: 27  KLAPYQNKFIDGAYGPGINVGVLSVGRGNGKSTLSAILALGELVGAWSDAKEREILIAAK 86

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
             Q     W  V      LP      +               E     ++  + +   + 
Sbjct: 87  TQQQAQICWHYVVSLSKTLPEDVQAAITIRRQ-------PRFEIQFDDENGPHILRAISA 139

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFTELNPNRFWIMTSNTRR 232
             +          T       DE    P    D +  ++L   ++ +     I TS +  
Sbjct: 140 DGKSAL------GTSPTLAILDERGHWPLAQGDELEAALLTGLSKRDGKALIISTSASND 193

Query: 233 LNGWFYDIFNIPLEDWKRYQIDTR--------------------TVEGIDSGFHEGIISR 272
           ++ +   +       +++                              +     +  ++ 
Sbjct: 194 MHPFSLWLDREAPGVYRQEHRPEPGLPADDVASLIIANPGTKYGIGPSLKRLKDDAALAI 253

Query: 273 YGLDSDVARIEILGQFPQQEVNN---FIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGG 329
               S ++R  +L +  + + +N    I  +   +    +A+     P ++G D+ G   
Sbjct: 254 ERGGSALSRFRLLSRNERVQEDNRDILISLDDWLKC-ETDALPPKSGPCVIGLDLGGSAS 312

Query: 330 DKTVVVFR-RGNIIEHIFDWSAKLIQETNQEGCPVG 364
                 +      +E    + +K   +   +   VG
Sbjct: 313 MSAAAYYWPETGRLECFGTFPSKPDLDARGQSDAVG 348


>gi|182682964|ref|YP_001837088.1| terminase, large subunit [Enterobacteria phage EPS7]
 gi|182630676|gb|ACB97608.1| terminase, large subunit [Enterobacteria phage EPS7]
          Length = 438

 Score = 87.3 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 44/308 (14%), Positives = 86/308 (27%), Gaps = 49/308 (15%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
           N        F  A  + R +GK+ + A+ + +L    P + ++ +A + + L N  W+++
Sbjct: 47  NALEDPRHRFVTACVS-RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGWSQI 103

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
              +     +   E                   + + +            +         
Sbjct: 104 RGLIKKYGLQTERENAKDK-------------EIELANGSLFKLASAAQADSAV------ 144

Query: 189 NTHGMAVFNDEASGTPD----IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
                 +  DEA+   D      +  +     + N         +T R   WF + +   
Sbjct: 145 GRSYDFIIFDEAA-ISDVGGAAFDIQLRPTLDKPNSKAL---FISTPRGGNWFKEFYEKG 200

Query: 245 LED----WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
             +    W       R     D    E          +  R E    F   E   F   N
Sbjct: 201 FNETLPNWVSIHGTYRDNPRADLNDIEEARRTVSK--NYFRQEYEADFSVFEGQIFDTFN 258

Query: 301 YIE-----EAMSREAIDDLYAPLIMGCDIAGEGGDKTVV----VFRRGNIIEHIFDWSA- 350
            IE     + M     DD     ++G D+     D T V         ++   + ++   
Sbjct: 259 AIEHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAVLTIKYHYDTDVYYVLEEYQQA 316

Query: 351 -KLIQETN 357
            K   +  
Sbjct: 317 EKTTAQHA 324


>gi|159897910|ref|YP_001544157.1| hypothetical protein Haur_1384 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890949|gb|ABX04029.1| hypothetical protein Haur_1384 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 477

 Score = 87.3 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 47/366 (12%), Positives = 88/366 (24%), Gaps = 70/366 (19%)

Query: 22  AECVLSFKNFVMRF--FPWGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTI 77
           A+C      F   F                    W  Q++ +  + +             
Sbjct: 8   AKCHADPAYFTHHFGLIDDAQGLGDGSGAMPFTLWPAQVQVLWTLLIQ------------ 55

Query: 78  FKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
               I   R +G + L     LWL   +PG  ++  +  + +    L   V +    LP 
Sbjct: 56  RLVLILKARQLGISWLCCAYALWLCLFQPGKVVLIFSKGQGEADEMLQR-VKRLYERLPE 114

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                        S          +   +     +        P T     +     V  
Sbjct: 115 WMREA--------SPALVTDNTTELEWANGSRVKS-------LPATKGAGRSFTASLVIL 159

Query: 198 DEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF---NIPLEDWKRYQ 252
           DEA+       +  ++             I+ S    +   F+ ++         +    
Sbjct: 160 DEAAFLLWATQLYTALKPTIDGGGQ---LIVLSTANGIGNLFHQLWLKAISAKNRFTTIF 216

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEI---------------------LGQFPQQ 291
           +        D+ ++   +  Y  D D+ R E                      L Q P  
Sbjct: 217 LPWWARPTRDAAWYHNQLEEY-TDPDMVRQEYPSTAQEAFLVSGRTRFKMPWLLKQNPSD 275

Query: 292 E---VNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHI 345
                      + ++               I+  D+A EG   GD            E +
Sbjct: 276 GLALDELPASLSLLDGVTVYHL-PQQGRRYILAADVA-EGLEHGDFCAATLIDAVSWEEM 333

Query: 346 FDWSAK 351
                K
Sbjct: 334 ASVHGK 339


>gi|152990214|ref|YP_001355936.1| phage terminase, large subunit [Nitratiruptor sp. SB155-2]
 gi|151422075|dbj|BAF69579.1| phage terminase, large subunit [Nitratiruptor sp. SB155-2]
          Length = 398

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 73/255 (28%), Gaps = 29/255 (11%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  +K     GRG  K+   A  +L L S +P + I+C    +  + +++   +S  +  
Sbjct: 18  PYRYKV-YYGGRGSAKSYNFALTLLVLASKQP-LRILCAREFQNSISDSVHRLLSDLIDK 75

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
             H   FE+    +      +E + + +  + +    T                      
Sbjct: 76  Y-HLPNFEVTQREIRNKLTGSEFIFKGLRHNIQSIKST-----------------EGVDI 117

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQI 253
            + +EA    +   + ++    +      W+   N   +    Y  F   P  +    ++
Sbjct: 118 CWVEEAQTVSEESWQILIPTIRKPGSE-IWVSF-NPYFVEDPTYQRFVVNPPSNAFVKKV 175

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF----IPHNYIEEAMSRE 309
             +          E +      D +       G+                + I+   S+E
Sbjct: 176 TYKDNPYFPDVLREEMEYDKKTDYERYMHVWEGECITYSDAQVFRDKFAIDTIDVGNSKE 235

Query: 310 AIDDLYAPLIMGCDI 324
                        D 
Sbjct: 236 VYYGADWGF--AVDP 248


>gi|289829424|ref|ZP_06547036.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 346

 Score = 86.9 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 59/161 (36%), Gaps = 5/161 (3%)

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
            ++ +EA    +   K +     +     ++I   N   +  + +  F   P ED    +
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSECWFIF--NPGLVTDFVWRNFVVDPPEDTLIRK 58

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
           I+      +     + I +    D +       G     +    I  ++IE A+    + 
Sbjct: 59  INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 118

Query: 313 D--LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           D        +G D+A  G DK   V+R G++I    +W AK
Sbjct: 119 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAK 159


>gi|119385627|ref|YP_916682.1| hypothetical protein Pden_2902 [Paracoccus denitrificans PD1222]
 gi|119376222|gb|ABL70986.1| protein of unknown function DUF264 [Paracoccus denitrificans
           PD1222]
          Length = 463

 Score = 86.9 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 35/294 (11%), Positives = 78/294 (26%), Gaps = 35/294 (11%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  ++ +  Q ++ +    S  L+ 
Sbjct: 71  VIMGGRGAGKTRAGAEWVRAQVEGATPEAPGRARRVALVSETLDQARDVMVFGESGILAS 130

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                                                A
Sbjct: 131 SPPDRRPVWEAGRRRL------------------VWPNGAVAQLYSAHEPEALRGPQFDA 172

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +          +  ++T+  + +                 + 
Sbjct: 173 AWVDELAKWKKAEECWDMLQFALRLGEHPQ-QVVTTTPKNVA--VLKRLLRQSSTVTTHA 229

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RYG    + R E+ G   +           +E    R    
Sbjct: 230 PTDANRAYLAESFLAEVQARYGGT-RLGRQELEGLLLEDVEGALWSAGLLERC--RVEAA 286

Query: 313 DLYAPLIMGCDIAGEGG---DKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPV 363
              + +++  D A  GG   D+  +V         +  W A ++++ +  G P+
Sbjct: 287 PALSRIVVAVDPAVTGGAAADECGIVVAGVVSEGPVTQWRAYVLEDASVRGGPL 340


>gi|221316961|ref|YP_002533105.1| putative terminase large subunit - phage associated [Bacillus
           cereus Q1]
 gi|221243293|gb|ACM16001.1| putative terminase large subunit - phage associated [Bacillus
           cereus Q1]
          Length = 425

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/268 (13%), Positives = 76/268 (28%), Gaps = 25/268 (9%)

Query: 72  NSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKW 131
               +I K     GRG GK+T  +  ++  +   P ++++CI   +  ++ + + ++ + 
Sbjct: 21  RKCESILKIVCKGGRGSGKSTDISICIVMDLIQFP-ITVLCIRKVKDTIRESCYEQIKEA 79

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           + +L   H F  +   +             +    +   I  R   +      +      
Sbjct: 80  IEILGVEHLFRFKESPM------------EIIYKPRGNKIIFRGADDPAKIKSIKIAKYP 127

Query: 192 GMAVFNDE-ASGTPDIINKSILGFFTE----LNPNRFWIMTSNTR-RLNGWFYDIFNIPL 245
               + +E A    +    +I                   + N   R   W    F    
Sbjct: 128 VAIAWFEELAEFKLEEDVSTIEKSILRKELPNGLRYKMYYSYNPPKRKQSWVNKKFETQF 187

Query: 246 EDWKRY--QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
           +    +           I   F E       L       E  G+ P       +P + + 
Sbjct: 188 KPKNTFVHHSTYHDNPHISKQFVEEAEETKRLKPQQYEHEYEGK-PTGSG--VVPFSNLT 244

Query: 304 EAMSREAIDDLYAPLIMGCDIAGEGGDK 331
                +     +  +  G D  G G D 
Sbjct: 245 FRRITDEEIKTFDNIRQGID-WGYGNDA 271


>gi|72384687|gb|AAZ67635.1| phage terminase large subunit-like protein [Haemophilus parasuis
           29755]
          Length = 405

 Score = 86.5 bits (212), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 71/275 (25%), Gaps = 38/275 (13%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M   +   R        I+C       L+++   E+ + +       
Sbjct: 27  GGRGSAKTRTFAKMTAVVAYQRAMQGESGVILCGREFMNSLEDSSLEEIKQAIQ------ 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  E                ++  R +          +  + DE
Sbjct: 81  ----------SEPWLTDFFEVGEKYVRTKCGRISYIFTGLRHNLDSIKSKARILLAWIDE 130

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY-QIDTRTV 258
           A    ++  + +L    E      W+   N  +        F    ++     +++    
Sbjct: 131 AESVSEMAWRKLLPTVRENGSE-IWLTW-NPEKKGSATDLRFRQHQDESMAIVEMNYSDN 188

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  +      D    R    G + ++         Y E  +  + + D   P
Sbjct: 189 PWFPDVLEQERLRDKARLDDATYRWIWEGDYLEESEAQVFRGKYQE--LEFKPLPDFEGP 246

Query: 318 LIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKL 352
              G D  G   D T            I  W  K 
Sbjct: 247 YH-GLDF-GFAQDPTAA----------IKCWVFKD 269


>gi|154247076|ref|YP_001418034.1| hypothetical protein Xaut_3147 [Xanthobacter autotrophicus Py2]
 gi|154161161|gb|ABS68377.1| protein of unknown function DUF264 [Xanthobacter autotrophicus Py2]
          Length = 416

 Score = 86.5 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/264 (13%), Positives = 67/264 (25%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +  L   RP         I  +A +   ++  +   VS  L++ 
Sbjct: 31  VLGGRGAGKTRAGAEWVRGLALGRPPFAGRPVGRIALVAETMADVREVMVEGVSGLLAVH 90

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P       +                                     +           A 
Sbjct: 91  PRAERPRWEPTRRRLE------------------WANGAVAQGFSAEDPESLRGPQFAAA 132

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +          R  +    T R       +   P       + 
Sbjct: 133 WLDELAKWKRAEATFDMLQFGLRLGAQPRQMVT--TTPRPTALLRRLLADPS--TAVTRA 188

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
            T       +    G +      + + R E+ G+  +   +       +E    REA   
Sbjct: 189 RTADNAFHLAPSFLGQVLTRYGGTRLGRQELDGELIEDRADALFSRPALEAL--REAQVP 246

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
               +++  D    +  G D   +
Sbjct: 247 PLTRIVVAVDPPASSRAGADACGI 270


>gi|330810733|ref|YP_004355195.1| phage terminase protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378841|gb|AEA70191.1| Putative phage terminase protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 439

 Score = 86.5 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 39/293 (13%), Positives = 70/293 (23%), Gaps = 47/293 (16%)

Query: 77  IFKCAISAGRGIGKTTL-------NAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVS 129
            F+ A+  GR  GKT L        A +      +     I   A ++ Q +   W  + 
Sbjct: 31  RFRDAVC-GRRFGKTFLGKAEMRRAAKLAAAWNVSVEDE-IWYAAPTQKQARRVFWRRLK 88

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
           + +                       +  E  M I  K              + +     
Sbjct: 89  QAIPKSWL----------------VTKPNETDMLITLKS----GHLLRCVGLENYDDLRG 128

Query: 190 THGMAVFNDEASGTPDIIN-KSILGFFT--------ELNPNRFWIMTSNTRRLNGWFYDI 240
           +    +  DE +        + I    +                 +   T +     YD 
Sbjct: 129 SGLFFILVDEWADCKYAAWEEVIRPMLSTCTYTLPNGEVRKGGHALRIGTPKGFNHCYDT 188

Query: 241 FNIPLEDWKRYQIDT----RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F       +               +     E    +   D    R E    F   +   +
Sbjct: 189 FQDGKPGHEPDHRSWLYTSLDGGNVPPEEIEAARRKM--DPRTFRQEYEASFENYQGVVY 246

Query: 297 IPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS 349
              N   EA            L +G D         VV   R ++   + ++S
Sbjct: 247 YTFN--REANRTSETIKRGEALHIGMDFNVM-KMAAVVHVIRDDLPLALSEFS 296


>gi|51512091|gb|AAU05290.1| terminase large subunit [Enterobacteria phage T5]
          Length = 438

 Score = 86.5 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 79/278 (28%), Gaps = 41/278 (14%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
           N        F  A  + R +GK+ + A+ + +L    P + ++ +A + + L N  W+++
Sbjct: 47  NALEDPRHRFVTACVS-RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGWSQI 103

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
              +     +   E                   + + +            +         
Sbjct: 104 RGLIKKYGLQTERENAKDK-------------EIELANGSLFKLASAAQADSAV------ 144

Query: 189 NTHGMAVFNDEASGTP---DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL 245
                 +  DEA+ +    D     +     + N         +T R   WF + +    
Sbjct: 145 GRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKAL---FISTPRGGNWFKEFYAYGF 201

Query: 246 ED----WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
           +D    W       R     D    E          +  R E    F   E   F   N 
Sbjct: 202 DDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSK--NYFRQEYEADFSVFEGQIFDTFNA 259

Query: 302 IE-----EAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
            +     + M     DD     ++G D+     D T V
Sbjct: 260 TDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAV 295


>gi|332185581|ref|ZP_08387329.1| terminase-like family protein [Sphingomonas sp. S17]
 gi|332014559|gb|EGI56616.1| terminase-like family protein [Sphingomonas sp. S17]
          Length = 436

 Score = 86.5 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 80/280 (28%), Gaps = 25/280 (8%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIAN 115
            E +E  ++  H              I AGRG GKT   A  +  L    PG  I  +  
Sbjct: 34  RELVERWELWAHDGQVAPPGDWRVWLIRAGRGFGKTRAGAEWVSALARDNPGARIALMGA 93

Query: 116 SETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRT 175
           +   ++  +    S  L++       +                   +G   + +  +   
Sbjct: 94  TLRDVERVMVRGESGLLAVARKGEAPKW------------------IGSLGQVHFTSGAI 135

Query: 176 YSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
                             A + DE                T        ++ + T R   
Sbjct: 136 GFAYSAAAPEALRGPQHHAAWCDELGKWKGEA-GWDNLMMTLRLGEHPRVLVTTTPRATP 194

Query: 236 WFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNN 295
               +  +P +  +     +     +   F + ++S+YG D+ + R E+ G+        
Sbjct: 195 LMRKVMALP-DCVETIGRTS-DNAHLPDSFQDAMLSQYG-DTRLGRQELDGEMVDDREGA 251

Query: 296 FIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVV 334
                 ++    R         +++G D  A   GD   +
Sbjct: 252 LWTRALLDR--QRVKTVPALDRVVVGVDPPATSSGDACGI 289


>gi|260433350|ref|ZP_05787321.1| phage DNA Packaging Protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417178|gb|EEX10437.1| phage DNA Packaging Protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 427

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 78/296 (26%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +  ++             +  +  +  Q+++ +    S  +  
Sbjct: 34  VIMGGRGAGKTRAGAEWVRSMVEGAKPFDEGEARRVALVGETFDQVRDVMIFGDSGIMQC 93

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                                        G       A
Sbjct: 94  SPPDRRPQWKASERKL------------------VWPNGAEAQAFSAHDPEGLRGPQFDA 135

Query: 195 VFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          R  +    T R      D+   P      + 
Sbjct: 136 AWVDELAKWKKAGETWDMLQFALRLGERPRVCVT--TTPRNVKVLKDLLAAPST-VMTHA 192

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F + + +RY     + R E+ G             + ++ A  R    
Sbjct: 193 PTEANRANLAESFLQEVRARYAGT-RLGRQELDGVLLADAEGALWTGSMLDGA--RVGAV 249

Query: 313 DLYAPLIMGCDIA---GEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC-PVG 364
                +++  D A   G G D   +V     +     DW A ++ +   +G  P G
Sbjct: 250 PELDRVVVALDPAVTGGSGADACGIVVVGAQLQGPPEDWRAYVLADRTVQGVGPAG 305


>gi|121602586|ref|YP_988560.1| PBSX family phage terminase large subunit [Bartonella bacilliformis
           KC583]
 gi|120614763|gb|ABM45364.1| putative phage terminase, large subunit, PBSX family [Bartonella
           bacilliformis KC583]
          Length = 402

 Score = 86.2 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 32/261 (12%), Positives = 69/261 (26%), Gaps = 30/261 (11%)

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I+C    +  L  +   E+ + +   P                +Y    +     D +  
Sbjct: 18  ILCARQFQNSLNESSLEEIKRAIEAYP------------FLRDYYDVGDKYVKSKDGRIL 65

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP---NRFWIM 226
                          +G      +  + DEA    +   ++++    E      +  W+ 
Sbjct: 66  YTFAGLDRNISSIKSMG----RILLCWVDEAEPVTETAWQTLIPTLREEGQDWHSELWVT 121

Query: 227 TSNTRRLNGWFYDIFNIPLE-DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
             N  R N      F +  + + K  +I+ R         +   ++      +       
Sbjct: 122 W-NPLRENAPVEKRFRLTKDPNIKGVEINWRDNPQFPDKLNRDRLADLHQRPEQYGHIWE 180

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI---MGCDIAGEG--GDKTVVVFRRGN 340
           G + Q     +     ++             PLI   +  DI G G   D T +   +  
Sbjct: 181 GDYLQAVQGAYYQKLLLDAEQEGRIAHVSRDPLIQIKIFWDIGGTGAKADATALWVAQ-- 238

Query: 341 IIEHIFDWSAKLIQETNQEGC 361
                 +       E   +  
Sbjct: 239 --FIGREIRILDYYEAQGQPL 257


>gi|46143644|ref|ZP_00204538.1| COG1783: Phage terminase large subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 407

 Score = 85.8 bits (210), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 73/273 (26%), Gaps = 32/273 (11%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWL 132
            ++CA   GRG  KT   A M       R        I+C       L+ +   EV + +
Sbjct: 21  RYRCAY-GGRGSAKTRTFALMTAVWALRRDQAGDSGVILCAREYMNSLEESSLEEVKQAI 79

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
                             + W                      ++  R +          
Sbjct: 80  R----------------STSWLEPHFVIGEKFIKTKSGRISYVFAGLRHNLDSIKSKARI 123

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL-EDWKRY 251
           +  + +EA    ++  + +     E N    W+   N  +        F   + E+ K  
Sbjct: 124 LLAWVEEAETVSEVAWQKLEPTVREHNSE-IWVTW-NPEKRGSATDLRFRQHVPENAKII 181

Query: 252 QIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
           +++            +  ++     D    R    G + +Q         Y E  +  E 
Sbjct: 182 EMNYSDNPWFPKELEQTRLADKARLDDATYRWIWEGAYLEQSEAQIFRDKYQE--LEFEP 239

Query: 311 IDDLYAPLIMGCDIAGEGGDKTVV---VFRRGN 340
             D   P   G D  G   D T         G+
Sbjct: 240 NPDFDGPYH-GLDF-GFANDPTAAIKCWVFDGD 270


>gi|86750583|ref|YP_487079.1| hypothetical protein RPB_3472 [Rhodopseudomonas palustris HaA2]
 gi|86573611|gb|ABD08168.1| Protein of unknown function DUF264 [Rhodopseudomonas palustris
           HaA2]
          Length = 431

 Score = 85.8 bits (210), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 73/292 (25%), Gaps = 36/292 (12%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAIS-AGRGIGKTTLNAWMMLWLIS------TRPG 107
           Q +F      H       +N   +   +   GRG GKT   A  +  L         RP 
Sbjct: 18  QHDFATFAHPHQEHGEAGNNGGPWTTWLLLGGRGAGKTRTGAEWVRALAHGTPPYAERPH 77

Query: 108 MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSK 167
             I  I  S    +  +    S  L   P     E  +                      
Sbjct: 78  RRIALIGESWQDAREVMVEGESGLLRCSPRAERPEWIASRRRLE---------------- 121

Query: 168 HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWI 225
                         D           A + DE +     +    ++          R  +
Sbjct: 122 --WRNGAVGQVFSADDPESLRGPQFDAAWCDELAKWRYAEACFDTLQFGLRLGLQPRQLV 179

Query: 226 MTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
               T R       +   P              + +   F + ++ RY     + R E+ 
Sbjct: 180 T--TTPRPLPLIKRLLADPRTR-VTRAPTKANADHLSPAFLDAVVGRYAGT-RMGRQELD 235

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE---GGDKTVV 334
           G+  +   +       IE    R A     A +++  D  G    G D   +
Sbjct: 236 GEMIEDRADALWSRALIESC--RVAQPPGLARVVVAIDPPGTSKVGADACGI 285


>gi|49476071|ref|YP_034112.1| phage related protein [Bartonella henselae str. Houston-1]
 gi|49238879|emb|CAF28172.1| phage related protein [Bartonella henselae str. Houston-1]
          Length = 402

 Score = 85.8 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/261 (11%), Positives = 65/261 (24%), Gaps = 30/261 (11%)

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I+C    +  L  +   E+ + +   P                +Y    +     D +  
Sbjct: 18  ILCARQFQNSLNESSLEEIKRAIESYP------------FLQDYYEIGDKYIKSKDGRIV 65

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPN---RFWIM 226
            +          +             + DEA    +   ++++    E   +     W+ 
Sbjct: 66  YVFAGLDR----NIASIKSMGRVFLCWVDEAEPVTETAWQTLIPTLREEGNDWNAELWVT 121

Query: 227 TSNTRRLNGWFYDIFNIPLEDW-KRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
             N  R N      F        K  +I  R         +    +      +       
Sbjct: 122 W-NPCRENAPVEKRFRNVNNPHIKGAEITWRDNPQFPEKLNRDRKADLEQRPEHYNHIWE 180

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI---MGCDIAGEG--GDKTVVVFRRGN 340
           G++ Q     +     +E +           PL+   +  DI G G   D T +   +  
Sbjct: 181 GEYLQTVEGAYYQKALLEASREGRITTVPRDPLMQIRIFWDIGGTGAKADATALWVAQ-- 238

Query: 341 IIEHIFDWSAKLIQETNQEGC 361
                 +       E   +  
Sbjct: 239 --FVGREIRVLDYYEAQGQPL 257


>gi|254362872|ref|ZP_04978947.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           PHL213]
 gi|153094509|gb|EDN75343.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           PHL213]
          Length = 410

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 71/256 (27%), Gaps = 28/256 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M       R        I+C       L+ +   EV + +   P   
Sbjct: 26  GGRGSGKTRAFAKMSAVSAYKRAMRGESGVILCGREFMNSLEESSLEEVKQAIKSEP--- 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      + ++    +     D +   +    +S  R +          +  + DE
Sbjct: 83  ---------FLANFFDVGEKYVRTKDGRISYV----FSGLRHNLDSIKSKARILIAWIDE 129

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQIDTRTV 258
           A    +   + ++    E N    W+   N           F   P E+    ++  +  
Sbjct: 130 AETVSETAWRKLIPTVRENNSE-IWVTW-NPENRGSATDTRFRQNPPENSCIIEMSYQDN 187

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +          Y E  +  +   D   P
Sbjct: 188 PWFPDVLEQERLNDKQRLDDATYRWIWEGDYLESSDAQIFRDKYQE--LEFKPNPDFNGP 245

Query: 318 LIMGCDIAGEGGDKTV 333
              G D  G   D T 
Sbjct: 246 YY-GLDF-GFANDPTA 259


>gi|171914351|ref|ZP_02929821.1| hypothetical protein VspiD_24270 [Verrucomicrobium spinosum DSM
           4136]
          Length = 450

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/282 (15%), Positives = 82/282 (29%), Gaps = 32/282 (11%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
            + + FK  + + R  GK   +A  ++     R   + +  A SE Q   TL    S+W 
Sbjct: 17  DDESRFKYGLWS-RQTGKDFSSAAEIVRDCKLRDKTTWMIAAPSERQSLETLAKC-SEWS 74

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
                      + +     G  A L +  +   +    I         P           
Sbjct: 75  EAF----DLASEGIREERDGPEALLKQGEIKFANGSRVIA-------VPGRPDTVRGFSA 123

Query: 193 MAVFNDEASG--TPDIINKSILGFFTEL--NPNRFWIMTSNTRRLNGWFYDIF---NIPL 245
             V   E +    PD   ++IL   T       +   + +         +D++   N   
Sbjct: 124 N-VLMTEFAFFEDPDATWRAILPSITNPLRGGEKKVRLITTPNGQGNKAHDLWTKENSTK 182

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI--- 302
             W ++++                +     D +    E   +F        + +  I   
Sbjct: 183 HKWSKHKVTIHDAVAAGLPVDPEELRAMLDDPEGWAQEYECEFLDAA-GVLLSYELIGSC 241

Query: 303 EEAMSREAIDDLYA------PLIMGCDIAGEGGDKTVVVFRR 338
           E   +     D +       PL  G D A +  D +V+   +
Sbjct: 242 EAPEATTTQPDAFWAARPQFPLYAGWDFARK-KDLSVLWTAQ 282


>gi|49474625|ref|YP_032667.1| phage related protein [Bartonella quintana str. Toulouse]
 gi|49240129|emb|CAF26575.1| phage related protein [Bartonella quintana str. Toulouse]
          Length = 402

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/261 (11%), Positives = 66/261 (25%), Gaps = 30/261 (11%)

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I+C    +  L  +   E+ + + + P                +Y    +     D +  
Sbjct: 18  ILCARQFQNSLNESSLEEIKRAIEVYP------------FLQDYYEIGDKYIKSKDGRII 65

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPN---RFWIM 226
            +          +             + DEA    +   ++++    E   +     W+ 
Sbjct: 66  YVFAGLDR----NIASIKSMGRVFLCWVDEAEPVTETAWQTLIPTLREEGKDWNAELWVT 121

Query: 227 TSNTRRLNGWFYDIFNIPLE-DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
             N  R N      F      + K  +I+ R         +    +      +       
Sbjct: 122 W-NPCRENAPVEKRFRNVENPNIKGAEINWRDNPLFPQKLNRDRKADLQQRPENYNHIWE 180

Query: 286 GQFPQQEVNNFIPHNYIEE---AMSREAIDDLYAPLIMGCDIAGEG--GDKTVVVFRRGN 340
           G++ Q     +     +E            D    + +  DI G G   D T +   +  
Sbjct: 181 GEYLQSVQGAYYQKALLEAELEGRITNVPRDPLMQIKIFWDIGGTGAKADATALWVAQ-- 238

Query: 341 IIEHIFDWSAKLIQETNQEGC 361
                 +       E   +  
Sbjct: 239 --FIGREIRVLDYYEAQGQPL 257


>gi|89071120|ref|ZP_01158320.1| Putative large terminase [Oceanicola granulosus HTCC2516]
 gi|89043331|gb|EAR49553.1| Putative large terminase [Oceanicola granulosus HTCC2516]
          Length = 444

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/264 (14%), Positives = 70/264 (26%), Gaps = 32/264 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLIS----TRPGM--SIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +     T PG    +  +  +  Q +  +    S  L+ 
Sbjct: 57  VILGGRGAGKTRAGAEWVRAQVEGPRATDPGRARRVALVGETIDQAREVMVFGDSGLLAC 116

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E  +                                                A
Sbjct: 117 APPDRRPEWIAGRRLL------------------VWPNGAQAQLFSAHDPEALRGPQFDA 158

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +       +  R  +    T R       +        + + 
Sbjct: 159 AWVDELAKWKKAEEAWDMLQLALRLGDDPRCCVT--TTPRPTALMRALLERD-GTARTHA 215

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   +  RY   S + R E+ G    +          I  A + + + 
Sbjct: 216 PTEANAANLARAFLAEVRRRYAG-SPLGRQELDGVMLSEIEGALWSAGAI-AAANCDVVP 273

Query: 313 DLYAPLIMGCDIAGEGGDKTVVVF 336
           DL+  +++  D +  GGD   +V 
Sbjct: 274 DLH-RVVVAVDPSAGGGDVCGIVV 296


>gi|171915351|ref|ZP_02930821.1| hypothetical protein VspiD_29290 [Verrucomicrobium spinosum DSM
           4136]
          Length = 451

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/282 (15%), Positives = 83/282 (29%), Gaps = 32/282 (11%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
            + + FK  + + R  GK   +A  ++     R   + +  A SE Q   TL     +W 
Sbjct: 18  DDESRFKYGLWS-RQTGKDFSSAAEIVRDCKLRDKTTWMIAAPSERQSLETLAKC-GEWS 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
                      + +     G  A L +  +   +    I         P           
Sbjct: 76  EAF----DLASEGIREERDGPEALLKQGEIKFANGSRVIA-------VPGRPDTVRGFSA 124

Query: 193 MAVFNDEASG--TPDIINKSILGFFTEL--NPNRFWIMTSNTRRLNGWFYDIF---NIPL 245
             V   E +    PD   ++IL   T       +   + +         +D++   N   
Sbjct: 125 N-VLMTEFAFFEDPDATWRAILPSITNPLRGGEKKVRLITTPNGQGNKAHDLWTKENSTK 183

Query: 246 EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI--- 302
             W ++++                +     D +    E   +F        +P+  I   
Sbjct: 184 HKWSKHKVTIHDAVAAGLPVDPEELRAMLDDPEGWAQEYECEFLDSA-GVLLPYELIATC 242

Query: 303 EEAMSREAIDDLYA------PLIMGCDIAGEGGDKTVVVFRR 338
           E A +     D +       PL  G D A +  D +V+   +
Sbjct: 243 EAAEATTTQADAFWNARQQFPLYAGWDFARK-KDLSVLWTAQ 283


>gi|37527280|ref|NP_930624.1| hypothetical protein plu3406 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786714|emb|CAE15780.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 418

 Score = 85.4 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/266 (13%), Positives = 77/266 (28%), Gaps = 30/266 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
            GRG GK+   A  ++ L+     M+I+C    +  + +++ A +   +  L   H++++
Sbjct: 28  GGRGGGKSVEIARALV-LLGAIEPMTILCAREFQNSINDSVLALLEAQIIDLGLSHFYKV 86

Query: 144 QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT 203
           ++                +   +                +    H       + +EA   
Sbjct: 87  KNN--------------EIEGQNGTRFTFKGL--RNNIQSIKSMHG--IKICWVEEAQTV 128

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDW-----KRYQIDTRTV 258
                  +       N +  W+   N R      Y +     ED         +++    
Sbjct: 129 SQDSWDILGPTVR-ANKSEVWVSF-NPREEEDPTYKLMTRHQEDPSDGGVIIRKVNYCDN 186

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPL 318
                   + +     +D +      LG              Y  EA S + +      L
Sbjct: 187 AFFPDVLRQEMEYCKRIDYEAYEHIWLGLPKALSEAVIFSGKYRVEAFS-DELWLEADRL 245

Query: 319 IMGCDIAGEGGDKTVV--VFRRGNII 342
             G D  G   D + +   F  G  +
Sbjct: 246 FYGADF-GFANDPSTLVRCFIIGTKL 270


>gi|261495269|ref|ZP_05991723.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309094|gb|EEY10343.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
          Length = 406

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 77/292 (26%), Gaps = 35/292 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M       R        I+C       L+ +   EV + +   P   
Sbjct: 26  GGRGSGKTRAFAKMSAVSAYKRAMQGESGVILCGREFMNSLEESSLEEVKQAIKSEP--- 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      + ++    +     D +   +    +S  R +          +  + DE
Sbjct: 83  ---------FLANFFDVGEKYVRTKDGRISYV----FSGLRHNLDSIKSKARILIAWIDE 129

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQIDTRTV 258
           A    +   + ++    E N    W+   N           F   P E+    ++  +  
Sbjct: 130 AETVSETAWRKLIPTVRENNSE-IWVTW-NPENRGSATDTRFRQNPPENSCIIEMSYQDN 187

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +          Y E  M      D   P
Sbjct: 188 PWFPDVLEQERLNDKQRLDDATYRWIWEGAYLEASEAQIFRGKYQE--MEFVPNPDFDGP 245

Query: 318 LIMGCDIAGEGGDKTVV---VFRRGNIIEHIFDWS----AKLIQETNQEGCP 362
              G D  G   D T         G++                 +   +G P
Sbjct: 246 YY-GLDF-GFAQDPTAAVKCWVFNGDLYIEFEAGKVGLELDDTADFIAKGVP 295


>gi|317120885|ref|YP_004100888.1| hypothetical protein Tmar_0036 [Thermaerobacter marianensis DSM
           12885]
 gi|315590865|gb|ADU50161.1| hypothetical protein Tmar_0036 [Thermaerobacter marianensis DSM
           12885]
          Length = 410

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/287 (16%), Positives = 84/287 (29%), Gaps = 31/287 (10%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIA 114
            E +                  ++   I AGRG GKT   A  +   +       I  + 
Sbjct: 9   AEALLYDWRFWARPKQLPPEGPWRIWLILAGRGFGKTRTGAEWVREQVERHGRRRIAIVG 68

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
            +   +++ +    S  LS+ P       +      +                       
Sbjct: 69  RTAADVRDVMVEGESGILSISPPWFRPVYEPSKRRLT------------------WPNGA 110

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRR 232
             +    D           A + DE +    P+  +  + G     +P    ++ + T R
Sbjct: 111 IATLYSADEPDLLRGPQHDAAWADELAAWRRPEAWDNLMFGLRLGPDPR---VVVTTTPR 167

Query: 233 LNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
                 D+ N P                +   F E IISRY   + + R E+ G+     
Sbjct: 168 PVKLIRDLLNDPT-CVVTRGSTYENAANLAPAFLEQIISRY-EGTRLGRQELYGEVLDDV 225

Query: 293 VNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE---GGDKTVVVF 336
                    I+E   REA       +++  D A     G D+T +V 
Sbjct: 226 PGALWQRKRIDELRVREAP--ELVRVVVAIDPAVTSEEGSDETGIVV 270


>gi|149203834|ref|ZP_01880803.1| Putative large terminase [Roseovarius sp. TM1035]
 gi|149142951|gb|EDM30993.1| Putative large terminase [Roseovarius sp. TM1035]
          Length = 419

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/312 (12%), Positives = 78/312 (25%), Gaps = 36/312 (11%)

Query: 58  FMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPG------MSI 110
            +  +               ++  +   GRG GKT   A  +   +             I
Sbjct: 2   ALPYLFEFWALPHQLPPSGDWRTWVIMGGRGAGKTRAGAEWVRSEVEGARPMDSGRCKRI 61

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
             +  +  Q++  +    S  L+  P     E Q+                         
Sbjct: 62  ALVGETIDQVREVMIFGESGILACSPPDRRPEWQATRKRL------------------IW 103

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTS 228
                          G         + DE +           +          R  +   
Sbjct: 104 PNGAVAQAFSAHDPEGLRGPQFDGAWVDELAKWKRARETWDMLQFGLRLGEAPRVCVT-- 161

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
            T R  G   DI   P                +   F + + +RY     + R E+ G  
Sbjct: 162 TTPRNVGVLKDILATPST-VTSSAPTEANRAHLAESFLDEVRARYAGT-RLGRQELDGLL 219

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHI 345
             +  +       +E A  R      +  +++  D    G    D+  ++         +
Sbjct: 220 IDEAEDALWSPAMLEAA--RVDTLPEFDRVVVAVDPPVSGHAASDECGIIVVGAITRGPV 277

Query: 346 FDWSAKLIQETN 357
            DW A ++ + +
Sbjct: 278 QDWRAYVLADAS 289


>gi|85702762|ref|ZP_01033866.1| Putative large terminase [Roseovarius sp. 217]
 gi|85671690|gb|EAQ26547.1| Putative large terminase [Roseovarius sp. 217]
          Length = 419

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/280 (12%), Positives = 70/280 (25%), Gaps = 35/280 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             I  +  +  Q++  +    S  ++ 
Sbjct: 26  VIMGGRGAGKTRAGAEWVRAQVEGSRPLDEGRCKRIALVGETIDQVREVMVFGESGIMAC 85

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + Q+                                                 
Sbjct: 86  SPPDRRPDWQATRKRL------------------IWPNGAVAQAYSAHDPEALRGPQFDG 127

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  R  +    T R  G   DI  +P        
Sbjct: 128 AWVDELAKWKRARETWDMLQFGLRLGDAPRVCVT--TTPRNVGVLKDIVAVPST-VVTSA 184

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F + + +RY     + R E+ G    +  +       +E A  R    
Sbjct: 185 PTEANRAYLAESFLDEVRARYAGT-RLGRQELDGLLIDEAEDALWTPAMLEAA--RVESL 241

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWS 349
             +  +++  D       G D+  ++         + DW 
Sbjct: 242 PEFDRVVVAVDPPVTGHAGSDECGIIMAGAITRGPVQDWR 281


>gi|307263070|ref|ZP_07544692.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306871696|gb|EFN03418.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 407

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 69/266 (25%), Gaps = 31/266 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M       R        I+C       L+ +   EV + +       
Sbjct: 27  GGRGSAKTRTFALMTAVWALRRDQAGDSGVILCAREYMNSLEESSLEEVKQAIR------ 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      + W                      ++  R +          +  + +E
Sbjct: 81  ----------STSWLEPHFVIGEKFIKTKSGRISYVFAGLRHNLDSIKSKARILLAWVEE 130

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL-EDWKRYQIDTRTV 258
           A    ++  + +     E N    W+   N  +        F   + E+ K  +++    
Sbjct: 131 AETVSEVAWQKLEPTVREHNSE-IWVTW-NPEKRGSATDLRFRRHVPENAKIIEMNYSDN 188

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +Q         Y E  +  E   D   P
Sbjct: 189 PWFPKELEQTRLADKARLDDATYRWIWEGAYLEQSEAQIFRDKYQE--LEFEPNPDFDGP 246

Query: 318 LIMGCDIAGEGGDKTVV---VFRRGN 340
              G D  G   D T         G+
Sbjct: 247 YH-GLDF-GFANDPTAAIKCWVFDGD 270


>gi|84687436|ref|ZP_01015314.1| Putative large terminase [Maritimibacter alkaliphilus HTCC2654]
 gi|84664594|gb|EAQ11080.1| Putative large terminase [Rhodobacterales bacterium HTCC2654]
          Length = 426

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/291 (13%), Positives = 77/291 (26%), Gaps = 36/291 (12%)

Query: 58  FMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPG------MSI 110
            +  V      +        ++  +   GRG GKT   A  +   +             +
Sbjct: 8   ALPYVFEFWALDHQLPPEGDWRTWVILGGRGAGKTRAGAEWVRAQVEGPAPLSPGRAGRV 67

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
             I  +  Q+++ +    S  ++  P       ++                         
Sbjct: 68  ALIGETFDQVRDVMVFGDSGIVACAPPDRRPAWEATKRRL------------------VW 109

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTS 228
               T +        G       A + DE +     D     +       +  R  ++T+
Sbjct: 110 PNGATATSFSASEPEGLRGPQFDAAWADELAKWKKVDDAWDMLQFALRLGDHPR-QVVTT 168

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
             R +                 +   T     +   F E I +RYG    + R E+ G  
Sbjct: 169 TPRDV--PILRRLLTLSSTVTTHAPTTANRANLAKSFLEEIEARYGGT-RLGRQELEGVL 225

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
                  F     +E+   R       + +++  D       G D+  +V 
Sbjct: 226 LDDREGAFWSTAMLEDC--RIDGPPPLSRIVVAVDPPVTGHAGSDECGIVV 274


>gi|307252059|ref|ZP_07533958.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306860359|gb|EFM92373.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 407

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 69/266 (25%), Gaps = 31/266 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M       R        I+C       L+ +   EV + +       
Sbjct: 27  GGRGSAKTRTFALMTAVWALRRDQAGDSGVILCAREYMNSLEESSLEEVKQAIR------ 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      + W                      ++  R +          +  + +E
Sbjct: 81  ----------STSWLEPHFVIGEKFIKTKSGRISYVFAGLRHNLDSIKSKARILLAWVEE 130

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL-EDWKRYQIDTRTV 258
           A    ++  + +     E N    W+   N  +        F   + E+ K  +++    
Sbjct: 131 AETVSEVAWQKLEPTVREHNSE-IWVTW-NPEKRGSATDLRFRRHVPENAKIIEMNYSDN 188

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +Q         Y E  +  E   D   P
Sbjct: 189 PWFPKELEQTRLADKARLDDATYRWIWEGAYLEQSEAQIFRDKYQE--LEFEPNPDFDGP 246

Query: 318 LIMGCDIAGEGGDKTVV---VFRRGN 340
              G D  G   D T         G+
Sbjct: 247 YY-GLDF-GFANDPTAAIKCWVFDGD 270


>gi|303251622|ref|ZP_07337796.1| hypothetical protein APP6_0825 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302649620|gb|EFL79802.1| hypothetical protein APP6_0825 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 409

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 69/266 (25%), Gaps = 31/266 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M       R        I+C       L+ +   EV + +       
Sbjct: 29  GGRGSAKTRTFALMTAVWALRRDQAGDSGVILCAREYMNSLEESSLEEVKQAIR------ 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                      + W                      ++  R +          +  + +E
Sbjct: 83  ----------STSWLEPHFVIGEKFIKTKSGRISYVFAGLRHNLDSIKSKARILLAWVEE 132

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL-EDWKRYQIDTRTV 258
           A    ++  + +     E N    W+   N  +        F   + E+ K  +++    
Sbjct: 133 AETVSEVAWQKLEPTVREHNSE-IWVTW-NPEKRGSATDLRFRRHVPENAKIIEMNYSDN 190

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +Q         Y E  +  E   D   P
Sbjct: 191 PWFPKELEQTRLADKARLDDATYRWIWEGAYLEQSEAQIFRDKYQE--LEFEPNPDFDGP 248

Query: 318 LIMGCDIAGEGGDKTVV---VFRRGN 340
              G D  G   D T         G+
Sbjct: 249 YY-GLDF-GFANDPTAAIKCWVFDGD 272


>gi|83943081|ref|ZP_00955541.1| hypothetical protein EE36_12908 [Sulfitobacter sp. EE-36]
 gi|83846089|gb|EAP83966.1| hypothetical protein EE36_12908 [Sulfitobacter sp. EE-36]
          Length = 259

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/264 (12%), Positives = 70/264 (26%), Gaps = 38/264 (14%)

Query: 48  FSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPG 107
             +P  WQ++ + +           SN         +GR  GK+T    +         G
Sbjct: 29  IGEPDAWQVDLLRS--------DPRSNEADRMILALSGRQSGKSTTAGGLG--YDDFSRG 78

Query: 108 MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSK 167
            ++I  A S  Q    L+  + ++ +  P                      +  +    +
Sbjct: 79  KTVILTAPSLRQSTE-LFRRILEYKNTDPFC-------------PPIVRQTQTELEAHPR 124

Query: 168 HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMT 227
           H                          +  DEA    D    +      E        + 
Sbjct: 125 H------GGRIIVVPATDQARGMTADTIIADEACFLDDDALTAFFPMRKETGR---IFLL 175

Query: 228 SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           S      G+FY+ +    +  +R    +  +    +        +  +     R E L +
Sbjct: 176 STPNMRQGYFYETWTSA-KRVRRITARSIDIPRRKAQVEFD---KATMSEATFRREHLCE 231

Query: 288 FPQQEVNNFIPHNYIEEAMSREAI 311
           F        +    +E+A +    
Sbjct: 232 FI-GAGTPLVSWEALEKASNPNVK 254


>gi|145579924|pdb|2O0H|A Chain A, T4 Gp17 Atpase Domain Mutant Complexed With Atp
 gi|145579925|pdb|2O0J|A Chain A, T4 Gp17 Atpase Domain Mutant Complexed With Adp
 gi|145579926|pdb|2O0K|A Chain A, T4 Gp17 Atpase Domain Mutant
          Length = 385

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/306 (11%), Positives = 84/306 (27%), Gaps = 52/306 (16%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 118 LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 173

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 174 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 220

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 221 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 261

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ ++ +  P+      +I    +    ++  I+ + T      F
Sbjct: 262 YASSPDAVRGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 319

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 320 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 379

Query: 287 QFPQQE 292
            F    
Sbjct: 380 AFEGTS 385


>gi|260427953|ref|ZP_05781932.1| phage DNA Packaging Protein [Citreicella sp. SE45]
 gi|260422445|gb|EEX15696.1| phage DNA Packaging Protein [Citreicella sp. SE45]
          Length = 409

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 47/297 (15%), Positives = 87/297 (29%), Gaps = 37/297 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  I  +  Q++  +    S  ++ 
Sbjct: 15  VIMGGRGAGKTRAGAEWVRACVEGAMPLSPGRCKRVALIGETMDQVREVMVFGESGIMNC 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E Q+                                        G       A
Sbjct: 75  SPPDRRPEWQATRRCL------------------VWPNGAEAMVFSAHDPEGLRGPQFDA 116

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          +  +    T R  G   ++  +P        
Sbjct: 117 AWVDELAKWKKARETWDMLQFALRLGEHPQVCVT--TTPRNVGILKELLELPST-VVTRA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RYG +S +AR E+ G               ++ A +  A  
Sbjct: 174 KTEANRANLAESFLEEVRARYG-NSRLARQELDGILVTDVDGALWTGEMLDRAQAL-APP 231

Query: 313 DLYAPLIMGCD-IAGEG--GDKTVVVFRRGNIIE-HIFDWSAKLIQETNQEG-CPVG 364
             +  +++  D  AG+G   D   +V   G + E     W A ++++ + +G  P G
Sbjct: 232 ATFDRIVVAVDPPAGDGKASDACGIVVA-GVVCEGPPQAWRAWVLEDASVQGVSPTG 287


>gi|307544683|ref|YP_003897162.1| hypothetical protein HELO_2093 [Halomonas elongata DSM 2581]
 gi|307216707|emb|CBV41977.1| K06909 [Halomonas elongata DSM 2581]
          Length = 531

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 72/269 (26%), Gaps = 22/269 (8%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G + L   +   +    PGM++   +  E  +                 +  FE   
Sbjct: 101 RDMGMSWLTIGLGCTVCLHHPGMAVGFGSRKEEYVDKIGSP-----------KSLFEKAR 149

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGP-HNTHGMAVFNDEASGTP 204
             +           +          +   T S    ++  G            DE++   
Sbjct: 150 SFMSMLPREFRGGWERKRHAPHMRIMFPETESVMTGESGDGIGRGDRTGFYIVDESAFLE 209

Query: 205 DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSG 264
                      T           S    +   F    +        +    R     D  
Sbjct: 210 RPHLVDASLSATTNCRQD----VSTPNGMGNPFAQRRH--SGKISVFTFHWRDDPRKDDA 263

Query: 265 FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGC 322
           ++   +     D      EI   +        IP  +++ A+        ++    +   
Sbjct: 264 WYAKQVDEL--DPVTVAQEIDINYSASVEGVLIPSAWVQAAVDAHKKLGIEITGERLGAL 321

Query: 323 DIAGEGGDKTVVVFRRGNIIEHIFDWSAK 351
           D+A EG D+     R G +++ + +W+ K
Sbjct: 322 DVADEGKDQNAYAGRHGILLDLVDEWTGK 350


>gi|149913871|ref|ZP_01902403.1| hypothetical protein RAZWK3B_17748 [Roseobacter sp. AzwK-3b]
 gi|149812155|gb|EDM71986.1| hypothetical protein RAZWK3B_17748 [Roseobacter sp. AzwK-3b]
          Length = 419

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/297 (12%), Positives = 71/297 (23%), Gaps = 35/297 (11%)

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNT 123
                       I  GRG GKT   A  +   +             +  +  +  Q++  
Sbjct: 15  QVPPEGDWRNWVILGGRGAGKTRAGAEWVRAQVEGARPLSEGLCRRMALVGETIDQVREV 74

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           +    S  ++  P     + Q+                                      
Sbjct: 75  MIFGESGIMACSPPDRRPDWQATRKRL------------------VWPNGAVAQAFSAHE 116

Query: 184 FVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
                       + DE +           +       +  +  I    T R  G   D+ 
Sbjct: 117 PEALRGPQFDGAWVDEMAKWKKARDTWDMLQFGLRLGDHPQVCIT--TTPRNVGVLKDLL 174

Query: 242 NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
                              +   F E + +RY     + R E+ G    +       ++ 
Sbjct: 175 EQKST-VVTSAPTEANRAFLAQSFLEEVRARYAGT-RLGRQELDGVLLSEAEGALWTNSG 232

Query: 302 IEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQE 355
           IE    R         +++  D       G D+  +V         + DW A ++ +
Sbjct: 233 IEAC--RVDNLPELDRIVVAIDPPVTGRAGSDECGIVVAGAVTRGPVQDWRAYVLAD 287


>gi|84517307|ref|ZP_01004661.1| putative large terminase [Loktanella vestfoldensis SKA53]
 gi|84508787|gb|EAQ05250.1| putative large terminase [Loktanella vestfoldensis SKA53]
          Length = 426

 Score = 83.5 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/285 (11%), Positives = 73/285 (25%), Gaps = 30/285 (10%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            I  GRG GKT   A  +   +       I  +  +  Q +  +    S  +++ P    
Sbjct: 40  VILGGRGAGKTRAGAEWVR-RMVASGARRIAVVGETYHQAREVMVFGDSGIMAVCPPDAR 98

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
            +  +                               +                A + DE 
Sbjct: 99  PKWIATRQML------------------VWPNGAQATLFSAQDPEALRGPQFDAAWVDEL 140

Query: 201 SGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTV 258
           +           +       +  R  +    T R       + + P      +   +   
Sbjct: 141 AKWRKAAATWDMLQFGLRLGDAPRVCVT--TTPRRQALLRKLLDRPST-VVTHAPTSANR 197

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPL 318
             +   F   + + Y     + R E+ G               +       A       +
Sbjct: 198 ANLADSFLAEMTAEYAGT-ALGRQELEGVMLDDVDGALWQMGALAACQVDRAPP--LTRI 254

Query: 319 IMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           ++  D    A  G D   ++     +   + DW A ++++ + +G
Sbjct: 255 VVAIDPPTTAHAGSDACGIIVAGVVMAGPVQDWRAYVLEDASLQG 299


>gi|78043214|ref|YP_360500.1| prophage LambdaCh01, PBSX family terminase large subunit
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995329|gb|ABB14228.1| prophage LambdaCh01, terminase, large subunit, PBSX family
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 420

 Score = 83.5 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/249 (13%), Positives = 71/249 (28%), Gaps = 23/249 (9%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            +  GRG GK++  +  ++  +   P  + + +   +  LK++++ ++   +  L    +
Sbjct: 30  WLKGGRGSGKSSFASIEIILGMMKDPNANAVVLRKVKETLKDSVFEQLIWAIEKLKVSDY 89

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF---N 197
                       W  +     M        I  R   + +          +   ++    
Sbjct: 90  ------------WDIKHNPMEMTYIPTGQKILFRGADKPKKIRSTKVSKGYIKFIWYEEV 137

Query: 198 DEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNG-WFYDIFNIPLEDWKRYQIDTR 256
           DE +G      + I               T N       W  +   I   D K +     
Sbjct: 138 DEFNGM--EEIRIINQSLMRGGEQFVVFYTYNPPNRVNAWVNEEILIERPDRKVHHSTYL 195

Query: 257 TVE--GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
           TV    +   F         ++    R E LG+           +  I +    +     
Sbjct: 196 TVPREWLGEQFLIEAEHLKRINERAYRHEYLGE-ITGTGGEIFSNITIRK--ITDDEIKA 252

Query: 315 YAPLIMGCD 323
           +  +  G D
Sbjct: 253 FDRIRRGID 261


>gi|254474412|ref|ZP_05087798.1| phage DNA Packaging Protein [Ruegeria sp. R11]
 gi|214028655|gb|EEB69490.1| phage DNA Packaging Protein [Ruegeria sp. R11]
          Length = 417

 Score = 83.5 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 44/295 (14%), Positives = 80/295 (27%), Gaps = 43/295 (14%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +  L              I  +  +  Q+++ +    S  L+ 
Sbjct: 24  VILGGRGAGKTRAGAEWVRALAEGSTPLSAGRARRIALLGETYDQVRDVMVQGDSGILAC 83

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                             T                  A
Sbjct: 84  TPPDRRPQWKATERRL------------------IWPNGATAQAFSAHDPEALRGPQFDA 125

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          R  +    T R      D+   P    + + 
Sbjct: 126 AWADELAKWKRGQDSWDMLQFALRLGTDPRVCVT--TTPRNVSVLRDLLASPST-VQTHA 182

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   + + F E + +RY   S + R E+ G   Q        +  +  A  R A  
Sbjct: 183 ATEANRANLATSFIEEVRNRYAG-SRLGRQELDGVLLQDVEGALWCNAGLVGAQVRSAPP 241

Query: 313 DLYAPLIMGCDI---AGEGGDKTVV----VFRRGNIIEHIFDWSAKLIQETNQEG 360
                +++  D    AG+  D   +       +G       DW A ++ +   +G
Sbjct: 242 --LDRVVVAVDPAVSAGKSSDACGILVVGAVLQGPP----QDWRAYVLADCTVQG 290


>gi|168820654|ref|ZP_02832654.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205342611|gb|EDZ29375.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
          Length = 539

 Score = 83.1 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 50/367 (13%), Positives = 107/367 (29%), Gaps = 44/367 (11%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKP--LEHFSQ---- 50
           P  I   +   + L  +    E + + + F           WG+   P  L++       
Sbjct: 12  PDYIQVFEWRMERLQRIRKAPETLPALRQFYRTNPAQFIIDWGMTTDPRNLDYGLPVTIP 71

Query: 51  ----PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP 106
               P   Q E+++ +     ++ N              R +G +  +  +   L     
Sbjct: 72  FLLFPR--QEEWIDWIMERSRNHENGLTEKS--------REMGLSWTSVGLASALCLFNR 121

Query: 107 GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
            M I   +  E  + +T+  +     ++      F     +    GW      + M ++ 
Sbjct: 122 EMVIGFGSRKEEYVDSTVDPK-----ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEF 176

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM 226
                  +  + +                F DEA+     +        T        I 
Sbjct: 177 PDTGAVIKGEAGDNIG-----RGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----ID 227

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
            S+   +N  F    +        +    R+    D  ++     +   +  +   E+  
Sbjct: 228 LSSVNGMNNPFAQKRH--SGKISVFTFHWRSDPRKDDEWYRKECEKI-DNPIIVAQELDL 284

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH 344
            +        IP  +++ A+              +   D+A EG DK     R G ++  
Sbjct: 285 NYQASAEGILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSD 344

Query: 345 IFDWSAK 351
           + +WS K
Sbjct: 345 VQEWSGK 351


>gi|312262635|gb|ADQ52930.1| gp17 terminase DNA packaging enzyme large subunit [Aeromonas phage
           PX29]
          Length = 406

 Score = 82.7 bits (202), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/271 (13%), Positives = 81/271 (29%), Gaps = 52/271 (19%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFV-----MRFFPWGIKGKPLEHFSQPHRWQ 55
           + R     +   + + E      C      F      +    WG+    L        +Q
Sbjct: 114 LKRANVPTKWTREMVEEWK---RCRDDIVYFAETYCSIIHIDWGVIKVQL------RDYQ 164

Query: 56  LEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIAN 115
            + +  +         ++ P          R +GKTT  A  +   +      ++  +A+
Sbjct: 165 KDMLRIMAT--ERMSIHNLP----------RQLGKTTATAIFLTHFVVFNEAKAVGVLAH 212

Query: 116 SETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRT 175
                K  L     + + +LP                   E  + ++ +++         
Sbjct: 213 KGDMSKEVLER-TKQSIELLPD-----------FLQPGIVEWNKGNIELENGCSI----- 255

Query: 176 YSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRL 233
                  +           ++ DEA+     D   K+IL   +    +R  I+ ++T   
Sbjct: 256 --GAYASSPDAVRGNSFALIYLDEAAFIENFDDTWKAILPVISSGRKSR--IILTSTPNG 311

Query: 234 NGWFYDIFN---IPLEDWKRYQIDTRTVEGI 261
              +YD++       + +K Y     TV+  
Sbjct: 312 INHWYDLWEVSINSDKGFKPYTTTWITVKER 342


>gi|315518961|dbj|BAJ51838.1| putative packaging maturation protein B [Ralstonia phage RSB2]
          Length = 593

 Score = 82.7 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 53/415 (12%), Positives = 101/415 (24%), Gaps = 87/415 (20%)

Query: 5   ISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDV 64
           +S  +KL+++  E L+H      F+ FV     W +   P      P   Q +    +  
Sbjct: 1   MSDLKKLQRDTKEALLHKRMQEDFRVFVWFV--WKVINLP-----NPTEIQNDMSHTLQ- 52

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
                    NP   +  I   RG+ K+ +    ++W +   P + I+ ++ S+ +     
Sbjct: 53  ---------NPPSRRFIIQGFRGVAKSFITCAYVVWRLWKDPQLKIMIVSASKERADANS 103

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY-------- 176
                    +    H             +             K   IT +          
Sbjct: 104 AFIKKIISEIHFLNHLKAKTGQVDTMIKFDVGPKLPDHSPSVKSVGITGQLTGSRADIII 163

Query: 177 --SEERPDTFVGPHNTHGMAVFNDEASGT------------PDIINKSILGFFTELNPNR 222
               E P           +     E                P                  
Sbjct: 164 ADDVEVPGNSSTQGARDKLFELVKEFDAILKPGGSVIYLGTPQNEMSLYNELLNRGYTTL 223

Query: 223 FWIMTSNTRR---LNGWFYDIFNIPLEDWKR----YQIDTRTVEGIDSGFHEGIISRYGL 275
            W      R       +   +     E +              E  D          YG 
Sbjct: 224 IWPARY-PRDDKQRANYGSRLAPYLAEKYDADPQGLAWKPTDPERFDEQDLLEREVSYGK 282

Query: 276 DSDVARIEILG------QFPQQEVNNFIPHNYIEEA-MSREAIDDL-------------- 314
              + +  +        ++P +  +  +     E A MS + +                 
Sbjct: 283 AGFMLQFMLDTSLSDAEKYPLRLRDLIVAQFGRERAPMSHDWLPGPALEASALPQIGLKG 342

Query: 315 ---YAPL------------IMGCDIAGEGGDKT---VVVFRRG-NIIEHIFDWSA 350
              Y P             ++  D +G G D+T   V+ F  G   +  +  +  
Sbjct: 343 DRYYNPYASAKEMSNYFGKVLAIDPSGRGKDETGYAVMYFLNGYLYLMEVGGFRG 397


>gi|294650848|ref|ZP_06728195.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292823266|gb|EFF82122.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 552

 Score = 82.7 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 56/385 (14%), Positives = 110/385 (28%), Gaps = 53/385 (13%)

Query: 1   MPRLISTDQKLEQ-ELHEMLMHAECVLSFKNFVMRFFPWGIK------GKPLEHFSQPHR 53
           M R        EQ EL       +C     ++    + W         G P         
Sbjct: 28  MSRRYYYKAVTEQSELSIQAEIYKCKNDPIHWFNH-WIWTYDPRGMSFGLPANIPFVLRP 86

Query: 54  WQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113
            Q+E +E +    ++  +          I   R  G + +     L       G +    
Sbjct: 87  KQVELVEWLSERENTQTHG--------LIEKSRDEGMSYVVLGYFLHRWLFVDGFAGGVG 138

Query: 114 ANSETQLKN-----TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           +  E  +       TL+ +     S +P           + P+G+  ++ +  M I +  
Sbjct: 139 SRKEELVDKKGDPKTLFHKFRDMFSKMPDW---------MKPTGFVEKVHDNYMRIINPD 189

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
              T    + +                F DE +       +++    ++       I  S
Sbjct: 190 NGATITGEAGDNIG-----RGGRTTMYFLDEWAFVERQ--EAVDAAISQNTN--VHIKGS 240

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVE--GIDSGFHEGIISRYGLDSDVA------ 280
               +   F+         +  + +  R          ++   I  +             
Sbjct: 241 TPNGIGDRFHQD--RFSGRYAVFSMPWRANPDKNWTVEYNGKQIHPWYEKQLATLDDVVL 298

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRR 338
             E+   +        IP  +++ A+        +     I G D+A EG DK     R 
Sbjct: 299 AQEVDINYAASVEGVLIPSTWVQLAIDAHIKLGIEPTGDRIAGLDVADEGKDKNSFASRH 358

Query: 339 GNIIEHIFDWSAK--LIQETNQEGC 361
           G ++ ++  WS K   I  T Q+  
Sbjct: 359 GIVMTYLDTWSGKGDDIFGTTQKAM 383


>gi|119869106|ref|YP_939058.1| phage terminase [Mycobacterium sp. KMS]
 gi|119695195|gb|ABL92268.1| phage Terminase [Mycobacterium sp. KMS]
          Length = 489

 Score = 82.7 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 52/336 (15%), Positives = 90/336 (26%), Gaps = 61/336 (18%)

Query: 29  KNFVMRF--FPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
           + FV     F    KG       +P  WQ++ +  V       V    P          R
Sbjct: 27  ERFVKFCEKFLRTPKGTGAREVFRPREWQMDIVRDVLDSGARTVGLMMP----------R 76

Query: 87  GIGKTTLNAWMMLWLISTR-PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           G GKTTL+A ++L++  TR  G +++  A  E Q     +   ++ + +           
Sbjct: 77  GQGKTTLSAAILLYIFFTRGEGANVVLFAVDERQAS-LAFRVAARMVQLSED-------- 127

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
             L    +           DS +  +     + E             +A   DEA     
Sbjct: 128 --LSSRCYVYADKLVLPLTDSTYQVMPASAAAAE---------GLDYVACLCDEAGVINR 176

Query: 206 IINKSILGFFTELNPNRFWIMTSNT-------------------RRLNGWFYDIFNIPL- 245
            + +               I                               +  F+    
Sbjct: 177 DVFEVAQ-LAQGKRERSVLIAIGTPGPDPNDQVLADLRAYAAEHPDDKSLVWREFSAAGF 235

Query: 246 EDWKRYQIDTRT--VEGIDSGFHEGIIS---RYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           ED               +D   H   +             R   L QF       F+P  
Sbjct: 236 EDHGADCPHCWELANPALDDFLHRDALHALLPPKTREATFRRARLCQFSTDTDGAFLPAG 295

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
             E  +S  +       +++  D +  G D T ++ 
Sbjct: 296 VWE-GLSTSSPVPPGVDVVLALDGSYNG-DTTALLV 329


>gi|254240165|ref|ZP_04933487.1| hypothetical protein PA2G_00806 [Pseudomonas aeruginosa 2192]
 gi|126193543|gb|EAZ57606.1| hypothetical protein PA2G_00806 [Pseudomonas aeruginosa 2192]
          Length = 342

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/254 (10%), Positives = 71/254 (27%), Gaps = 27/254 (10%)

Query: 90  KTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLH 149
           K+   A ++L  +  R  + I+C    +  +++++   +  ++  L    ++E+      
Sbjct: 39  KSHGVAQVLL-DMGARNPLRILCAREIQKSMRDSVHRLLRDYIVKLGLTEFYEVLDT--- 94

Query: 150 PSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINK 209
                       +   +    +       +               V+ +EA G       
Sbjct: 95  -----------EIRGRNGTLFLFSGL---QGHTVDSIKSFEGVDIVWVEEAQGVCKKSWD 140

Query: 210 SILGFFTELNPNRFWIMTSNTRRLNGWFY-DIFNIPLEDWKRYQIDTRTVEGIDSGFHEG 268
            ++    +     +  +  N        Y      P +D    +I+ R         ++ 
Sbjct: 141 VLIPTIRKDGSEIWLTL--NPAMDTDDTYVRFCAAPDDDVWLCEINWRDNPWFPDVLNQE 198

Query: 269 I-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMSREAIDDLYAPLIMGCDI 324
              ++  +  +       G+               + +E    R    D   P+    D+
Sbjct: 199 RLRAKRSMSQEDYEHIWEGKPRTVAEGAIYRHEILDLMESGRVRPVPYDPLLPVHTVWDL 258

Query: 325 AGEGGDKTVVVFRR 338
                D   + F +
Sbjct: 259 GW--NDAMTIGFVQ 270


>gi|238790716|ref|ZP_04634478.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
 gi|238721211|gb|EEQ12889.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
          Length = 538

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/366 (13%), Positives = 89/366 (24%), Gaps = 43/366 (11%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNF-----VMRFFPWG--------IKGKPLEHF 48
           P  +   +   + L  +    E +   + F           WG         +G P    
Sbjct: 12  PDYMQVFEWRMERLQRIRQQPEILPIMRAFYKDNPAQFIIDWGMTVDPRNVERGLPARIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++E       +                 R +G + L   M   L     G+
Sbjct: 72  FLLFPKQEEWIEWFVDRWRNAEPGITEKT--------RDMGMSWLTVGMASSLCLFNRGV 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
                +  E  +                 +  F+     +                    
Sbjct: 124 FAGFGSRKEEYVDKIGSP-----------KSLFDKARNFISLLPTEFRGGWSLKQHAPHM 172

Query: 169 YTITCRTYSEERPDTFVGP-HNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMT 227
             +   T S    +   G            DE++              T           
Sbjct: 173 RILFPETESAMTGEAGDGIGRGDRTSFYIVDESAFLERPYLVDASLSATTNCRQD----V 228

Query: 228 SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
           S    +   F +  +      K +    R     D  +++  +     D      EI   
Sbjct: 229 STPNGMANSFAERRH--SGKIKVFTFHWRDDPRKDDAWYQKQVENL--DPVTVAQEIDIN 284

Query: 288 FPQQEVNNFIPHNYIEEAMSRE--AIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHI 345
           +        IP  +++ A++             +   DIA EG D      R G ++E I
Sbjct: 285 YSASVEGVLIPSAWVQAAINAHEVLGIVPTGQRLGALDIADEGKDTNSFAGRHGFLLESI 344

Query: 346 FDWSAK 351
            +WS K
Sbjct: 345 EEWSGK 350


>gi|197105675|ref|YP_002131052.1| hypothetical protein PHZ_c2212 [Phenylobacterium zucineum HLK1]
 gi|196479095|gb|ACG78623.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 446

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 47/337 (13%), Positives = 83/337 (24%), Gaps = 49/337 (14%)

Query: 39  GIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMM 98
             KG PL    +P   Q+E  E +   C               ++A R  GK  +     
Sbjct: 7   REKGLPLTW--EPRPHQVELWETLVDGCRRAD-----------VAAHRRWGKDEVALQWA 53

Query: 99  LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELL 158
                 +PG     +     Q +  +W  V+                +      +   + 
Sbjct: 54  AVEALEKPG-VYWHLLPEAAQGRKAIWDAVN------------PHTGVRRINEAFPIHVR 100

Query: 159 EQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTEL 218
           ++++  + K        +     D +     +    V   E S +       I     E 
Sbjct: 101 KRTLDQEMKVELNNGSVWQVVGSDNYDSLVGSSPRGVVFSEWSLSKPQAWGFIRPILAEN 160

Query: 219 NPNRFWIMTSNTRRLNGWFYDIFNIPLED--WKRYQIDTRTVEGIDSGFHEGIISR---- 272
                W +   T R        F     +  W   +      E       +   +     
Sbjct: 161 GG---WALFLWTPRGRNHATRAFESRQREAGWFCLKSPATDTEVFTKAQLDQERAELIAE 217

Query: 273 ---YGLDSDVARIEILGQFPQQEVNNFIPHNYIE---EAMSREAIDDLYAPLIMGCDIAG 326
                        E L  F       +      E            D  A +    D+  
Sbjct: 218 LGSREEGEARFASEYLVDFDAAAPGAYYATLLGEAERAGRIGRVPWDPAARVDTAWDLG- 276

Query: 327 EGGDKTVVVFRRGNIIEHIF-DWSAKLIQETNQEGCP 362
              D T + F +      +  +  A    ET+ EG P
Sbjct: 277 -IDDYTAIWFFQ-----QVGREVRAIDYFETSGEGLP 307


>gi|159044721|ref|YP_001533515.1| hypothetical protein Dshi_2178 [Dinoroseobacter shibae DFL 12]
 gi|157912481|gb|ABV93914.1| hypothetical protein Dshi_2178 [Dinoroseobacter shibae DFL 12]
          Length = 452

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/267 (13%), Positives = 64/267 (23%), Gaps = 35/267 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q+++ +    S  L+ 
Sbjct: 59  VILGGRGAGKTRAGAEWVRAEVEGARPLDAGRSRRVALVGETYDQVRDVMIFGESGILAC 118

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E Q                                     +           A
Sbjct: 119 SPADRKPEWQGTRRQL------------------VWPNGAIAKCHSANDPEALRGPQFDA 160

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +  P  +     +          R  +    T R +     I        K   
Sbjct: 161 AWVDELAKWPNAEETWDMLQFALRLGVNPRQVVT--TTPRPSTILKQILATGST-VKTTA 217

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   + + F E I +RY     + R E+ G               IE         
Sbjct: 218 PTEANRAYLAASFLEEIRARYAGT-RLGRQELDGVLLDDVEGALWTSAGIEANRVETVPP 276

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF 336
                +++  D      +G D   +V 
Sbjct: 277 --LDRIVVAVDPPVTGHKGSDACGIVV 301


>gi|71065561|ref|YP_264288.1| PBSX family phage terminase large subunit [Psychrobacter arcticus
           273-4]
 gi|71038546|gb|AAZ18854.1| phage terminase, large subunit, PBSX family [Psychrobacter arcticus
           273-4]
          Length = 421

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/254 (13%), Positives = 65/254 (25%), Gaps = 28/254 (11%)

Query: 84  AGRGIGKTTLNAWMMLW----LISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M       L        I+C       L  +   E+ +         
Sbjct: 34  GGRGSGKTRTFALMTAVEGYRLAEAGASGIILCGREFMNSLNESSLEEIKQ--------- 84

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                  ++    W  +  E                ++  R +       +  +  + DE
Sbjct: 85  -------AIKSVSWLNDYYEIGEKYIRTKNRRVAYAFTGLRHNLDSIKGKSRILLAWVDE 137

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVE 259
           A    +   + +L    E +    WI   N           F     ++   +++     
Sbjct: 138 AENVSEAAWRKLLPTVREDDSEV-WITW-NPENKGSATDKRFRQVEHEF-IVEMNHNDNP 194

Query: 260 GIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPL 318
                  +  ++     D    R    G + +          ++     R    +   P 
Sbjct: 195 FFPDVLEQERLNDQENLDDATYRWIWEGAYLEASDAQIFNGKFVVREFERHPTWN--GPY 252

Query: 319 IMGCDIAGEGGDKT 332
             G D  G   D T
Sbjct: 253 N-GLDF-GFSTDPT 264


>gi|260556808|ref|ZP_05829026.1| P-loop protein [Acinetobacter baumannii ATCC 19606]
 gi|260410067|gb|EEX03367.1| P-loop protein [Acinetobacter baumannii ATCC 19606]
          Length = 437

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/298 (12%), Positives = 73/298 (24%), Gaps = 46/298 (15%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI------ICIANSETQLKNTLWAEVSK 130
            F+ A+  GR  GKT L    M          ++         A +  Q K   W  + +
Sbjct: 30  RFRDAVC-GRRFGKTFLAKAEMRRAARLAQKWNVSVEDEIWYAAPTFKQAKRVFWKRLKQ 88

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
            +              ++                       T         D +     +
Sbjct: 89  AIPPSWRFGKPNETECTITLK--------------------TGHVIRVVGLDNYDDLRGS 128

Query: 191 HGMAVFNDEASGTPDIIN-KSILGFFT-------ELNPNRFWIMTSNTRRLNGWFYDIFN 242
               +  DE +        + +    +        +      ++   T +     YD + 
Sbjct: 129 GLFFLIIDEWADCKWAAWEEVLRPMLSTCKYTVNGVQRVGGNVLRIGTPKGYNHCYDTWM 188

Query: 243 IPLE----DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP 298
                   D K +   +     I     +    +   D    R E    F   +   +  
Sbjct: 189 DGQNGREPDHKSWIYTSLQGGNIPESEIDVARRKM--DPKTFRQEYEASFETYQGVIYYC 246

Query: 299 HNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQET 356
                    +         L +G D   +     VV  R G  +  + ++  K + +T
Sbjct: 247 FERTFNCTEKVVK--EGDVLHIGMDFNVQ-KMAAVVYVRDGEELYAVGEF--KDLFDT 299


>gi|168467237|ref|ZP_02701079.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
 gi|195630466|gb|EDX49092.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
          Length = 539

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/367 (13%), Positives = 106/367 (28%), Gaps = 44/367 (11%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKP--LEHFSQ---- 50
           P  +   +   + L  +    E + + + F           WG+   P  L++       
Sbjct: 12  PDYVQVFEWRMERLQRIRKAPETLPALRQFYRTNPAQFIIDWGMTTDPRNLDYGLPVTIP 71

Query: 51  ----PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP 106
               P   Q E+++ +     +  N              R +G +  +  +   L     
Sbjct: 72  FLLFPR--QEEWIDWIIERSRNQENGLTEKS--------REMGLSWTSVGLASALCLFNR 121

Query: 107 GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
            M I   +  E  + +T+  +     ++      F     +    GW      + M ++ 
Sbjct: 122 EMVIGFGSRKEEYVDSTVDPK-----ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEF 176

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM 226
                  +  + +                F DEA+     +        T        I 
Sbjct: 177 PDTGAVIKGEAGDNIG-----RGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----ID 227

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
            S+   +N  F    +        +    R+    D  ++     +   +  +   E+  
Sbjct: 228 LSSVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYRKECEKI-DNPIIVAQELDL 284

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH 344
            +        IP  +++ A+              +   D+A EG DK     R G ++  
Sbjct: 285 NYQASAEGILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSD 344

Query: 345 IFDWSAK 351
           + +WS K
Sbjct: 345 VQEWSGK 351


>gi|56697127|ref|YP_167490.1| terminase, large subunit, putative [Ruegeria pomeroyi DSS-3]
 gi|56678864|gb|AAV95530.1| terminase, large subunit, putative [Ruegeria pomeroyi DSS-3]
          Length = 408

 Score = 81.9 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/291 (13%), Positives = 76/291 (26%), Gaps = 35/291 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q+++ +    S  L+ 
Sbjct: 15  VILGGRGAGKTRAGAEWVRARVEGSRPLDAGRARRVALVGETYDQVRDVMVFGESGILAC 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                                        G       A
Sbjct: 75  SPPDRRPNWKASERKL------------------IWPNGAEAQAFSAQDPEGLRGPQFDA 116

Query: 195 VFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          +  +    T R      D+   P    + + 
Sbjct: 117 AWVDELAKWKKAGETWDMLQFALRLGERPQVCVT--TTPRNVKLLKDLLAAPST-VQTHA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G               ++ A  R +  
Sbjct: 174 PTEANRANLAESFLEEVRARYAGT-RLGRQELDGVLLADAEGALWTAEMLDRA--RTSSV 230

Query: 313 DLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                +++  D +  G   GD   +V     +     DW A ++ +   +G
Sbjct: 231 PELDRVVVALDPSVSGGASGDACGMVVVGAQMQGPPQDWRAWVLADRTVQG 281


>gi|167553969|ref|ZP_02347711.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205321713|gb|EDZ09552.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 539

 Score = 81.9 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/367 (13%), Positives = 107/367 (29%), Gaps = 44/367 (11%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKP--LEHFSQ---- 50
           P  +   +   + L  +    E + + + F           WG+   P  L++       
Sbjct: 12  PDYVQVFEWRMERLQRIRKAPETLPALRQFYRTNPAQFIIDWGMTTDPRNLDYGLPVTIP 71

Query: 51  ----PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP 106
               P   Q E+++ +     ++ N              R +G +  +  +   L     
Sbjct: 72  FLLFPR--QEEWIDWIMERSRNHENGLTEKS--------REMGLSWTSVGLASALCLFNR 121

Query: 107 GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
            M I   +  E  + +T+  +     ++      F     +    GW      + M ++ 
Sbjct: 122 EMVIGFGSRKEEYVDSTVDPK-----ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEF 176

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM 226
                  +  + +                F DEA+     +        T        I 
Sbjct: 177 PDTGAVIKGEAGDNIG-----RGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----ID 227

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
            S+   +N  F    +        +    R+    D  ++     +   +  +   E+  
Sbjct: 228 LSSVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKI-DNPIIVAQELDL 284

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH 344
            +        IP  +++ A+              +   D+A EG DK     R G ++  
Sbjct: 285 NYQASTEGILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSD 344

Query: 345 IFDWSAK 351
           + +WS K
Sbjct: 345 VQEWSGK 351


>gi|291335343|gb|ADD94958.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C148]
          Length = 234

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 62/178 (34%), Gaps = 11/178 (6%)

Query: 151 SGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP-DIINK 209
                  ++     D K   +   T   +  +  +         V  DEA+    ++  +
Sbjct: 12  KLVPKPWIKTKNETDLKLELVNGSTIELKGTENAMALRGRSLSGVVLDEAAFMDAEVWFE 71

Query: 210 SILGFFTELNPNRFWIMTSNTRRLNGWFYDIF----NIPLEDWKRYQIDTRTVEGIDSGF 265
            I       +   + +  S       WFYD++    + P  +WKR+   T     +    
Sbjct: 72  VIRPALA--DKQGWALFISTPDGTASWFYDLWCYCEDDPTNEWKRWCYTTIEGGNVPQEE 129

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
            E   ++   D    R E    F  + +   +  ++ ++ +S +A D    PL++G D
Sbjct: 130 VEAARAQL--DPRTFRQEFEASF--ENLTGLVAISFSDDNISTDAKDISIQPLLLGVD 183


>gi|291337121|gb|ADD96636.1| hypothetical protein Syncc9605_0456 [uncultured organism
           MedDCM-OCT-S12-C92]
          Length = 354

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 69/208 (33%), Gaps = 16/208 (7%)

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP-D 205
            +         +      D +   I   T   +  +  +         V  DEA+    +
Sbjct: 8   RVLKKLVPKVWIRTKNETDLRIELINGSTIELKGTENAMALRGRSLSGVVLDEAAFMDAE 67

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF----NIPLEDWKRYQIDTRTVEGI 261
           +  + I       +   + +  S       WFYD++    +    +W+R+   T     +
Sbjct: 68  VWFEVIRPALA--DKEGWALFISTPDGTASWFYDLWCYVPDDETNEWQRWSYTTIDGGNV 125

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMG 321
                E   ++   D+   R E    F  + +   +  ++ ++ +S EA D    PL++G
Sbjct: 126 SKHEVEAARAQL--DTRTFRQEFEASF--ENLTGLVAISFSDDNISTEAKDISIQPLLLG 181

Query: 322 CDIAGEGGD-KTVVV-FRRGNIIEHIFD 347
            D      D  + +   + G  +    +
Sbjct: 182 VD---FNVDPMSGICAVKNGETLYVFDE 206


>gi|191172603|ref|ZP_03034142.1| gp33 TerL [Escherichia coli F11]
 gi|190907076|gb|EDV66676.1| gp33 TerL [Escherichia coli F11]
 gi|324014340|gb|EGB83559.1| hypothetical protein HMPREF9533_01599 [Escherichia coli MS 60-1]
          Length = 540

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/364 (12%), Positives = 93/364 (25%), Gaps = 40/364 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E + + K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIYWIMERWGNRENGITEKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                  DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +   F    +        +    R     D  ++     +   +  V   E+   +
Sbjct: 230 SVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++E++ 
Sbjct: 287 SASAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVR 346

Query: 347 DWSA 350
           +WS 
Sbjct: 347 EWSG 350


>gi|330910791|gb|EGH39301.1| phage terminase, large subunit [Escherichia coli AA86]
          Length = 540

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/356 (11%), Positives = 86/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  + E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     +   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGNRENGITEKSREMGLSWTAIGLACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R     D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP  +++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|49475449|ref|YP_033490.1| terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49475495|ref|YP_033536.1| terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49238255|emb|CAF27468.1| Terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49238301|emb|CAF27516.1| Terminase large subunit protein [Bartonella henselae str.
           Houston-1]
          Length = 340

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/263 (11%), Positives = 66/263 (25%), Gaps = 30/263 (11%)

Query: 108 MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSK 167
            +I+C    +  L  +   E+ + +                    +Y         ID +
Sbjct: 16  GTILCARQFQNSLAESSLEEIKRAIE------------GHDFLKDYYKVGESSIKSIDGR 63

Query: 168 HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELN---PNRFW 224
                   +S    +          +  + DEA    +   ++++    E         W
Sbjct: 64  ----IAFQFSGLDRNIASIKSMGRILLCWVDEAEPVTETAWQTLIPTLREEGEGWRAELW 119

Query: 225 IMTSNTRRLNGWFYDIFNIPLED-WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE 283
           +   N  R N      F     +  KR +I+           +E  +       +  +  
Sbjct: 120 VTW-NPLRDNAPVERRFRFSNNEAIKRVEINWSDNPKFPKILNEARLDDLKNRPETYKHI 178

Query: 284 ILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDIAGEG--GDKTVVVFRR 338
             G +       +     +   +E        D    +    DI G G   D T +   +
Sbjct: 179 WEGAYLTAIQGAYYQKEMLAAEQEGRIGRVARDPLMQMRAFWDIGGTGAKADATAIWIAQ 238

Query: 339 GNIIEHIFDWSAKLIQETNQEGC 361
                   +       E   +  
Sbjct: 239 ----FVGREIRVLDYYEAQGQPL 257


>gi|85709622|ref|ZP_01040687.1| Phage DNA Packaging Protein [Erythrobacter sp. NAP1]
 gi|85688332|gb|EAQ28336.1| Phage DNA Packaging Protein [Erythrobacter sp. NAP1]
          Length = 441

 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/281 (13%), Positives = 74/281 (26%), Gaps = 32/281 (11%)

Query: 66  CHSNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
              +        ++   I AGRG GKT   A  +  +  +     I  +++S  + +  +
Sbjct: 38  IARSAQLPPDGEWRVWLIMAGRGFGKTRAGAEWVRSIAESHSEARIALVSSSLAEARAVM 97

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
               S  L+  P     E +                                        
Sbjct: 98  VEGESGLLACSPPDRRPEFEPSLRRVR------------------FPNGAEAHLYSAGEP 139

Query: 185 VGPHNTHGMAVFNDEASGTP------DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
                      + DE    P           ++L      +  R  I  + T R      
Sbjct: 140 EALRGPQFSHAWCDEVGKWPISHSRATRAWDNLLMGLRLGDDPR--IAVTTTPRAVPLVQ 197

Query: 239 DIFNIPLEDWKRY-QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFI 297
            +            +  T              I+     S + R EI G+  +       
Sbjct: 198 RLLKQETSQATAVTRGSTYDNSANLPARFLEAIADEFAGSQLGRQEIEGELIEDIEGALW 257

Query: 298 PHNYIEEAMSREAIDDLYAPLIMGCDI--AGEGGDKTVVVF 336
             + +E++   EA    +  +++G D   +  G D+  +V 
Sbjct: 258 SRSLLEQSKE-EAGPPGFRRIVIGVDPPTSSTG-DECGIVV 296


>gi|300824951|ref|ZP_07105051.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300522580|gb|EFK43649.1| conserved hypothetical protein [Escherichia coli MS 119-7]
          Length = 540

 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/364 (12%), Positives = 93/364 (25%), Gaps = 40/364 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E + + K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITEKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                  DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +   F    +        +    R     D  ++     +   +  V   E+   +
Sbjct: 230 SVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++E++ 
Sbjct: 287 SASAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVR 346

Query: 347 DWSA 350
           +WS 
Sbjct: 347 EWSG 350


>gi|169633984|ref|YP_001707720.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii SDF]
 gi|169152776|emb|CAP01795.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii]
          Length = 552

 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 92/299 (30%), Gaps = 41/299 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKN-----TLWAEVSKWLSMLP 136
           I   R  G + +     L       G +    +  E  +       TL+ +     S +P
Sbjct: 107 IEKSRDEGMSYVVLGFFLHRWLFVEGFAGGVGSRKEELVDKKGDPKTLFHKFRDMFSKMP 166

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                      L P G+  ++ +  M I +     T    + +                F
Sbjct: 167 QW---------LKPKGFVEKVHDNYMRIINPDNGATITGEAGDNIG-----RGGRTTMYF 212

Query: 197 NDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTR 256
            DE +       +++    ++       I  S    +   F+         +  + +  R
Sbjct: 213 LDEWAFV--EQQEAVDAAISQNTN--VHIKGSTPNGIGDRFHQD--RFSGRYAVFTMPWR 266

Query: 257 TVEG----------IDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAM 306
                         +   ++E  ++    D  V   E+   +        IP  +++ A+
Sbjct: 267 DNPDKNWTVTYNGKVIYPWYEKQLATL--DDVVLAQEVDINYAASVEGVLIPSTWVQAAI 324

Query: 307 S--REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAK--LIQETNQEGC 361
              ++   +     I G D+A EG DK     R G ++ ++  WS K   I  T Q+  
Sbjct: 325 DAHKKLQIEPTGDRIGGLDVADEGKDKNSFAARHGVVMTYLATWSGKGDDIFGTTQKAM 383


>gi|318064508|gb|ADV36483.1| phage terminase large subunit [Edwardsiella phage eiDWF]
 gi|318064606|gb|ADV36532.1| phage terminase large subunit [Edwardsiella phage eiMSLS]
          Length = 460

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 41/318 (12%), Positives = 96/318 (30%), Gaps = 36/318 (11%)

Query: 43  KPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLI 102
            P++   +   W+++ +     H    +N++   I    + +G G GKT   A   + L 
Sbjct: 26  APVKKERKSRTWRIKTL----PHQRGLINDTTTKI--LGLCSGFGGGKTWSAARKAVQLA 79

Query: 103 STRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSM 162
              PG   I    +   L   ++ E+ K L+    +  F  Q    H             
Sbjct: 80  ILNPGCDGIITEPTIPLLVKIMYPELEKALNEAGIKWKFNKQDKIYHCRIAG-------- 131

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG----TPDIINKSILGFFTEL 218
                           +  + +      +      DE             + +LG     
Sbjct: 132 ---------QMTRIICDSMENYTRLIGVNAAWCVCDEFDTTKPDIAMEAYRKLLGRLRTG 182

Query: 219 NPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
           N  +  ++ S        +    +   +  +  +  T     +   + + + ++Y    +
Sbjct: 183 NVRQ-MVIVSTPEGFRAMYQIFISEADDQKRLIKARTTDNHYLPQDYIDTLRAQY--PPE 239

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF-R 337
           +    + G+F           N+     + + + +    L++G D    G     V   R
Sbjct: 240 LIEAYLNGEFVNLTGGAVY-RNFSRTLNNCDTVAEDDDTLMIGMDF-NVGQMAGAVYVQR 297

Query: 338 RGNIIEH---IFDWSAKL 352
             + +E    + ++   L
Sbjct: 298 IADGVEEMHLVDEFCGLL 315


>gi|318064394|gb|ADV36428.1| phage terminase large subunit [Edwardsiella phage eiAU]
          Length = 460

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 41/318 (12%), Positives = 96/318 (30%), Gaps = 36/318 (11%)

Query: 43  KPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLI 102
            P++   +   W+++ +     H    +N++   I    + +G G GKT   A   + L 
Sbjct: 26  APVKKERKSRTWRIKTL----PHQRGLINDTTTKI--LGLCSGFGGGKTWSAARKAVQLA 79

Query: 103 STRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSM 162
              PG   I    +   L   ++ E+ K L+    +  F  Q    H             
Sbjct: 80  ILNPGCDGIITEPTIPLLVKIMYPELEKALNEAGIKWKFNKQDKIYHCRIAG-------- 131

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG----TPDIINKSILGFFTEL 218
                           +  + +      +      DE             + +LG     
Sbjct: 132 ---------QMTRIICDSMENYTRLIGVNAAWCVCDEFDTTKPDIAMEAYRKLLGRLRTG 182

Query: 219 NPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSD 278
           N  +  ++ S        +    +   +  +  +  T     +   + + + ++Y    +
Sbjct: 183 NVRQ-MVIVSTPEGFRAMYQIFISEADDQKRLIKARTTDNHYLPQDYIDTLRAQY--PPE 239

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF-R 337
           +    + G+F           N+     + + + +    L++G D    G     V   R
Sbjct: 240 LIEAYLNGEFVNLTGGAVY-RNFSRTLNNCDTVAEDDDTLMIGMDF-NVGQMAGAVYVQR 297

Query: 338 RGNIIEH---IFDWSAKL 352
             + +E    + ++   L
Sbjct: 298 IADGVEEMHLVDEFCGLL 315


>gi|163736656|ref|ZP_02144075.1| hypothetical protein RGBS107_16031 [Phaeobacter gallaeciensis
           BS107]
 gi|161390526|gb|EDQ14876.1| hypothetical protein RGBS107_16031 [Phaeobacter gallaeciensis
           BS107]
          Length = 430

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 79/292 (27%), Gaps = 35/292 (11%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +  L              I  +  +  Q+++ +    S  L+ 
Sbjct: 37  VILGGRGAGKTRAGAEWVRTLAEGATPLSAGRARRIALLGETYDQVRDVMVQGDSGLLAC 96

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                             T                  A
Sbjct: 97  TPRDRRPTWKATERRL------------------IWPNGATAQAFSAHDPEALRGPQFDA 138

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  R  +    T R  G   D+   P    + + 
Sbjct: 139 AWADELAKWKRGQDSWDMLQFALRLGDDPRVCVT--TTPRNVGVLRDLLASPST-VQTHA 195

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   + + F   + +RY   S + R E+ G   Q        +  +  A    A  
Sbjct: 196 ATEANRANLAASFIAEVRNRYAG-SRLGRQELDGILLQDVEGALWTNAGLVAAQI--AKA 252

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
                +++  D    AG+  D   +V     +     DW A ++ +   +G 
Sbjct: 253 PTLDRVVVAVDPAVSAGKRSDACGIVVVGATLQGPPQDWCAYVLADCTVQGV 304


>gi|254160843|ref|YP_003043951.1| hypothetical protein ECB_00733 [Escherichia coli B str. REL606]
 gi|253972744|gb|ACT38415.1| conserved hypothetical protein [Escherichia coli B str. REL606]
          Length = 540

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/356 (11%), Positives = 86/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  + E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     +   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGNRENGITEKSREMGLSWTAIGLACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R     D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP  +++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|159897093|ref|YP_001543340.1| hypothetical protein Haur_0564 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890132|gb|ABX03212.1| hypothetical protein Haur_0564 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 477

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 76/301 (25%), Gaps = 60/301 (19%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G + L     LWL   +PG  ++  +  + +    L   V +    LP         
Sbjct: 64  RQLGISWLCCAYALWLCLFQPGKVVLIFSKGQGEADEMLHR-VKRLYERLPDWMREA--- 119

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASG--T 203
                S          +   +     +        P T     +     V  DEA     
Sbjct: 120 -----SPALVTDNTTELEWANGSRVKS-------LPATKGAGRSFTASLVILDEAGFLIW 167

Query: 204 PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI---PLEDWKRYQIDTRTVEG 260
              +  ++             I+ S    +   F+ ++         +K   +       
Sbjct: 168 AKQLYTALKPTIDGGGQ---LIVLSTANGIGNLFHQLWVKALSAKNRFKTIFLPWWARPT 224

Query: 261 IDSGFHEGIISRYGLDSDVARIEI---------------------------LGQFPQQEV 293
            D+ +++  +  Y  D D+ R E                             G   +   
Sbjct: 225 RDAQWYQEQLEEY-TDLDMVRQEYPSTAQEAFLVSGRTRFKMPWLLQQTPSDGLAAESLP 283

Query: 294 NNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHIFDWSA 350
           +     + +        +       I+  D+A EG   GD            E +     
Sbjct: 284 DALDKLDGVTM----YQLPQQGRRYILAADVA-EGLEHGDFCAATLIDAVSWEEMVSVHG 338

Query: 351 K 351
           K
Sbjct: 339 K 339


>gi|296160121|ref|ZP_06842940.1| phage terminase, large subunit, PBSX family [Burkholderia sp.
           Ch1-1]
 gi|295889595|gb|EFG69394.1| phage terminase, large subunit, PBSX family [Burkholderia sp.
           Ch1-1]
          Length = 494

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 87/301 (28%), Gaps = 42/301 (13%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P   K  +  GRG  KT     ++    S R    ++C+   +  ++ +  AE+S+ +  
Sbjct: 68  PKRLKI-VYGGRGSAKTRSVVSILTAQASARRE-RVLCLREIQNSIEESSHAELSEEIER 125

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
                 F +    +                     T +  ++     +       T    
Sbjct: 126 RDLSGSFVVGKKIIRV-----------------PATRSSFSFRGLYRNQRGIKGFTKASK 168

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL--------- 245
            + DEA G      + ++    E     +  +T N  + +   +     P          
Sbjct: 169 AWVDEADGVSRDSWEILMPTIREKGSEVW--VTFNPNKAHDPTWTDLIGPYEHLLDDGGC 226

Query: 246 ---EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
              +D    + +                    +D D      LGQF ++         + 
Sbjct: 227 YEDDDVLIIRANYTDNPWFTEELELERAKMERVDKDRYNWIWLGQFNKRSNELIFAGKWR 286

Query: 303 EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV--VFRRGNIIEHIFDWSAKLIQETNQEG 360
            EA    A    +     G        D T +   F +GN +    D+ A  +++   +G
Sbjct: 287 TEAFETPANVRFFFGADWG-----FAQDPTTLNRSFVKGNTLFV--DYEANSLRQNAGKG 339

Query: 361 C 361
            
Sbjct: 340 V 340


>gi|291283815|ref|YP_003500633.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763688|gb|ADD57649.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
          Length = 540

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/356 (11%), Positives = 86/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  + E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     +   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGNRENGITEKSREMGLSWTAIGLACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R     D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP  +++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|78212008|ref|YP_380787.1| hypothetical protein Syncc9605_0456 [Synechococcus sp. CC9605]
 gi|78196467|gb|ABB34232.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 414

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/250 (13%), Positives = 70/250 (28%), Gaps = 31/250 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            +++GR  GKT +    +L       G  +  +A +  Q K   W ++ + +        
Sbjct: 24  VVNSGRRFGKTRMALTWLLEGALLTSGSRMWFLAPTRVQAKQIAWRDLKEMVPGSWASQV 83

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
            E                   + + +  +            D               DE 
Sbjct: 84  RESTLT---------------IELRNGSHIQLA------GADYADSLRGQRADRFAIDEY 122

Query: 201 SGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP--LEDWKRYQIDTR 256
               D   + ++ L      + +   I +S       +  +++      E W R+   + 
Sbjct: 123 CYIRDLQEMWQAALLPMLGTSDDGSVIFSSTPAGGGTFSAELWERAETAEGWARWNFPSV 182

Query: 257 TVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
               +   + E        D  + R E  G   +  +    P        +     D   
Sbjct: 183 AGGWVKPEYVEQARQTM--DPSLWRQEFFGS-IESLLGAVYPAF---NQQNISDTVDNGG 236

Query: 317 PLIMGCDIAG 326
           PL++GCD   
Sbjct: 237 PLLVGCDFNR 246


>gi|84503393|ref|ZP_01001462.1| Putative large terminase [Oceanicola batsensis HTCC2597]
 gi|84388303|gb|EAQ01254.1| Putative large terminase [Oceanicola batsensis HTCC2597]
          Length = 460

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/267 (12%), Positives = 62/267 (23%), Gaps = 35/267 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             I  +  +  Q++  +    S  ++ 
Sbjct: 67  VILGGRGAGKTRAGAEWVRAQVEGDRPLDKGRCKRIALVGETIDQVREVMIFGDSGIMAC 126

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                                        G        
Sbjct: 127 SPPDRRPEWEATRKRL------------------VWPNGAVAYAFSAHEPEGLRGPQFDG 168

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE             +       +  R  +    T R  G   D+  +       + 
Sbjct: 169 AWADELGKWRRGRDSWDMLQFALRLGDAPRVCVT--TTPRNVGVLKDLLEMDST-VTTHA 225

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RY     + R E+ G               +E    R    
Sbjct: 226 PTEANRANLADSFLAEVRARYAGTG-LGRQELDGVMLDAAEGALWTPAMLEAG--RVEAP 282

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF 336
                +++  D       G D+  +V 
Sbjct: 283 PDLDRIVVAVDPPVTGHAGSDECGIVV 309


>gi|218555117|ref|YP_002388030.1| hypothetical protein ECIAI1_2647 [Escherichia coli IAI1]
 gi|218361885|emb|CAQ99485.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 540

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/267 (11%), Positives = 69/267 (25%), Gaps = 19/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G +     +   L      M I   +  E  + ++     + +           ++ 
Sbjct: 101 REMGLSWTAIGLACSLCLFNKEMVIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEF 159

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
                   +A  +                    +                  DEA+    
Sbjct: 160 RGSWSEKKHAPYMRVEFP---------ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQR 210

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
            +        T        I  S+   +   F    +        +    R     D  +
Sbjct: 211 PLLIDAALSQTTRCR----IDLSSVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEW 264

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +     +   +  V   E+   +        IP  +++ A+              +   D
Sbjct: 265 YRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMD 323

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G ++E++ +WS 
Sbjct: 324 VADEGRDKNAFSTRHGFLMENVREWSG 350


>gi|302339289|ref|YP_003804495.1| hypothetical protein Spirs_2798 [Spirochaeta smaragdinae DSM 11293]
 gi|301636474|gb|ADK81901.1| conserved hypothetical protein [Spirochaeta smaragdinae DSM 11293]
          Length = 295

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 88/292 (30%), Gaps = 61/292 (20%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ   ++               ++ +  ++  R  GK+T+ A           G  I
Sbjct: 33  PFLWQDWALDQ--------------SLRRLLLNCCRQAGKSTVIAAKAAHKAKFFSGSLI 78

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           I ++ +  Q K  +  +V  ++++                     E  + +    ++   
Sbjct: 79  ILVSPALRQSKELM-RKVEDFIALDKSFP------------PASEEDNQLTKEFKNRSRI 125

Query: 171 ITCRTYSEERPDTFVGPHN-THGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
           +         P +       +    +  DEAS  PD + K+I       +     ++ + 
Sbjct: 126 VA-------LPGSEKTIRGLSGPTLIIIDEASRIPDELYKAIRPMMAGADTEL--VLMTT 176

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTV-EGIDSGFHEGIISRYGL------------- 275
                G FYD ++   + W + ++  R +     +      + R                
Sbjct: 177 PFGKRGVFYDAWSR-SKRWTKIEVVGRDILGRFPNEQVYAQLRRKDGIKACYSPRHSVEF 235

Query: 276 --------DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI 319
                        R E  G+F     ++      +  A+  +     +AP+I
Sbjct: 236 LGEELEEMGEWWYRQEYGGEFMDPI-DSVFNMEDVRAAIINDTPAISFAPII 286


>gi|281416211|ref|YP_003347946.1| DNA packaging/maturation protein B [Vibrio phage N4]
 gi|237701518|gb|ACR16511.1| DNA packaging/maturation protein B [Vibrio phage N4]
          Length = 572

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 47/382 (12%), Positives = 88/382 (23%), Gaps = 91/382 (23%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               F  F+M    W     P     +P R Q +    +                +  + 
Sbjct: 1   MKNDFVLFLMVL--WRALNLP-----EPTRCQKDMARKLAAGDER----------RFILQ 43

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + +LP  H  + 
Sbjct: 44  AFRGIGKSFITCAFVVWKLWNNPQLKFMIVSASKERADANSIF-IKRIIDLLPFLHELKP 102

Query: 144 QSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHG 192
           +         +   L +       K   IT +              E P+          
Sbjct: 103 RPEQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQAARDR 162

Query: 193 MAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           +     E                P                   W      + +N      
Sbjct: 163 LGELVKEFDAILKPNGTIIYLGTPQCEMTLYRELENRGYKTTIWPARY-PKDMNDLETYG 221

Query: 241 FNIPL-------EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
             +         E+ + Y          D          YG      +  +    P    
Sbjct: 222 NRLAPMLKDELMENPEAYWWQPTDPVRFDDEDLRERELSYGKAGFALQFML---NPNLSD 278

Query: 294 NNFIP---HNYIEEAMSREAID------------------------------------DL 314
               P    ++I  A+  +                                         
Sbjct: 279 AEKYPLKLRDFIVAALEVDKAPLTYGWLPNPQNLLQNVPQVGLKGDTYHRYDVADKRQAS 338

Query: 315 YAPLIMGCDIAGEGGDKTVVVF 336
           Y   IM  D +G G D+T    
Sbjct: 339 YTSKIMAIDPSGRGKDETGYCV 360


>gi|68299748|ref|YP_249597.1| DNA packaging protein B [Vibriophage VP4]
 gi|66473287|gb|AAY46296.1| DNA packaging protein B [Vibriophage VP4]
          Length = 586

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 47/382 (12%), Positives = 88/382 (23%), Gaps = 91/382 (23%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               F  F+M    W     P     +P R Q +    +                +  + 
Sbjct: 15  MKNDFVLFLMVL--WRALNLP-----EPTRCQKDMARKLAAGDER----------RFILQ 57

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + +LP  H  + 
Sbjct: 58  AFRGIGKSFITCAFVVWKLWNNPQLKFMIVSASKERADANSIF-IKRIIDLLPFLHELKP 116

Query: 144 QSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHG 192
           +         +   L +       K   IT +              E P+          
Sbjct: 117 RPEQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQAARDR 176

Query: 193 MAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           +     E                P                   W      + +N      
Sbjct: 177 LGELVKEFDAILKPNGTIIYLGTPQCEMTLYRELENRGYKTTIWPARY-PKDMNDLETYG 235

Query: 241 FNIPL-------EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
             +         E+ + Y          D          YG      +  +    P    
Sbjct: 236 NRLAPMLKDELMENPEAYWWQPTDPVRFDDEDLRERELSYGKAGFALQFML---NPNLSD 292

Query: 294 NNFIP---HNYIEEAMSREAID------------------------------------DL 314
               P    ++I  A+  +                                         
Sbjct: 293 AEKYPLKLRDFIVAALEVDKAPLTYGWLPNPQNLLQNVPQVGLKGDTYHRYDVADKRQAS 352

Query: 315 YAPLIMGCDIAGEGGDKTVVVF 336
           Y   IM  D +G G D+T    
Sbjct: 353 YTSKIMAIDPSGRGKDETGYCV 374


>gi|291334534|gb|ADD94186.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C1220]
 gi|291335526|gb|ADD95137.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C491]
 gi|291335665|gb|ADD95272.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C846]
          Length = 354

 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 70/208 (33%), Gaps = 16/208 (7%)

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP-D 205
            +         +      D +   I   T   +  +  +         V  DEA+    +
Sbjct: 8   RVLKKLVPKVWIRTKNETDLRIELINGSTIELKGTENAMALRGRSLSGVVLDEAAFMDAE 67

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF----NIPLEDWKRYQIDTRTVEGI 261
           +  + I       +   + +  S       WFYD++    +    +W+R+   T     +
Sbjct: 68  VWFEVIRPALA--DKEGWALFISTPDGTASWFYDLWCYVPDDETNEWQRWSYTTIDGGNV 125

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMG 321
                E   ++   D+   R E    F  + +   +  ++ +E +S+EA D    PL++G
Sbjct: 126 SKHEVEAARAQL--DTRTFRQEFEASF--ENLTGLVAISFSDENISQEAKDISIQPLLLG 181

Query: 322 CDIAGEGGD-KTVVV-FRRGNIIEHIFD 347
            D      D  + +   + G  +    +
Sbjct: 182 VD---FNVDPMSGICAVKNGETLYVFDE 206


>gi|254776419|ref|ZP_05217935.1| phage terminase [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 491

 Score = 80.8 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 41/329 (12%), Positives = 86/329 (26%), Gaps = 53/329 (16%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
             WQ+  +          +          AI   RG+GKT + A + L+ +   P  + I
Sbjct: 51  RPWQMGMLRPFLDPDPRPLVG--------AIMGPRGLGKTGIFAALGLYELFCGPDGNEI 102

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
            I   + ++   L    ++ + +                    A +    + +  K  T+
Sbjct: 103 PIVAVDERMAGRLLKPAAQMVELN-------------DELAARAVVYRDRIEVPGKRSTL 149

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSI------------LGFFTELN 219
           T      +R +               DE          ++            LG  T  N
Sbjct: 150 TALPAEAKRIEGLGTW-----TLALADELGEIDPDTWSTLLLGAGKLDGAMALGIGTPPN 204

Query: 220 PNRFWIM------TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISR- 272
                +        +N       FY+      E      +    +               
Sbjct: 205 RETSVLTDLREACRANPDDRTMAFYEFSADGFEHHPVSCVHCLELANPQLDDLLSRDRAT 264

Query: 273 ---YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGG 329
                      R + L Q      + F+  +  +   +   + D  A +++  D + +  
Sbjct: 265 ALLKQTTEGEYRRKRLCQVVTTNESPFVDADTWDGLKAPHPVPD-GADVVIALDGSLK-D 322

Query: 330 DKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
           D T +V      +  +  +      E   
Sbjct: 323 DSTALVV---GTVGKVPHFDRLDAWENPG 348


>gi|218296727|ref|ZP_03497433.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
 gi|218242816|gb|EED09350.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
          Length = 425

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 88/273 (32%), Gaps = 25/273 (9%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           + FK  + + R  GK+               G + + ++  E Q +    AE +K     
Sbjct: 17  SRFKIGLWS-RQTGKSFALTLEAALHAVEHRGSTWVLLSAGERQSREL--AEKAKAHLDA 73

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             +    M+S           + +  + + +    I         P         +   V
Sbjct: 74  MKQVGTLMESRFF---EGGESVTQLEIRLPNLSRLIF-------LPANPRTARG-YTGNV 122

Query: 196 FNDEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
             DE +     + I  ++    T   P+    + S      G F++++      W R+++
Sbjct: 123 VLDEFAFHQDSEAIWAAMYPIIT-RRPDLKIRVMSTPNGPRGKFWELWEKGGPAWSRHKV 181

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA--- 310
                           +     D  + + E L +F       F+P + I EA +RE    
Sbjct: 182 TIYDAVAQGLPVDPEELRAGLADDFIWQQEYLCEFL-SAEEAFLPWSLILEAEAREDPRG 240

Query: 311 IDDLYAPLIMGCDIAGEGGDKTVVVF--RRGNI 341
             +      +G D+     D TV V   R G++
Sbjct: 241 PWNPDQAY-LGVDVGRH-RDLTVFVVLERVGDV 271


>gi|89054122|ref|YP_509573.1| hypothetical protein Jann_1631 [Jannaschia sp. CCS1]
 gi|88863671|gb|ABD54548.1| protein of unknown function DUF264 [Jannaschia sp. CCS1]
          Length = 483

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/267 (11%), Positives = 61/267 (22%), Gaps = 35/267 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            +  GRG GKT   A  +  ++             +  I  +  Q    +    S  ++ 
Sbjct: 90  VVLGGRGAGKTRAGAEWVRSMVEGATPEAPGRAKRVALIGETYDQAMAVMVKGESGLIAC 149

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P        +                                    +            
Sbjct: 150 SPPDRVPRWIAGERKL------------------VWPNGAEAQVFSANDPEALRGPQFDL 191

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +  P        +              + + T R      D+  +  +      
Sbjct: 192 AWADELAKWPKAQETWDMLQFGLRLGQHP--QQIVTTTPRNVNVLKDL--LARDGVAHTH 247

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
             T       +      +     D+ + R E+ G       N       I+E    +A D
Sbjct: 248 APTEANSAYLADSFLTEVRSRYGDTRLGRQELDGVLLDDVDNALWVRGAIDEGRLTDAPD 307

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF 336
                +I+  D       G D   +V 
Sbjct: 308 V--TRVIVAVDPPVTGHAGSDACGIVV 332


>gi|313499430|gb|ADR60796.1| P-loop protein [Pseudomonas putida BIRD-1]
          Length = 374

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/293 (11%), Positives = 68/293 (23%), Gaps = 48/293 (16%)

Query: 77  IFKCAISAGRGIGKTTL-------NAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVS 129
            F+ A+  GR  GKT L        A +      +     I   A +  Q K   W  + 
Sbjct: 33  RFRDAVC-GRRFGKTFLGKAEMRRAARLAAEWGVSVEDE-IWYGAPTFKQAKRVFWRRLK 90

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
           + +              S+                       +         D +     
Sbjct: 91  QAIPEAWRAARPNETECSITLK--------------------SGHIMRVVGLDNYDNLRG 130

Query: 190 THGMAVFNDEASGTPDIIN-KSILGFF---------TELNPNRFWIMTSNTRRLNGWFYD 239
           +    V  DE +        + +             T  +      +   T +     YD
Sbjct: 131 SGLFFVLVDEWADCSWAAWEEVLRPMLSTCQYTIPQTGESRKGGHALRIGTPKGFNHCYD 190

Query: 240 IFNIPL----EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNN 295
            +         D K +Q  +     + +   +    +   D    R E    F +     
Sbjct: 191 TYRDGQPGGEPDHKSWQYTSLQGGNVPAVELDAARRKM--DPRTFRQEYEAGF-ENYAGV 247

Query: 296 FIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
                +                + +G D         VV   R  +   + ++
Sbjct: 248 VYS-TFDRAECHTSERIKPGEAIHIGMDFNVM-KMAAVVYVVRDGLPLALDEF 298


>gi|323512078|gb|ADX87539.1| DNA packaging protein B [Vibrio phage ICP3_2009_B]
 gi|323512127|gb|ADX87587.1| DNA packaging protein B [Vibrio phage ICP3_2009_A]
 gi|323512176|gb|ADX87635.1| DNA packaging protein B [Vibrio phage ICP3_2008_A]
 gi|323512224|gb|ADX87682.1| DNA packaging protein B [Vibrio phage ICP3_2007_A]
          Length = 572

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 47/382 (12%), Positives = 88/382 (23%), Gaps = 91/382 (23%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               F  F+M    W     P     +P R Q +    +                +  + 
Sbjct: 1   MKNDFVLFLMVL--WRALNLP-----EPTRCQKDMARKLAAGDER----------RFILQ 43

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + +LP  H  + 
Sbjct: 44  AFRGIGKSFITCAFVVWKLWNNPQLKFMIVSASKERADANSIF-IKRIIDLLPFLHELKP 102

Query: 144 QSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHG 192
           +         +   L +       K   IT +              E P+          
Sbjct: 103 RPEQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQAARDR 162

Query: 193 MAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           +     E                P                   W      + +N      
Sbjct: 163 LGELVKEFDAILKPNGTIIYLGTPQCEMTLYRELENRGYKTTIWPARY-PKDMNDLESYG 221

Query: 241 FNIPL-------EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
             +         E+ + Y          D          YG      +  +    P    
Sbjct: 222 NRLAPMLKDELMENPEAYWWQPTDPVRFDDEDLRERELSYGKAGFALQFML---NPNLSD 278

Query: 294 NNFIP---HNYIEEAMSREAID------------------------------------DL 314
               P    ++I  A+  +                                         
Sbjct: 279 AEKYPLKLRDFIVAALEVDKAPLTYGWLPNPQNLLQNVPQVGLKGDTYHRYDVADKRQSS 338

Query: 315 YAPLIMGCDIAGEGGDKTVVVF 336
           Y   IM  D +G G D+T    
Sbjct: 339 YTSKIMTIDPSGRGKDETGYCV 360


>gi|325171325|ref|YP_004251296.1| DNA packaging protein B [Vibrio phage ICP3]
 gi|323512031|gb|ADX87493.1| DNA packaging protein B [Vibrio phage ICP3]
          Length = 586

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 47/382 (12%), Positives = 88/382 (23%), Gaps = 91/382 (23%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
               F  F+M    W     P     +P R Q +    +                +  + 
Sbjct: 15  MKNDFVLFLMVL--WRALNLP-----EPTRCQKDMARKLAAGDER----------RFILQ 57

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + +LP  H  + 
Sbjct: 58  AFRGIGKSFITCAFVVWKLWNNPQLKFMIVSASKERADANSIF-IKRIIDLLPFLHELKP 116

Query: 144 QSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHG 192
           +         +   L +       K   IT +              E P+          
Sbjct: 117 RPEQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQAARDR 176

Query: 193 MAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           +     E                P                   W      + +N      
Sbjct: 177 LGELVKEFDAILKPNGTIIYLGTPQCEMTLYRELENRGYKTTIWPARY-PKDMNDLESYG 235

Query: 241 FNIPL-------EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
             +         E+ + Y          D          YG      +  +    P    
Sbjct: 236 NRLAPMLKDELMENPEAYWWQPTDPVRFDDEDLRERELSYGKAGFALQFML---NPNLSD 292

Query: 294 NNFIP---HNYIEEAMSREAID------------------------------------DL 314
               P    ++I  A+  +                                         
Sbjct: 293 AEKYPLKLRDFIVAALEVDKAPLTYGWLPNPQNLLQNVPQVGLKGDTYHRYDVADKRQSS 352

Query: 315 YAPLIMGCDIAGEGGDKTVVVF 336
           Y   IM  D +G G D+T    
Sbjct: 353 YTSKIMTIDPSGRGKDETGYCV 374


>gi|297569231|ref|YP_003690575.1| hypothetical protein DaAHT2_1260 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925146|gb|ADH85956.1| conserved hypothetical protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 465

 Score = 80.4 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 47/345 (13%), Positives = 83/345 (24%), Gaps = 49/345 (14%)

Query: 23  ECVLSFKNFVMRFF--PWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKC 80
           +       F   F    W      L         Q +    +   C          + + 
Sbjct: 5   QAAQDPALFARWFKQGDWSAWFAFLSAVFGLEMNQEQ--RRIFETCTGRQKAPESPVKEA 62

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGM---------SIICIANSETQLKNTLWAEVSKW 131
            +  GR  GK+   A + ++L +              +++ +A    Q +          
Sbjct: 63  WLVVGRRGGKSFTTALIAVYLAAFHDYRQFLQPGERGTVLILAADRKQARTIF------- 115

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
                   +     L +       E             +I   T S      +       
Sbjct: 116 -------RYARAMVLEIPMLAGLLERETADGLELKNSVSIEIATAS------YRATRGYT 162

Query: 192 GMAVFNDEASGT-------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-- 242
            +A   DE +            I  +I        PN   ++ S+     G  Y  +   
Sbjct: 163 VVAALLDEIAFWFTDGANPDHEIVNAIQPGMAT-IPNAMMLVLSSPYAKQGELYRAYRES 221

Query: 243 IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI 302
              +D +       T     S     I   Y  D   A  E  GQF       F+    +
Sbjct: 222 FGADDPEVLVWQADTKTMNPSVPDRIIQRAYDRDPAAAAAEYGGQFRDDLE-QFVSREVV 280

Query: 303 EEAMS---REAIDDLYAPLIMGCDIAGEGGDKTVVVF--RRGNII 342
           +        E             D +G   D   +    R G+ +
Sbjct: 281 DSCTREEPTELPPISSNRYYGFTDPSGGSADSMTLAISHREGDRV 325


>gi|158337379|ref|YP_001518554.1| hypothetical protein AM1_4258 [Acaryochloris marina MBIC11017]
 gi|158307620|gb|ABW29237.1| conserved domain protein [Acaryochloris marina MBIC11017]
          Length = 476

 Score = 80.4 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 48/345 (13%), Positives = 98/345 (28%), Gaps = 61/345 (17%)

Query: 38  WGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS-AGRGIGKTTLNAW 96
           W   G  L+ F     WQ + ++ ++         S     K ++   GR +G + L   
Sbjct: 41  WIKSGGSLKQFILWD-WQKDVVDWIEEPQ------SLSDSPKLSVIIKGRQLGLSQLCCS 93

Query: 97  MMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAE 156
             L+          + I+ +++              S L      EM S +         
Sbjct: 94  WFLYKAWQNSAWVGVIISRTQSD-------------SSLLASRMREMASTAGLVDFSTDS 140

Query: 157 LLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN-THGMAVFNDEASGTPDI--INKSILG 213
           LL+  +      +  +                       +  DEA+   ++     +   
Sbjct: 141 LLKLEISGGGTLHFRSA---------AVDAVRGIDSVSGILFDEAAFQTNLKLSLSAATP 191

Query: 214 FFTELNPNRFWIMTSNTRRLNGWFYDIFN-----------------IPLEDWK------R 250
             +++  +   I+ S     +G F+D  N                  P+  W+       
Sbjct: 192 AMSQVGSDARIILCSTPNGASGHFFDTLNGFDNCVSDIERIRSGELPPVNKWQREDGNIA 251

Query: 251 YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREA 310
             I  ++V G +  + E +     L       E       +  +       +  A + E 
Sbjct: 252 IAIHWKSVYGDNPSYLEDLEKSLSLPKAQIAQEYDLS-LTESSSVVFSFAVVRAAATGEY 310

Query: 311 ID--DLYAPLIMGCDIAGEGGDK--TVVVFRRGNIIEHIFDWSAK 351
                      +G D AG G D   +V + + G        +  +
Sbjct: 311 EPQFTEDELYYVGVDPAGSGADYFCSVFLKKTGETFTVSKLYRKR 355


>gi|209548746|ref|YP_002280663.1| phage terminase, large subunit, PBSX family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534502|gb|ACI54437.1| phage terminase, large subunit, PBSX family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 424

 Score = 80.4 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 36/320 (11%), Positives = 86/320 (26%), Gaps = 45/320 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIA 114
           Q++  E              P  +K A   GRG  K+     +++ + + +P   I+C  
Sbjct: 3   QIQIPEKFAPFLE-------PHRYKTAY-GGRGGAKSHTIGGLLVHIAARQPEF-IVCGR 53

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
             +  ++++++  +               ++          +  + S+           +
Sbjct: 54  EFQNSIEDSVYRLL---------------ENTIKKDGLTDYKFTKTSIENTRTGSEFVFK 98

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
             S+    +           ++ +E     +    +++           W    N   + 
Sbjct: 99  GLSKLDGVSIKSLEGATK--LWIEEGQNITNGTLNNVIPTIRTEGSE-IWTSF-NPSVIE 154

Query: 235 GWFYDI-FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRY-GLDSDVARIEILGQFPQQE 292
              +      P  D    +++            E     +  +D         G      
Sbjct: 155 APVWQRLVVKPPPDSVVVKVNHNDNPWFPKVLEEERRHHFVTMDRATYDNIWEGVPMAFT 214

Query: 293 VNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDI--AGEG-GDKTVVVFRR---GNIIE 343
                        ++    +   D   P+I   D+  A  G GD   + F +   G  + 
Sbjct: 215 AGAIFREEMAAMEKQGRIGKVPHDPTKPVIAVFDMGHAASGKGDPHAITFVQQGNGTAVN 274

Query: 344 HIFDWSAKLIQETNQEGCPV 363
            I  W        N +  P 
Sbjct: 275 AIGYWEG------NNKPLPT 288


>gi|194430118|ref|ZP_03062621.1| gp33 TerL [Escherichia coli B171]
 gi|215487586|ref|YP_002330017.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|260845222|ref|YP_003223000.1| putative terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|194411828|gb|EDX28147.1| gp33 TerL [Escherichia coli B171]
 gi|215265658|emb|CAS10061.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|257760369|dbj|BAI31866.1| predicted terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|309702924|emb|CBJ02255.1| putative phage gp33 TerL [Escherichia coli ETEC H10407]
 gi|323159191|gb|EFZ45181.1| gp33 TerL [Escherichia coli E128010]
          Length = 540

 Score = 80.4 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/267 (11%), Positives = 69/267 (25%), Gaps = 19/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G +     +   L      M I   +  E  + ++     + +           ++ 
Sbjct: 101 REMGLSWTAIGLACSLCLFNKEMVIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEF 159

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
                   +A  +                    +                  DEA+    
Sbjct: 160 RGSWSEKKHAPYMRVEFP---------ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQR 210

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
            +        T        I  S+   +   F    +        +    R     D  +
Sbjct: 211 PLLIDAALSQTTRCR----IDLSSVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEW 264

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +     +   +  V   E+   +        IP  +++ A+              +   D
Sbjct: 265 YRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMD 323

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G ++E++ +WS 
Sbjct: 324 VADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|324114526|gb|EGC08494.1| hypothetical protein ERIG_00518 [Escherichia fergusonii B253]
          Length = 540

 Score = 80.0 bits (195), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 40/356 (11%), Positives = 87/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  + E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     +   L   +  M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGNRENGITEKSREMGLSWTAIGLACSLCLFKKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R     D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP  +++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|83308162|emb|CAJ29395.1| gp19 protein [Enterobacteria phage K1F]
          Length = 586

 Score = 80.0 bits (195), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 46/387 (11%), Positives = 92/387 (23%), Gaps = 91/387 (23%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           LM A     F  F+  F  W     P+     P R Q++  + +    +           
Sbjct: 11  LMTARMKADFVFFL--FVLWKALSLPV-----PTRCQIDMAKKLSAGDNR---------- 53

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  + A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + ++P  
Sbjct: 54  RFILQAFRGIGKSFITCAFVVWKLWNNPDLKFMIVSASKERADANSIF-IKRIIDLMPQL 112

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P+     
Sbjct: 113 KELKPKQGQRDAVISFDVGPAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQ 172

Query: 188 HNTHGMAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
                ++    E                P                   W      R    
Sbjct: 173 AARDRLSELVKEFDAILKPGGTIIYLGTPQNEMTLYRELEGRGYTTTIWPARY-PRDRKD 231

Query: 236 WFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           W      +         ED + +          D    +     YG      +  +    
Sbjct: 232 WQSYGDRLAPMLQAELEEDPESFYWRPTDEVRFDDTDLKERELSYGKAGFALQFML---N 288

Query: 289 PQQEVNNFIPHNYIE----------EAMSREAIDDL------------------------ 314
           P        P    +            M  + + +                         
Sbjct: 289 PNLSDAEKYPLKLRDLIVADLDPASSPMVYQWLPNPQNKREDVPNVGLMGDSYHTYQTVG 348

Query: 315 -----YAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 349 SAFSSYTQKILVIDPSGRGKDETGYAV 375


>gi|39934961|ref|NP_947237.1| terminase GTA [Rhodopseudomonas palustris CGA009]
 gi|39648812|emb|CAE27333.1| probable large terminase, Rhodobacter capsulatus GTA orfg2
           homologue [Rhodopseudomonas palustris CGA009]
          Length = 386

 Score = 80.0 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 40/264 (15%), Positives = 72/264 (27%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLI------STRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +  ++      +TRP   I  +  S    +  +    S  L + 
Sbjct: 1   MLGGRGAGKTRAGAEWVRAMVAGTPPYATRPHGRIALVGESWHDAREVMVEGESGLLRIT 60

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P R   E  +                                    D           A 
Sbjct: 61  PRRERPEWIATRKRLE------------------WPNGAVGEVFSADDPDSLRGPQFEAA 102

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +       +  R   + + T R       +   P         
Sbjct: 103 WCDELAKWRYAEASFDMLQFGLRLGSRPRQ--LITTTPRPLPLIKRLLGDPHTR-VTRAP 159

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +   F E +++RY       R E+ G+  +   +     + IE A  R A   
Sbjct: 160 TRANAAHLSPAFLETVVARYAGT-RQGRQELDGELIEDRPDALWSRDRIERA--RVAAAP 216

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
               +++  D    +  G D   +
Sbjct: 217 PLVRIVVAIDPPGSSRPGADACGI 240


>gi|262279834|ref|ZP_06057619.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260185|gb|EEY78918.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 416

 Score = 80.0 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 80/288 (27%), Gaps = 40/288 (13%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI------ICIANSETQLKNTLWAEVSK 130
            F+ A+  GR  GKT L    M          ++         A +  Q K   W  + +
Sbjct: 9   RFRDAVC-GRRFGKTFLAKAEMRRAARLAAKWNVSVEDEIWYAAPTFKQAKRVFWKRLKQ 67

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
            +                          E S+ + S H             D +     +
Sbjct: 68  AIPASW--------------RAGKPNETECSITLRSGHVIRVVGL------DNYDDLRGS 107

Query: 191 HGMAVFNDEASGTPDIIN-KSILGFFT-------ELNPNRFWIMTSNTRRLNGWFYDIFN 242
               +  DE +        + +    +        +      ++   T +     YD F 
Sbjct: 108 GLFFLIIDEWADCKWAAWEEVLRPMLSTCKYVVNGVQRVGGHVLRIGTPKGFNHCYDTFM 167

Query: 243 --IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
              P  +         +++G +    E I+++  +D      E    F   +   F   N
Sbjct: 168 DGQPGHEPDCKSFSYTSLQGGNIPESEIIVAKRKMDPKTFSQEYEASFESYQGVIFYCFN 227

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDW 348
            +  A +          L +G D         VV  RRG  +  + ++
Sbjct: 228 RLLSASTETVQ--ANDVLHVGMDFNVT-KMAAVVYVRRGEQMHAVDEF 272


>gi|110680226|ref|YP_683233.1| hypothetical protein RD1_3034 [Roseobacter denitrificans OCh 114]
 gi|109456342|gb|ABG32547.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 456

 Score = 80.0 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 37/291 (12%), Positives = 75/291 (25%), Gaps = 35/291 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q++  +    S  L+ 
Sbjct: 63  VIMGGRGAGKTRAGAEWVRAQVEGARPLDEGRSRRVALVGETIEQVREVMIFGDSGILAC 122

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                               +        G       A
Sbjct: 123 SPPDRRPVWEAGRKRL------------------VWPNGAIATIHSAFDPEGLRGPQFDA 164

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  +  +    T R  G    +   P      + 
Sbjct: 165 AWVDELAKWKKAQDTWDMLQFALRLGDKPQVCVT--TTPRNVGVLKTLMKSPST-VSSHA 221

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G   +           IE    R    
Sbjct: 222 PTEANAANLARSFLEEVRARYAGT-RLGRQELDGVLLEDAEGALWTTAGIEG--IRCEQA 278

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                +++  D    +G   D+  ++     +     DW A ++ +   +G
Sbjct: 279 PELDRIVVAVDPSTTSGANSDECGIIVAGVKMAGAPQDWRAYVLADCTVQG 329


>gi|254465926|ref|ZP_05079337.1| phage DNA Packaging Protein [Rhodobacterales bacterium Y4I]
 gi|206686834|gb|EDZ47316.1| phage DNA Packaging Protein [Rhodobacterales bacterium Y4I]
          Length = 428

 Score = 80.0 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 76/303 (25%), Gaps = 35/303 (11%)

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNT 123
               +       I  GRG GKT   A  +  L              I  +A +  Q+++ 
Sbjct: 24  QRPPDGDWRAWVILGGRGAGKTRAGAEWVRSLAEGARPHDPGTARRIALVAETYDQVRDV 83

Query: 124 LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDT 183
           +    S  L+  P     + ++                                      
Sbjct: 84  MIHGDSGILACSPPDRRPKWKASERKL------------------IWPNGAEAQAFSAHD 125

Query: 184 FVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF 241
                     A + DE +           +          R  +    T R       + 
Sbjct: 126 PEALRGPQFDAAWADELAKWRKGQESWDMLQFALRLGQDPRVCVT--TTPRNAPVLKRLL 183

Query: 242 NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
             P    + +         +   F E + SRY     + R E+ G               
Sbjct: 184 ASPST-VQTHAATEANRANLAPSFLEEVRSRYAGT-RLGRQELDGVMLSDIQGALWTTAA 241

Query: 302 IEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQ 358
           + EA   EA       +++  D    AG+  D   +V           DW A ++ +   
Sbjct: 242 LVEAQVAEAPP--LDRVVVAVDPAVSAGKDSDACGIVVAGAVTRGKPQDWQAYVLADCTV 299

Query: 359 EGC 361
           +G 
Sbjct: 300 QGV 302


>gi|114569469|ref|YP_756149.1| hypothetical protein Mmar10_0918 [Maricaulis maris MCS10]
 gi|114339931|gb|ABI65211.1| protein of unknown function DUF264 [Maricaulis maris MCS10]
          Length = 450

 Score = 79.6 bits (194), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 43/315 (13%), Positives = 85/315 (26%), Gaps = 31/315 (9%)

Query: 31  FVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIG 89
           FV  F+   ++ +      +  R + + +     H  +      P  +   +   GRG G
Sbjct: 13  FVDTFWMQTMRERERAWHKEADRQERDAIHTDFRHRATGPQLPPPGEWLTWLFLGGRGAG 72

Query: 90  KTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLH 149
           KT   A  +      R    I  +  +   ++  +             +H         +
Sbjct: 73  KTRAGAEWVRHRAL-RTVSRIALVGPTFNDVREVMIE------GPSGLKHLGSAMERPRY 125

Query: 150 PSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDII-- 207
            +               +    +         +   G         + DE +  PD    
Sbjct: 126 EA------------SRKRLVFPSGSQAYAFSAEDADGLRGPQFDYAWGDEFAAWPDPQRV 173

Query: 208 NKSILGFFTELNPNRFWIMTSNTRRLNGWF---YDIFNIPLEDWKRYQIDTRTVEGIDSG 264
             ++          R  I+ + T R           ++        +Q        +  G
Sbjct: 174 LDTLRMGVRLGGAPR--ILLTTTPRPIPALKALVKAWDPRGPIRVTHQPTAANAANLAPG 231

Query: 265 FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI 324
           F E + + YG  S + R E+ G               IE A            +++  D 
Sbjct: 232 FVEALNAAYGG-SMLGRQEVEGLLIDDPDGALWTRPKIEAARLAAGQMPELDRIVVALDP 290

Query: 325 AGEGG---DKTVVVF 336
              GG   D+  +V 
Sbjct: 291 PATGGPRSDECGIVV 305


>gi|255262025|ref|ZP_05341367.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104360|gb|EET47034.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 510

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/267 (10%), Positives = 56/267 (20%), Gaps = 35/267 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWL------ISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +         +   P   +  +  +  Q +  +    S  L+ 
Sbjct: 11  VILGGRGAGKTRAGAEWVRAQVEGSGPLDVGPATRVALVGETIEQAREVMVFGESGILAC 70

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P        +                                                A
Sbjct: 71  SPDDRRPVWSTTRRQL------------------CWPNGAVAQLFSASDPERLRGPQFDA 112

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  R  +    T R  G    +  +         
Sbjct: 113 AWVDELAKWKKGQEAWDMLQFGMRLGDDPRVCVT--TTPRNVGVLRSL--LARSSTVTAH 168

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
             T       +      +      + + R E+ G               +E +       
Sbjct: 169 GTTEANAAHLADAFLDEVRTRYAGTRLGRQELDGVLLADAEGALWTSKGLEASHVEVVP- 227

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF 336
                +++  D       G D   ++ 
Sbjct: 228 -QCDRVLVSVDPPVTGHMGSDDCGIIV 253


>gi|83945577|ref|ZP_00957923.1| Phage DNA Packaging Protein [Oceanicaulis alexandrii HTCC2633]
 gi|83850943|gb|EAP88802.1| Phage DNA Packaging Protein [Oceanicaulis alexandrii HTCC2633]
          Length = 410

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 38/274 (13%), Positives = 76/274 (27%), Gaps = 31/274 (11%)

Query: 68  SNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPGMS-IICIANSETQLKNTLW 125
            +     P  ++  +   GRG GKT   A  +      + G   I  +A + + ++  + 
Sbjct: 21  RDAQKPPPGDWRIWLFLGGRGAGKTRAGAEWI--RAQVKAGCRRIALVAPTFSDVREVMV 78

Query: 126 AEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFV 185
           +  S +L++         ++                                    +   
Sbjct: 79  SGPSGFLNIGEEDERPRYEASRHRL------------------IWPNGAEAHGFSSEDPD 120

Query: 186 GPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI 243
           G         + DE +    P      +          R  I    T R           
Sbjct: 121 GLRGPQFDCAWVDEFAAWTRPQETLDMLGLGLRLGEDPRLMIT--TTPRPI-PALKALLK 177

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
                  +         +  GF   +  RYG  S +AR E+ G             + I+
Sbjct: 178 QAGVVMTHAATEANAANLAPGFVAAMTDRYG-ASRLARQELEGVLIDDPDGALWTRDLID 236

Query: 304 EAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF 336
           +A+   A +     +++  D  A   GD+  ++ 
Sbjct: 237 QALGLPAFEPE--RVVVAVDPPASATGDECGIIV 268


>gi|163742707|ref|ZP_02150092.1| terminase, large subunit, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383962|gb|EDQ08346.1| terminase, large subunit, putative [Phaeobacter gallaeciensis 2.10]
          Length = 417

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 42/292 (14%), Positives = 79/292 (27%), Gaps = 35/292 (11%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +  L              I  +  +  Q+++ +    S  L+ 
Sbjct: 24  VILGGRGAGKTRAGAEWVRTLAEGATPLSAGRARRIALLGETYDQVRDVMVQGDSGLLAC 83

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                             T                  A
Sbjct: 84  TPRDRRPTWKATERRL------------------IWPNGATAQAFSAHDPEALRGPQFDA 125

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  R  +    T R  G   ++   P    + + 
Sbjct: 126 AWADELAKWKRGQDSWDMLQFALRLGDDPRVCVT--TTPRNVGVLRELLASPST-VQTHA 182

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   + + F   + +RY   S + R E+ G   Q        +  +  A    A  
Sbjct: 183 ATEANRANLAASFLAEVRNRYAG-SRLGRQELDGILLQDIEGALWTNAGLVAAQI--AKA 239

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGC 361
                +++  D    AG+  D   +V     +     DW A ++ +   +G 
Sbjct: 240 PTLDRVVVAVDPAVSAGKHSDACGIVVVGATLQGPPQDWCAYVLADCTVQGV 291


>gi|194100357|ref|YP_002003787.1| gp19 [Enterobacteria phage EcoDS1]
 gi|193201352|gb|ACF15831.1| gp19 [Enterobacteria phage EcoDS1]
          Length = 587

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 46/387 (11%), Positives = 92/387 (23%), Gaps = 91/387 (23%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           LM A     F  F+  F  W     P+     P R Q++  + +    +           
Sbjct: 11  LMTARMKADFVFFL--FVLWKALSLPV-----PTRCQIDMAKKLSAGDNR---------- 53

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  + A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + ++P  
Sbjct: 54  RFILQAFRGIGKSFITCAFVVWKLWNNPDLKFMIVSASKERADANSIF-IKRIIDLMPQL 112

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P+     
Sbjct: 113 QELKPKQGQRDAVISFDVGPAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQ 172

Query: 188 HNTHGMAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
                ++    E                P                   W      R    
Sbjct: 173 AARDRLSELVKEFDAILKPGGTIIYLGTPQNEMTLYRELEGRGYTTTIWPARY-PRDKKD 231

Query: 236 WFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           W      +         ED + +          D    +     YG      +  +    
Sbjct: 232 WQSYGDRLAPMLQAELEEDPESFYWRPTDEVRFDDTDLKERELSYGKAGFALQFML---N 288

Query: 289 PQQEVNNFIPHNYIE----------EAMSREAIDDL------------------------ 314
           P        P    +            M  + + +                         
Sbjct: 289 PNLSDAEKYPLKLRDLIVADLDPSSSPMVYQWLPNPQNKREDVPNVGLMGDSYHTYQTVG 348

Query: 315 -----YAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 349 SAFSSYTQKILVIDPSGRGKDETGYAV 375


>gi|307294267|ref|ZP_07574111.1| hypothetical protein SphchDRAFT_1737 [Sphingobium chlorophenolicum
           L-1]
 gi|306880418|gb|EFN11635.1| hypothetical protein SphchDRAFT_1737 [Sphingobium chlorophenolicum
           L-1]
          Length = 438

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 32/257 (12%), Positives = 65/257 (25%), Gaps = 22/257 (8%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           + AGRG GKT   A  +  +    P   I  +  +  + +  +    S  L++ P  +  
Sbjct: 57  MMAGRGFGKTRAGAEWVRSVAEGDPAARIALVGATLGEARAVMVEGASGVLAVSPWWNRP 116

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
                                              +                  + DE +
Sbjct: 117 AFLPALRKL------------------VWRNGAVATLFGAAEAESLRGPQFSHGWADEIA 158

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTV-EG 260
                                  ++ + T R       +      D    +  +      
Sbjct: 159 KWAGGQAAWDNLMMGMRLGIAPRVLATTTPRPVALVRGLVERNGSDVVVTRGRSADNASH 218

Query: 261 IDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIM 320
           +  GF   +   YG    + R E+ G+  ++        + +E            A +++
Sbjct: 219 LADGFLAAMERNYGGT-RLGRQELDGELIEEVEGALWSRDLLERCRVAHVRGT-LARVVV 276

Query: 321 GCD-IAGEGGDKTVVVF 336
             D  A   GD   +V 
Sbjct: 277 AVDPPASVHGDACGIVV 293


>gi|294011207|ref|YP_003544667.1| hypothetical protein SJA_C1-12210 [Sphingobium japonicum UT26S]
 gi|292674537|dbj|BAI96055.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 437

 Score = 79.6 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 66/256 (25%), Gaps = 20/256 (7%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           + AGRG GKT   A  +  +  + P   I  +  +  + +  +    S  L++ P     
Sbjct: 56  MLAGRGFGKTRAGAEWVRSVAESDPKARIALVGATLGEARAVMVEGASGILAVAP----- 110

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
                       +A  L        K         +                  + DE +
Sbjct: 111 ------WWNRPVFAPALR-------KLVWPNGAVATLYGAAEAESLRGPQFSHGWADEIA 157

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGI 261
                                  ++ + T R       +      D    +  T      
Sbjct: 158 KWAGGQAAWDNLMMGMRLGGAPRVLATTTPRPVPLVRGLVARAGGDVVVTRGRTADNVAH 217

Query: 262 DSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMG 321
            +      + R    + + R E+ G+  ++        + +E              +++ 
Sbjct: 218 LADGFLAAMERSYGGTRLGRQELDGELIEEVEGALWSRDLLERCRVAHVR-GGLTRVVVA 276

Query: 322 CD-IAGEGGDKTVVVF 336
            D  A   GD   +V 
Sbjct: 277 VDPPASAHGDACGIVV 292


>gi|239828154|ref|YP_002950778.1| hypothetical protein GWCH70_2829 [Geobacillus sp. WCH70]
 gi|239808447|gb|ACS25512.1| conserved hypothetical protein [Geobacillus sp. WCH70]
          Length = 534

 Score = 79.6 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 64/436 (14%), Positives = 120/436 (27%), Gaps = 124/436 (28%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M + ++ ++KL+  +++  + A+      NF+         G  +     P   Q +FM 
Sbjct: 1   MAKRLTKEEKLKIIMNDFKLFAK------NFIKIV---DNNGDTVPFVLNPE--QEQFMG 49

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +  +                I  GR IG TTL+   ML+   T+P  + I + +    +
Sbjct: 50  QMGKYN--------------IILKGRQIGFTTLSLAYMLYSACTKPDTNYIIMTH-HASV 94

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
             +L+ ++ K    LPH  + +     L P        E  +   S+    T +      
Sbjct: 95  SKSLFVKLKKMYRSLPHEKYPD-----LFPKALLNNRDELYLQNGSRVIIATAQGEDVIS 149

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF--TELNPNRFWIMTSNTRRLNGWFY 238
            +TF   H          E +  P  +   I+              I+  +T      + 
Sbjct: 150 GNTFQLIH--------LSEMAKYPQDVQDEIIATCIPALAKNESSSIIIESTAYGYNTYQ 201

Query: 239 DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------------ 286
           ++F     D +           +   + +     +       R    G            
Sbjct: 202 EMFMKAYRDKESVWKAHFYS-WLAKAYEKQFKHTFDEAEAWFRANNQGRRMTYEDLDHDE 260

Query: 287 -------------------------------QFPQQEVNNF------------------I 297
                                          +FP      F                   
Sbjct: 261 KILKDKYGATYRQLMFRRYYIATNSLDKFKREFPTTPDEAFAESNKSIFDTNKIIERLQY 320

Query: 298 PHNYIEEAMSREAIDDLYAPLI-----------------MGCDIA-GEGG--DKTVVVFR 337
               IE     + + D+  P I                  G D+A G GG  D T +   
Sbjct: 321 VIQPIETKEIYDILPDVLKPYINKNLFIYHLPKPKVRHYAGVDVASGTGGNNDYTAISIL 380

Query: 338 RGNIIEHIFDWSAKLI 353
             +  + +  W +  I
Sbjct: 381 DADG-QQVASWYSNDI 395


>gi|325292327|ref|YP_004278191.1| large terminase phage packaging protein [Agrobacterium sp. H13-3]
 gi|325060180|gb|ADY63871.1| large terminase phage packaging protein [Agrobacterium sp. H13-3]
          Length = 419

 Score = 79.6 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 73/288 (25%), Gaps = 35/288 (12%)

Query: 55  QLEFMEAVDV--HCHSNVNNSNPTIFKCAIS-AGRGIGKTTLNAWMM--LWLISTRPGMS 109
           Q +    +       +         ++  +   GRG GKT   A  +  +     +  + 
Sbjct: 11  QKQVFTLLRDWRFIGNLPQQPPEGDWRTWLLIGGRGSGKTRAGAEWVHRIASAGKQSDLR 70

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLP-HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
           I  +A +    +  +   +S    +    R  FE+    L                    
Sbjct: 71  IALVAETLGDAREVMIDGISGICRIARRCRPAFEVSRRRL-------------------- 110

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIM 226
                        +             + DE      P      +          R  + 
Sbjct: 111 IWPNGAMAQVFSSEDPESLRGPQFHMAWADELGKWKYPQETWDMLQFGLRLGEAPRQLVT 170

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
              T R       +   P              + +  GF + +  RYG    + R EI G
Sbjct: 171 --TTPRPIPLLKALLADPSSR-VAKMPTAMNAQNLSPGFLKAMHDRYGGT-RLGRQEIGG 226

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTV 333
           +   +          +E  +  +      A +++  D  AG G +   
Sbjct: 227 ELIDEREGALWKRADLEAIVETDHEP--LARIVVAVDPPAGIGENSCC 272


>gi|251778523|ref|ZP_04821443.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243082838|gb|EES48728.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 448

 Score = 79.2 bits (193), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/278 (12%), Positives = 79/278 (28%), Gaps = 22/278 (7%)

Query: 60  EAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
           +++    +     +  T F      G G GK+      M+      P    + I      
Sbjct: 25  KSIFNDAYLPQLQNYQTRFNI-YYGGAGSGKSHFVVQKMILKYLEYPNRKCLVIRKVGNS 83

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
           L+++++       ++L   H  E   +              S+ + +    I       E
Sbjct: 84  LRDSIFELFK---TVLSDWHLLERCEIRDSL---------LSITLPNGSTFIFKGLDDSE 131

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYD 239
           +  +       +   +  +E +         +       N      +  N    + W Y+
Sbjct: 132 KIKSI-----ANIDDIVVEECTEIDKQEFSQLGLRLRSKNGYNQIHVMFNPISKSNWVYE 186

Query: 240 IF---NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           ++        D    +   +  + +   +   +I     D    RI  LG+F   +   +
Sbjct: 187 MWFQNGYDESDTMVLKTTYKDNKFLPYDYINALIKMKETDPVYYRIYALGEFASLDKLIY 246

Query: 297 IPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
                ++    +      YA    G D  G   D +  
Sbjct: 247 TNWEELDFDWRKLMQQRPYAKACFGLDF-GYVNDPSAF 283


>gi|86138748|ref|ZP_01057320.1| terminase, large subunit, putative [Roseobacter sp. MED193]
 gi|85824395|gb|EAQ44598.1| terminase, large subunit, putative [Roseobacter sp. MED193]
          Length = 417

 Score = 79.2 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 77/313 (24%), Gaps = 38/313 (12%)

Query: 62  VDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLIST------RPGMSIICIA 114
           +               ++  +   GRG GKT   A  +   +          G  +  I 
Sbjct: 4   LFEFWAHAHQLPPSGEWRTWVILGGRGAGKTRAGAEWIRTQVEGATPLGPGRGRRLALIG 63

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
            +  Q+++ +    S  L+  P     + ++                             
Sbjct: 64  ETYDQVRDVMILGDSGILACSPSDRRPQWKAGERKL------------------IWANGA 105

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRR 232
                                + DE +           +       +  R  +    T R
Sbjct: 106 MAQAFSAHDPEALRGPQFDTAWADELAKWRRAREAWDMLQFSLRLGDDPRVCVT--TTPR 163

Query: 233 LNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
                  +   P    K +         +   F   + +RY   S + R E+ G      
Sbjct: 164 NAALLRQLLASPST-VKSHAATEANRANLAPSFLSEVRARYAG-SRLGRQELDGILLSDV 221

Query: 293 VNNFIPHNYIEEAMSREAIDDLY-APLIMGCDIA---GEGGDKTVVVFRRGNIIEHIFDW 348
                    +      +         +++  D A   G+G D   ++     +   +  W
Sbjct: 222 EGAIWRAAQL---AELQVPTAPALDRIVVAVDPAVSSGKGSDACGIIVAGACLQGPVETW 278

Query: 349 SAKLIQETNQEGC 361
            A ++ +   +G 
Sbjct: 279 RAYVLADRTVQGV 291


>gi|316934938|ref|YP_004109920.1| hypothetical protein Rpdx1_3618 [Rhodopseudomonas palustris DX-1]
 gi|315602652|gb|ADU45187.1| hypothetical protein Rpdx1_3618 [Rhodopseudomonas palustris DX-1]
          Length = 431

 Score = 79.2 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 39/264 (14%), Positives = 71/264 (26%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLI------STRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +  ++      +TRP   I  +  S    +  +    S  L + 
Sbjct: 46  MLGGRGAGKTRAGAEWVRAMVAGTPPYATRPHGRIALVGESWHDAREVMVEGESGLLRIT 105

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P R   E  +                                    D           A 
Sbjct: 106 PRRERPEWIATRKRLE------------------WPNGAVGEVFSADDPDSLRGPQFEAA 147

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +       +  R   + + T R       +   P         
Sbjct: 148 WCDELAKWRYAEASFDMLQFGLRLGSRPRQ--LITTTPRPLPLIKRLLADPHTR-VTRAP 204

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +   F E +++RY       R E+ G+  +   +     + IE A  R     
Sbjct: 205 TRANAAHLSPAFLETVVARYAGT-RQGRQELDGELIEDRPDALWSRDRIERA--RVGAAP 261

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
               +++  D    +  G D   +
Sbjct: 262 PMVRIVVAIDPPGSSRPGADACGI 285


>gi|163731339|ref|ZP_02138786.1| hypothetical protein RLO149_18584 [Roseobacter litoralis Och 149]
 gi|161394793|gb|EDQ19115.1| hypothetical protein RLO149_18584 [Roseobacter litoralis Och 149]
          Length = 286

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 76/296 (25%), Gaps = 36/296 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q++  +    S  L+ 
Sbjct: 15  VIMGGRGAGKTRAGAEWVRAQVEGARPLDEGRSRRVALVGETIEQVREVMIFGDSGILAC 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P       ++                               +                A
Sbjct: 75  SPPDRRPVWEAGRKRL------------------VWPNGAIATIHSAFDPEELRGPQFDA 116

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +       +  +  +    T R  G    +   P      + 
Sbjct: 117 AWVDELAKWKKAQDTWDMLQFALRLGDKPQVCVT--TTPRNVGVLKTLMKSPST-VSSHA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E + +RY     + R E+ G   +           IE    R    
Sbjct: 174 PTEANAANLARSFLEEVRARYAGT-RLGRQELDGVLLEDAEGALWTTAGIEG--IRCEKA 230

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG-CPVG 364
                +++  D    +G   D+  ++     +     DW A ++ +   +G  P G
Sbjct: 231 PELDRIVVAVDPSTTSGANSDECGIIVAGVKMAGAPQDWRAYVLADCTVQGASPAG 286


>gi|224796473|ref|YP_002641230.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
 gi|224497687|gb|ACN53304.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
          Length = 450

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/289 (15%), Positives = 85/289 (29%), Gaps = 45/289 (15%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------KYSKVIFSGGIASGKTFLASYLLIKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS + L      ++ K   +L    + + +S          EL            
Sbjct: 99  NFIIGNSISLLMTNTIKQIEKICRLLGI-DYQKKKSGQSFCKIAGFELN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         +L    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETLLEVLKRLRKG--KSIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL-GQF 288
                 +F   +    + +K Y   T       + F E    +    S   +  +L G++
Sbjct: 200 PESPAHFFKTDYIENTDVFKTYNFTTYDNPLNSADFIETQ-EKLYKHSPAYKARVLYGEW 258

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
                ++                D  +   IM  D A   GGD T +  
Sbjct: 259 I-VNESSLFNEMIFN-------QDYEFKSPIMYIDPAFSVGGDNTAICV 299


>gi|219872451|ref|YP_002476937.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
 gi|219694305|gb|ACL34832.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
          Length = 450

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 46/288 (15%), Positives = 84/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------DYSKVIFSGGIASGKTFLASYLLIKKLIENKSFYEKDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K    L    + + +S          EL            
Sbjct: 99  NFIIGNSIGLLMTNTIKQIEKICGFLGI-DYQKKKSGESFCKIAGLELN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D+F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDSFSKIRGGNSAIIYVNEATVIHKETLLEVIKRLRKG--KAIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   F    + +K Y   T       + F E     Y          + G++ 
Sbjct: 200 PEGPTHFFKTDFIENKDVFKTYNFTTYDNPLNSADFIETQKKLYKHLPAYKARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|297566322|ref|YP_003685294.1| hypothetical protein Mesil_1911 [Meiothermus silvanus DSM 9946]
 gi|296850771|gb|ADH63786.1| protein of unknown function DUF264 [Meiothermus silvanus DSM 9946]
          Length = 427

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 91/277 (32%), Gaps = 28/277 (10%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
           + + FK  + + R +GK+   +   +      P    + ++  E Q K            
Sbjct: 19  DQSRFKIGLWS-RQVGKSFAASLEAVLDCVAHPRSLWVFLSRGERQSKE--------LAE 69

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
                         ++   + AE  +  + + +    I+        P          G 
Sbjct: 70  KAQRHLEAIQVVAEMYDEPFDAESTQTVIRLPNGSRIIS-------LPANPDTARGYSGN 122

Query: 194 AVFNDEAS--GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--NIPLEDWK 249
            V  DE +       I  ++    T  +      + S  +   G FY+I+      + W 
Sbjct: 123 -VLLDEFALHKDSREIWGALYPTIT-RSKRYRLRVLSTPKGQQGKFYEIWQPEPGGDLWS 180

Query: 250 RYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSRE 309
           R+++D               + +   D  + + E L +F  +    ++P+  I    S +
Sbjct: 181 RHRVDIYDAVQQGLEVDPEELRKGLKDPVLWQQEYLLEFVDEAS-AWLPYELITSCESSQ 239

Query: 310 AIDDL--YAPLIMGCDIAGEGGDKTVVVF--RRGNII 342
           A  D      L +G DI     D +V+    R G+++
Sbjct: 240 ARTDGALEGDLYLGMDIGRH-RDLSVIWVAERVGDVL 275


>gi|291334627|gb|ADD94276.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C231]
          Length = 320

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 77/236 (32%), Gaps = 37/236 (15%)

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             K+  W  + K +                 P  W     E  + I+     I   T   
Sbjct: 1   MAKDIAWRALKKLV-----------------PKVWIHSKNETDLRIE----LINGSTIEL 39

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTP-DIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
           +  +  +         V  DEA+    ++  + I       +   + +  S       WF
Sbjct: 40  KGTENAMALRGRSLSGVVLDEAAFMDAEVWFEVIRPALA--DKEGWALFISTPDGTASWF 97

Query: 238 YDIF----NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEV 293
           YD++         +W+R+   T     +     E   ++   D+   R E    F  + +
Sbjct: 98  YDLWCYVPEDETGEWQRWSYTTIEGGNVSKHEVEAARAQL--DNRTFRQEFEASF--ENL 153

Query: 294 NNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGD-KTVVV-FRRGNIIEHIFD 347
              +  ++ +E +S+EA D    PL++G D      D  + +   + G  +    +
Sbjct: 154 TGLVAISFSDENISQEAKDISIQPLLLGVD---FNVDPMSGICAVKNGETLYVFDE 206


>gi|77118209|ref|YP_338131.1| maturation protein [Enterobacteria phage K1F]
 gi|72527953|gb|AAZ73005.1| maturation protein [Enterobacteria phage K1F]
          Length = 575

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 91/386 (23%), Gaps = 91/386 (23%)

Query: 20  MHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFK 79
           M A     F  F+  F  W     P+     P R Q++  + +    +           +
Sbjct: 1   MTARMKADFVFFL--FVLWKALSLPV-----PTRCQIDMAKKLSAGDNR----------R 43

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
             + A RGIGK+ +    ++W +   P +  + ++ S+ +        + + + ++P   
Sbjct: 44  FILQAFRGIGKSFITCAFVVWKLWNNPDLKFMIVSASKERADANSIF-IKRIIDLMPQLK 102

Query: 140 WFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPH 188
             + +         +     +       K   IT +              E P+      
Sbjct: 103 ELKPKQGQRDAVISFDVGPAKPDHSPSVKSVGITGQLTGSRADILIADDVEVPNNSATQA 162

Query: 189 NTHGMAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
               ++    E                P                   W      R    W
Sbjct: 163 ARDRLSELVKEFDAILKPGGTIIYLGTPQNEMTLYRELEGRGYTTTIWPARY-PRDRKDW 221

Query: 237 FYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +         ED + +          D    +     YG      +  +    P
Sbjct: 222 QSYGDRLAPMLQAELEEDPESFYWRPTDEVRFDDTDLKERELSYGKAGFALQFML---NP 278

Query: 290 QQEVNNFIPHNYIE----------EAMSREAIDDL------------------------- 314
                   P    +            M  + + +                          
Sbjct: 279 NLSDAEKYPLKLRDLIVADLDPASSPMVYQWLPNPQNKREDVPNVGLMGDSYHTYQTVGS 338

Query: 315 ----YAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 339 AFSSYTQKILVIDPSGRGKDETGYAV 364


>gi|255321082|ref|ZP_05362250.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262379515|ref|ZP_06072671.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
 gi|255301852|gb|EET81101.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262298972|gb|EEY86885.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
          Length = 558

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/241 (13%), Positives = 64/241 (26%), Gaps = 21/241 (8%)

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
             L H+       L          + +               T + E  D          
Sbjct: 152 KTLLHKFRDMYSKLPAWMKPKG-FIEKVHDNYMRIINPDNGATVTGEAGDNIG--RGGRT 208

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
              F DE +       +++    ++       I  S    +   F+         +  + 
Sbjct: 209 TMYFLDEWAFVERQ--EAVDAAISQNTN--VHIKGSTPNGIGDKFHQD--RFSGRYAVFT 262

Query: 253 IDTRTVE--GIDSGFHEGIISRYGL------DSDVARIEILGQFPQQEVNNFIPHNYIEE 304
           +  R              +I  +        D  V   E+   +        IP  +++ 
Sbjct: 263 MAWRDNPDKNWQVELDGKLIYPWYEKQLATLDDIVLAQEVDIDYAASVEGVLIPSAWVQA 322

Query: 305 AMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS--AKLIQETNQEG 360
           A+        +         D+A EG DK     R G +++++  WS     I  T Q+ 
Sbjct: 323 AVDAHIKLGIEPSGERNGALDVADEGKDKNSFAARHGIVLQYLDTWSGIGDDIFGTTQKA 382

Query: 361 C 361
            
Sbjct: 383 I 383


>gi|291296347|ref|YP_003507745.1| hypothetical protein Mrub_1969 [Meiothermus ruber DSM 1279]
 gi|290471306|gb|ADD28725.1| protein of unknown function DUF264 [Meiothermus ruber DSM 1279]
          Length = 426

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 81/270 (30%), Gaps = 27/270 (10%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           + FK  + + R  GK+   +   +       G   I ++  E Q                
Sbjct: 20  SRFKIGLWS-RQTGKSFAASLEAVLDCLEHRGQLWIFLSRGERQSLE--------LAEKA 70

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                       LH   +     +  +   +    I+        P          G  V
Sbjct: 71  KRHCEAIRAVAELHQEQFDVATKQYVIQFPNGSRIIS-------LPANPDTARGYSGS-V 122

Query: 196 FNDEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQ 252
             DE         I  +I    T  N      + S     +G F++++   P + W R++
Sbjct: 123 LLDEFGFHQDSREIWGAIYPTIT-RNERYRIRVISTPNGQSGKFWELWQGGPGDVWSRHR 181

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA----MSR 308
           +D              ++ +   D    + E L +F ++    ++P++ +          
Sbjct: 182 VDIYDAVKEGLAIDPEVLRQGIRDPLKWQQEYLLEFVEEN-TAWLPYDLLATCESELART 240

Query: 309 EAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           +   +    L +G DI  +  D +V+    
Sbjct: 241 DGELEREGELYLGMDIGRQ-RDLSVIWVIE 269


>gi|326536951|ref|YP_004306358.1| DNA packaging protein B [Pseudomonas phage phiIBB-PF7A]
 gi|318054527|gb|ADV35703.1| DNA packaging protein B [Pseudomonas phage phiIBB-PF7A]
          Length = 588

 Score = 78.4 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 47/399 (11%), Positives = 95/399 (23%), Gaps = 91/399 (22%)

Query: 24  CVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAIS 83
              SF  F+  F  W     P+     P + Q+   + +                +  + 
Sbjct: 14  LKGSFVAFL--FVLWAALNLPV-----PTKQQISMSKKLAAGDSR----------RFILQ 56

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM 143
           A RGIGK+ +    ++W +   P + I+ ++ ++ +        + + + +LP  H  + 
Sbjct: 57  AFRGIGKSFITCAFVVWKLWNNPDLKIMIVSANKDRADANSVF-IKRIIDLLPFLHELKP 115

Query: 144 QS-----------LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           ++               P    +       G  +            E P           
Sbjct: 116 RAGQRDSSLSFDVGPARPDHSPSVKSVGVTGGMTGSRADILIADDVEVPGNSGTQSARDH 175

Query: 193 MAVFNDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNG---WF 237
           +     E                P                   W      R +     +F
Sbjct: 176 LGELVKEFDAILKPDGTIIYLGTPQTEMTLYRELEDRGYSTTIWPARY-PRDVADLESYF 234

Query: 238 YDIFNIPLEDWKRYQ---------IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ- 287
           +   N    D                       D          YG      +  +    
Sbjct: 235 HAKGNRSRLDPTMLAELEADSRLFWKPTDPVRFDDEDLRERELSYGKGGFALQFMLNPNL 294

Query: 288 -----FPQQEVNNFIPHNYIEEA--MSREAIDD--------------------------- 313
                +P +  +  +    +E A    +   +D                           
Sbjct: 295 SDIEKYPLKLRDWIVAALDMESAPTTWQWLPNDRNEAKGLPLVGLKGDRFHRYESCGTTT 354

Query: 314 -LYAPLIMGCDIAGEGGDKTVVVF-RRGNIIEHIFDWSA 350
             Y   I+  D +G G D+T      + N    + +W  
Sbjct: 355 AKYDQKILVIDPSGRGKDETGYCVLYQLNGYIFLMEWGG 393


>gi|90419122|ref|ZP_01227033.1| phage terminase large subunit [Aurantimonas manganoxydans SI85-9A1]
 gi|90337202|gb|EAS50907.1| phage terminase large subunit [Aurantimonas manganoxydans SI85-9A1]
          Length = 411

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/279 (13%), Positives = 70/279 (25%), Gaps = 36/279 (12%)

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLI------STRPGMSIICIANSETQL 120
             +         +  +  GRG GKT   A  +  +       + RP   I  IA +    
Sbjct: 14  RRSQLPPPGHWRQWLLIGGRGSGKTRAGAEWVRAMAAGAPPIAARPHGRIALIAETLGDA 73

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           +  + A  S  ++                      E          +             
Sbjct: 74  REVMIAGESGIVAAS-------------------VEGRPVYEVSRRRLVFPNGAIAQVFS 114

Query: 181 PDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
            +           A + DE +     +    ++          R   + + T R      
Sbjct: 115 SEDPDALRGYQFDAAWGDEFAKWVHGEACFDNLQFGLRLGVRPR--ALFTTTPRPI-PLL 171

Query: 239 DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP 298
                       +         +  GF   + +RYG  S + R E+ G   +   +    
Sbjct: 172 KQLMADAGTASTHMRTAENAANLAPGFLAAMEARYGG-SRLGRQELEGLMLEAREDALFD 230

Query: 299 HNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVV 334
              I+ A  R A       +++  D    A    D   +
Sbjct: 231 VAAIDAARVRVAP--ELRRVVVAVDPPATATTRSDACGI 267


>gi|317153313|ref|YP_004121361.1| hypothetical protein Daes_1602 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943564|gb|ADU62615.1| hypothetical protein Daes_1602 [Desulfovibrio aespoeensis Aspo-2]
          Length = 507

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/253 (13%), Positives = 67/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +  +  +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCLARNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +++  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DSIIEEIEYQLDTNPDLMNSIAVTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDSFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                     + S    L    Y       + +  ++  +             ++    G
Sbjct: 178 KTGG---ILRIYSTPNGLRDTTYYRLTS-SDQFHVFRWPSWLNPLWTEDRESELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|85375635|ref|YP_459697.1| Phage DNA packaging protein [Erythrobacter litoralis HTCC2594]
 gi|84788718|gb|ABC64900.1| Phage DNA Packaging Protein [Erythrobacter litoralis HTCC2594]
          Length = 450

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 80/278 (28%), Gaps = 30/278 (10%)

Query: 68  SNVNNSNPTIFKCA-ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
            +        ++   I AGRG GKT   A  +  +        I  +  S  ++++ +  
Sbjct: 49  RDEQQPPEGPWRVWLICAGRGFGKTRAGAEWVRNVARHDGEARIALVGASLVEVRSVMVE 108

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
             S  L+  P               G  A   E S+             YS   P++   
Sbjct: 109 GESGVLAASP---------------GALAPEFEPSLRRLQWPNGAQAFLYSAGEPES--- 150

Query: 187 PHNTHGMAVFNDEASGTPD------IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
                    + DE +   +          ++       +  R  ++ + T R       +
Sbjct: 151 LRGPQHTHAWCDEIAKWDNAGLRALAAWDNLQMGMRLGDHPR--VLATTTPRTVALMQRL 208

Query: 241 FNIPLEDWKRY-QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPH 299
           +           Q  T    G+    +   +      + + R E+ G+  ++        
Sbjct: 209 YAEVESGAVVLAQGKTEDNAGVLPTAYFEAMLDQYGATSLGRQELEGEMLEEVDGALWSR 268

Query: 300 NYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF 336
             +E+             +++G D  A   GD   +V 
Sbjct: 269 ALLEQCR-TAGTGAERIRVVVGVDPPASSSGDACGIVV 305


>gi|297247965|ref|ZP_06931683.1| phage DNA packaging protein [Brucella abortus bv. 5 str. B3196]
 gi|297175134|gb|EFH34481.1| phage DNA packaging protein [Brucella abortus bv. 5 str. B3196]
          Length = 415

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 78/295 (26%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 6   RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 65

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 66  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 108

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 109 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPR-Q 165

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           ++T+  R +                 +         +  GF + I  RY     + R E+
Sbjct: 166 VVTTTPRAV--PLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 222

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 223 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 275


>gi|183600815|ref|ZP_02962308.1| hypothetical protein PROSTU_04416 [Providencia stuartii ATCC 25827]
 gi|188019600|gb|EDU57640.1| hypothetical protein PROSTU_04416 [Providencia stuartii ATCC 25827]
          Length = 413

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/274 (13%), Positives = 77/274 (28%), Gaps = 27/274 (9%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWL----ISTRPGMSIICIANSETQLKNTL 124
            V  +    ++ A   GRG  KT   A M                I+C       L+ + 
Sbjct: 14  PVFENEGVRYRGAY-GGRGSAKTRTFALMTAIRGYMAAMNGQSGVILCAREYMNSLEESS 72

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
             EV + +  +P                W ++  E                ++  R +  
Sbjct: 73  MEEVKQAIRSVP----------------WLSDFYELGEKYIRTKCRSVSYVFAGLRHNLD 116

Query: 185 VGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-I 243
                   +  + DEA    +I    +     E      W+   N  +        F   
Sbjct: 117 SIKSKARILIAWVDEAESVSEIAWTKLAPTVREAGSE-IWVTW-NPEKDGSATDKRFRKE 174

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYI 302
           P ++    +++        S   E  +S     D +       G + +      + + Y+
Sbjct: 175 PPDNAIIVEMNYDDNPWFPSVLEEERLSDQSRLDPNTYAWIWEGAYLENSDKQVLANKYV 234

Query: 303 EEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
            ++   + +      L+ G D  G   D   ++ 
Sbjct: 235 VQSF-PDDLWKQADRLLFGADF-GFAKDPNTLIR 266


>gi|322835667|ref|YP_004215693.1| terminase large subunit [Rahnella sp. Y9602]
 gi|321170868|gb|ADW76566.1| terminase large subunit [Rahnella sp. Y9602]
          Length = 539

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 51/369 (13%), Positives = 97/369 (26%), Gaps = 50/369 (13%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPL-EHFSQPH--- 52
           P      +   + L  +    E + +   F           WG+   P    F  P    
Sbjct: 12  PDYGQVFEWRMERLQRIRQQPEMLPALNAFYRDNPAQFIIDWGMTTDPRNLDFGMPVSVP 71

Query: 53  ----RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +        N              R +G +  +  +   L      M
Sbjct: 72  FLLFPKQEEWINWIMDRRSQQENGITEKS--------REMGLSWTSIGLACALCLFNKEM 123

Query: 109 SIICIANSETQLKNT-----LWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMG 163
            I   +  E  + +T     L+ +  K++ MLP        +    P             
Sbjct: 124 VIGFGSRKEEYVDSTGDPKALFWKARKFVEMLPVEFRGGWSAKKHAPYMRVEFP------ 177

Query: 164 IDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRF 223
                          +                F DEA+     +        T       
Sbjct: 178 ---------TTGAVLKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIEASLSQTTRCR--- 225

Query: 224 WIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE 283
            I  S+   +   F    +        +    R+    D  ++    ++   +  V   E
Sbjct: 226 -IDLSSVNGMANPFAQKRHG--GRIPVFTFHWRSDPRKDEAWYAKECAKI-DNPVVVAQE 281

Query: 284 ILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNI 341
           +   +        IP+ +I  A++             +   D+A EG DK     R G +
Sbjct: 282 LDLNYSASAEGVLIPNEWIRAAINAHIKLGIQPTGKRLGAMDVADEGRDKNAFSARYGFL 341

Query: 342 IEHIFDWSA 350
           +  + +WS 
Sbjct: 342 LTEVEEWSG 350


>gi|261315193|ref|ZP_05954390.1| phage DNA Packaging protein [Brucella pinnipedialis M163/99/10]
 gi|261304219|gb|EEY07716.1| phage DNA Packaging protein [Brucella pinnipedialis M163/99/10]
          Length = 329

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 78/295 (26%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 6   RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 65

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 66  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 108

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 109 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPR-Q 165

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           ++T+  R +                 +         +  GF + I  RY     + R E+
Sbjct: 166 VVTTTPRAV--PLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 222

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 223 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 275


>gi|256369024|ref|YP_003106532.1| phage terminase large subunit, putative [Brucella microti CCM 4915]
 gi|255999184|gb|ACU47583.1| phage terminase large subunit, putative [Brucella microti CCM 4915]
          Length = 384

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 69/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++        + IE+          
Sbjct: 159 AENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|17987633|ref|NP_540267.1| Phage DNA packaging protein [Brucella melitensis bv. 1 str. 16M]
 gi|260563648|ref|ZP_05834134.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260566826|ref|ZP_05837296.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|261219037|ref|ZP_05933318.1| phage DNA Packaging protein [Brucella ceti M13/05/1]
 gi|261221792|ref|ZP_05936073.1| phage DNA Packaging protein [Brucella ceti B1/94]
 gi|261321463|ref|ZP_05960660.1| phage DNA Packaging protein [Brucella ceti M644/93/1]
 gi|261324708|ref|ZP_05963905.1| phage DNA Packaging protein [Brucella neotomae 5K33]
 gi|261751918|ref|ZP_05995627.1| phage DNA Packaging protein [Brucella suis bv. 5 str. 513]
 gi|261754576|ref|ZP_05998285.1| phage DNA Packaging protein [Brucella suis bv. 3 str. 686]
 gi|265990705|ref|ZP_06103262.1| phage DNA Packaging protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994537|ref|ZP_06107094.1| phage DNA Packaging protein [Brucella melitensis bv. 3 str. Ether]
 gi|265997756|ref|ZP_06110313.1| phage DNA Packaging protein [Brucella ceti M490/95/1]
 gi|265999560|ref|ZP_05466908.2| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|17983344|gb|AAL52531.1| phage DNA packaging protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153664|gb|EEW88756.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260156344|gb|EEW91424.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|260920376|gb|EEX87029.1| phage DNA Packaging protein [Brucella ceti B1/94]
 gi|260924126|gb|EEX90694.1| phage DNA Packaging protein [Brucella ceti M13/05/1]
 gi|261294153|gb|EEX97649.1| phage DNA Packaging protein [Brucella ceti M644/93/1]
 gi|261300688|gb|EEY04185.1| phage DNA Packaging protein [Brucella neotomae 5K33]
 gi|261741671|gb|EEY29597.1| phage DNA Packaging protein [Brucella suis bv. 5 str. 513]
 gi|261744329|gb|EEY32255.1| phage DNA Packaging protein [Brucella suis bv. 3 str. 686]
 gi|262552224|gb|EEZ08214.1| phage DNA Packaging protein [Brucella ceti M490/95/1]
 gi|262765650|gb|EEZ11439.1| phage DNA Packaging protein [Brucella melitensis bv. 3 str. Ether]
 gi|263001489|gb|EEZ14064.1| phage DNA Packaging protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094670|gb|EEZ18449.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
          Length = 430

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 78/295 (26%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPR-Q 176

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           ++T+  R +                 +         +  GF + I  RY     + R E+
Sbjct: 177 VVTTTPRAV--PLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|254471818|ref|ZP_05085219.1| phage DNA Packaging Protein [Pseudovibrio sp. JE062]
 gi|211959020|gb|EEA94219.1| phage DNA Packaging Protein [Pseudovibrio sp. JE062]
          Length = 428

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/265 (10%), Positives = 65/265 (24%), Gaps = 38/265 (14%)

Query: 82  ISAGRGIGKTTLNAWMML-------WLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           +  GRG GKT      +        W  +  P  +I  +  +   ++  +   +S  L++
Sbjct: 45  LMGGRGAGKTRAGVEWVRGKTAGEPW--AGPPAGNIALVGQTYADVREVMIEGISGLLAV 102

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     +                                       +           A
Sbjct: 103 HPPNQKPQWNPSRRRLE------------------WPNGAIARAFSSEDPEALRGPQFDA 144

Query: 195 VFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DEA    +       +          +  +    T   +     +            
Sbjct: 145 AWCDEAGKWSNATETFDMLQFGLRLGTQPQQLV---TTTPKSTPLLKMLLQDQRVVVTKA 201

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F + +  RYG    + R E+ G+  +   +      + E    R    
Sbjct: 202 GTKSNAAFLAEAFLQQMAERYGGT-RLGRQELDGELIEDREDALFARKWFEMNRVRHVP- 259

Query: 313 DLYAPLIMGCDI---AGEGGDKTVV 334
                +++  D    +G+  D   +
Sbjct: 260 -ELKRIVVAIDPPATSGKSADACGI 283


>gi|62181180|ref|YP_217597.1| hypothetical protein SC2610 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62128813|gb|AAX66516.1| orf, partial conserved hypothetical protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322715669|gb|EFZ07240.1| hypothetical protein SCA50_2790 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 540

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/356 (11%), Positives = 88/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  H E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQHPEMLPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     M   L      M I   +  
Sbjct: 72  FLLFPKQEEWVHWIMERWGKRENGITEKSREMGLSWTAIGMACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R+    D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP ++++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|192291432|ref|YP_001992037.1| phage terminase, large subunit, PBSX family [Rhodopseudomonas
           palustris TIE-1]
 gi|192285181|gb|ACF01562.1| phage terminase, large subunit, PBSX family [Rhodopseudomonas
           palustris TIE-1]
          Length = 421

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/249 (14%), Positives = 61/249 (24%), Gaps = 26/249 (10%)

Query: 84  AGRGIGKTTLNAWMM----LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG GKT   A M     +          I+C       L ++ +AEV           
Sbjct: 7   GGRGSGKTRTFAKMSAVRGIDFAQAGMDGVIVCGREFMNSLADSSFAEVK---------- 56

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                  ++  + W AE  +                +   R +            ++ DE
Sbjct: 57  ------AAILSTPWLAERYDVGDTYIRTKCRRIIFVFVGLRHNLDSIKSKARIRLLWVDE 110

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRYQIDTRTV 258
           A    D      +    E      W+   N  R        F   P    K  +++ R  
Sbjct: 111 AEPVSDEAWNITIPTVREEGSE-IWLTW-NPDRKASATNKRFRENPPAGAKIVELNWRDN 168

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLY 315
                  +   +       D       G++       +         E+        D  
Sbjct: 169 PYFPEILNRTRLDDKANRPDQYGWVWEGEYRSVVAGAYYAKALTQAKEQGRITFVPLDPL 228

Query: 316 APLIMGCDI 324
             +    DI
Sbjct: 229 MQVRAYLDI 237


>gi|9632855|ref|NP_049779.1| gp17'' unknown function [Enterobacteria phage T4]
 gi|5354479|gb|AAD42686.1|AF158101_273 gp17'' unknown function [Enterobacteria phage T4]
 gi|299780524|gb|ADJ39886.1| gp17'' [Enterobacteria phage T4T]
          Length = 416

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 57/226 (25%), Gaps = 33/226 (14%)

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
            R    ++ L         E  + S+ +D+                +           ++
Sbjct: 7   DRTKQAIELLPDFLQPGIVEWNKGSIELDNGSSI-------GAYASSPDAVRGNSFAMIY 59

Query: 197 NDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED------- 247
            DE +  P+      +I    +    ++  I+ + T      FYDI+   +E        
Sbjct: 60  IDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHFYDIWTAAVEGKSGFEPY 117

Query: 248 ---WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYI- 302
              W   +       +  D G+   I +  G      R E    F               
Sbjct: 118 TAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAV 177

Query: 303 ---------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVVFRR 338
                    +    +    +     I   D + G G D   +    
Sbjct: 178 MDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIID 223


>gi|261317250|ref|ZP_05956447.1| phage DNA Packaging protein [Brucella pinnipedialis B2/94]
 gi|265988289|ref|ZP_06100846.1| phage DNA Packaging protein [Brucella pinnipedialis M292/94/1]
 gi|261296473|gb|EEX99969.1| phage DNA Packaging protein [Brucella pinnipedialis B2/94]
 gi|264660486|gb|EEZ30747.1| phage DNA Packaging protein [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/266 (13%), Positives = 70/266 (26%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 46  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 105

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 106 RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 146

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  ++T+  R +                 +  
Sbjct: 147 WCDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMR 203

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 204 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 260

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 261 PLARIVVAVDPPASSGKASDACGIVV 286


>gi|254709718|ref|ZP_05171529.1| Phage DNA packaging protein [Brucella pinnipedialis B2/94]
 gi|256031209|ref|ZP_05444823.1| Phage DNA packaging protein [Brucella pinnipedialis M292/94/1]
          Length = 411

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/266 (13%), Positives = 70/266 (26%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  ++T+  R +                 +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|194445851|ref|YP_002040314.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
 gi|194404514|gb|ACF64736.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
          Length = 540

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/356 (11%), Positives = 88/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  H E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQHPEMLPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     M   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGKRENGITEKSREMGLSWTAIGMACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R+    D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP ++++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|261213600|ref|ZP_05927881.1| phage DNA Packaging protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915207|gb|EEX82068.1| phage DNA Packaging protein [Brucella abortus bv. 3 str. Tulya]
          Length = 426

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 74/295 (25%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREMMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPRQV 177

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           +    T                    +         +  GF + I  RY     + R E+
Sbjct: 178 V---TTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|192290494|ref|YP_001991099.1| hypothetical protein Rpal_2102 [Rhodopseudomonas palustris TIE-1]
 gi|192284243|gb|ACF00624.1| protein of unknown function DUF264 [Rhodopseudomonas palustris
           TIE-1]
          Length = 386

 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/264 (15%), Positives = 71/264 (26%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLI------STRPGMSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +  ++      +TRP   I  +  S    +  +    S  L + 
Sbjct: 1   MLGGRGAGKTRAGAEWVRAMVAGTPPYATRPHGRIALVGESWHDAREVMVEGESGLLRIT 60

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P R   E  +                                    D           A 
Sbjct: 61  PRRERPEWIASRRRLQ------------------WPNGAVGEVFSADDPDSLRGPQFEAA 102

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +          R   + + T R       +   P         
Sbjct: 103 WCDELAKWRYAEASFDMLQFGLRLGARPRQ--LITTTPRPLPLIKRLLADPHTR-VTRAP 159

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +   F E +++RY       R E+ G+  +   +     + IE A  R A   
Sbjct: 160 TRANAAHLSPAFLETVVARYAGT-RQGRQELDGELIEDRPDALWSRDRIERA--RVAAAP 216

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
               +++  D    +  G D   +
Sbjct: 217 PLVRIVVAIDPPGSSRPGADACGI 240


>gi|226940437|ref|YP_002795511.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715364|gb|ACO74502.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 133

 Score = 77.7 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 54/143 (37%), Gaps = 11/143 (7%)

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           +  AN++TQL+     EV KW  +    HWF+ QS S+                 +K + 
Sbjct: 1   MITANTDTQLRTKTSPEVGKWQRLSITSHWFDPQSASIAARD----------KEHAKTWR 50

Query: 171 ITCRTYSEERPDTFVGPHNT-HGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                +SE   + F G HN    + +  DEAS   D + +   G  T+      WI   N
Sbjct: 51  ADFVPWSEHNTEAFAGLHNKGKRIVLIFDEASAIADKVWEVAEGALTDEETEIIWIAFGN 110

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQ 252
             R  G F + F          Q
Sbjct: 111 PTRNIGRFRECFRRFRHSGWIIQ 133


>gi|260754354|ref|ZP_05866702.1| phage DNA Packaging protein [Brucella abortus bv. 6 str. 870]
 gi|260674462|gb|EEX61283.1| phage DNA Packaging protein [Brucella abortus bv. 6 str. 870]
          Length = 426

 Score = 77.7 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 74/295 (25%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPRQV 177

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           +    T                    +         +  GF + I  RY     + R E+
Sbjct: 178 V---TTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|260545691|ref|ZP_05821432.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260757573|ref|ZP_05869921.1| phage DNA Packaging protein [Brucella abortus bv. 4 str. 292]
 gi|260761398|ref|ZP_05873741.1| phage DNA Packaging protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883379|ref|ZP_05894993.1| phage DNA Packaging protein [Brucella abortus bv. 9 str. C68]
 gi|260097098|gb|EEW80973.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260667891|gb|EEX54831.1| phage DNA Packaging protein [Brucella abortus bv. 4 str. 292]
 gi|260671830|gb|EEX58651.1| phage DNA Packaging protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260872907|gb|EEX79976.1| phage DNA Packaging protein [Brucella abortus bv. 9 str. C68]
          Length = 426

 Score = 77.7 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 74/295 (25%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPRQV 177

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           +    T                    +         +  GF + I  RY     + R E+
Sbjct: 178 V---TTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|306838714|ref|ZP_07471549.1| Phage DNA packaging protein [Brucella sp. NF 2653]
 gi|306406201|gb|EFM62445.1| Phage DNA packaging protein [Brucella sp. NF 2653]
          Length = 430

 Score = 77.7 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 78/295 (26%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPR-Q 176

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           ++T+  R +                 +         +  GF + I  RY     + R E+
Sbjct: 177 VVTTTPRAV--PLLKALLTDRTVSMTHMRTVENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|167993618|ref|ZP_02574712.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
 gi|205328294|gb|EDZ15058.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
          Length = 539

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/356 (11%), Positives = 88/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  H E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQHPEMLPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     M   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGKRENGITEKSREMGLSWTAIGMACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R+    D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP ++++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|161618560|ref|YP_001592447.1| hypothetical protein BCAN_A0599 [Brucella canis ATCC 23365]
 gi|225852113|ref|YP_002732346.1| hypothetical protein BMEA_A0624 [Brucella melitensis ATCC 23457]
 gi|254701380|ref|ZP_05163208.1| Phage DNA packaging protein [Brucella suis bv. 5 str. 513]
 gi|254703925|ref|ZP_05165753.1| Phage DNA packaging protein [Brucella suis bv. 3 str. 686]
 gi|254713724|ref|ZP_05175535.1| Phage DNA packaging protein [Brucella ceti M644/93/1]
 gi|254717218|ref|ZP_05179029.1| Phage DNA packaging protein [Brucella ceti M13/05/1]
 gi|256044294|ref|ZP_05447198.1| Phage DNA packaging protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060717|ref|ZP_05450881.1| Phage DNA packaging protein [Brucella neotomae 5K33]
 gi|256113127|ref|ZP_05454004.1| Phage DNA packaging protein [Brucella melitensis bv. 3 str. Ether]
 gi|256159312|ref|ZP_05457102.1| Phage DNA packaging protein [Brucella ceti M490/95/1]
 gi|256254617|ref|ZP_05460153.1| Phage DNA packaging protein [Brucella ceti B1/94]
 gi|161335371|gb|ABX61676.1| protein of unknown function DUF264 [Brucella canis ATCC 23365]
 gi|225640478|gb|ACO00392.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|326408609|gb|ADZ65674.1| Phage DNA packaging protein [Brucella melitensis M28]
 gi|326538330|gb|ADZ86545.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 411

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|331650684|ref|ZP_08351739.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331040472|gb|EGI12647.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 414

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/267 (11%), Positives = 68/267 (25%), Gaps = 19/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G +     +   L      M I   +  E  + ++     + +           ++ 
Sbjct: 47  REMGLSWTAIGLACSLCLFNKEMVIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEF 105

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
                   +A  +                    +                  DEA+    
Sbjct: 106 RGSWSEKKHAPYMRVEFP---------ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQR 156

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
            +        T        I  S+   +   F    +        +    R     D  +
Sbjct: 157 PLLIDAALSQTTRCR----IDLSSVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEW 210

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +     +   +  V   E+   +        IP  +++  +              +   D
Sbjct: 211 YRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQATVDAHIKLGIQPTGKRLGAMD 269

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G ++E++ +WS 
Sbjct: 270 VADEGRDKNAFSTRHGFLLENVREWSG 296


>gi|265983712|ref|ZP_06096447.1| terminase large subunit [Brucella sp. 83/13]
 gi|264662304|gb|EEZ32565.1| terminase large subunit [Brucella sp. 83/13]
          Length = 384

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 69/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++        + IE+          
Sbjct: 159 VENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|126739361|ref|ZP_01755054.1| terminase, large subunit, putative [Roseobacter sp. SK209-2-6]
 gi|126719461|gb|EBA16170.1| terminase, large subunit, putative [Roseobacter sp. SK209-2-6]
          Length = 433

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/291 (12%), Positives = 70/291 (24%), Gaps = 35/291 (12%)

Query: 81  AISAGRGIGKTTLNAWMML------WLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +         +ST P   +  +  +  Q+++ +    S  L+ 
Sbjct: 40  VILGGRGAGKTRAGAEWVRCQIEGATPLSTGPSRRLALVGETYDQVRDVMIQGDSGILAC 99

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     + ++                                                 
Sbjct: 100 SPKDRRPQWKAGERKL------------------LWANGAQAQAFSAHDPEALRGPQFDL 141

Query: 195 VFNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          R  I    T   N              + + 
Sbjct: 142 AWLDELAKWKRGREAWDMLQFALRLGKDPRACI---TTTPRNSQILRDVLAQSSTVQTHA 198

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F E +  RY     + R E+ G                E A  +    
Sbjct: 199 PTDANRANLAPSFLEEMKQRYAGT-RLGRQELEGCLLSDVEGALWSSA--ELAGQQCKEA 255

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG 360
                +++  D    AG+  D   ++           +W   ++ +   +G
Sbjct: 256 PELDRIVVAVDPAVSAGKASDACGILVAGARHAGTPSEWETYVLADRTVQG 306


>gi|82699481|ref|YP_414055.1| ATP/GTP-binding domain-containing protein [Brucella melitensis
           biovar Abortus 2308]
 gi|189023809|ref|YP_001934577.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|82615582|emb|CAJ10565.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis biovar
           Abortus 2308]
 gi|189019381|gb|ACD72103.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
          Length = 380

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 69/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++        + IE+          
Sbjct: 159 AENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|254693351|ref|ZP_05155179.1| Phage DNA packaging protein [Brucella abortus bv. 3 str. Tulya]
          Length = 407

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREMMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|149185407|ref|ZP_01863723.1| hypothetical protein ED21_20319 [Erythrobacter sp. SD-21]
 gi|148830627|gb|EDL49062.1| hypothetical protein ED21_20319 [Erythrobacter sp. SD-21]
          Length = 444

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 81/303 (26%), Gaps = 39/303 (12%)

Query: 43  KPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLI 102
              E    P+ W+ +           +            + AGRG GKT   A  +L   
Sbjct: 27  TAEERAEWPYHWRRQA--------RESQRAPEGDWQTWLVMAGRGFGKTRAGAEWVLETA 78

Query: 103 STRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSM 162
              P   I  +  S  +++  +    S  L+  P                W A   + S+
Sbjct: 79  EADPFARIALVGASLGEVRAVMVEGESGILACSP---------------PWRAPDYQPSL 123

Query: 163 GIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDII------NKSILGFFT 216
                 +                          + DE +   +          ++L    
Sbjct: 124 RT---VHFPNGAQAFLYSAAESESLRGPQHSHAWCDEVAKWSNSHERASRSWDNLLLGLR 180

Query: 217 ELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTR--TVEGIDSGFHEGIISRYG 274
                R       T R       + +                    + + F   + + +G
Sbjct: 181 LGKDQRIMAT--TTPRSVPLLRRLLDAERTHGLVLTGGATRDNAANLPTKFLAAMDAEFG 238

Query: 275 LDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTV 333
            +S +   E+ G   ++          +E+     A DD    +++G D  A   GD+  
Sbjct: 239 -NSALGLQELDGLLLEEIEGALWSRALLEQRRGACAEDD-LRRVVVGVDPPASAHGDECG 296

Query: 334 VVF 336
           +V 
Sbjct: 297 IVV 299


>gi|254437946|ref|ZP_05051440.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198253392|gb|EDY77706.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 441

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/319 (11%), Positives = 77/319 (24%), Gaps = 36/319 (11%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPG------ 107
           QL+ +  +      +   +    ++  +   GRG GKT   A  +  ++           
Sbjct: 21  QLKALPYLFEFWALDHQLAPEGDWRTWVILGGRGAGKTRAGAEWVRSMVEGSRPRDPGIA 80

Query: 108 MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSK 167
             +  I  +  Q +  +    S  L+  P     +  S                      
Sbjct: 81  KHVGLIGETMEQAREVMVFGTSGILACSPPDRRPQWISGRNLL----------------- 123

Query: 168 HYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWI 225
                                     AV+ DE +  P        +          R  +
Sbjct: 124 -IWPNGAEARLYSAFDPERLRGPQFDAVWADELAKWPKAQSTWDMMQFGLRLGANPRACV 182

Query: 226 MTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
            T   + +       F         +         +   F + +  RY     + R E+ 
Sbjct: 183 TT-TPKNVE--ILKDFMARKSTVHTHATTQANRAYLADSFLQEVQERYCGT-RLGRQELD 238

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVFRRGNII 342
           G               +E              +++  D    A    D   +V       
Sbjct: 239 GVLLADVDGALWSSARLEAGHVT--KLPQMDRIVVAVDPPAGANATSDACGIVVAGIVSQ 296

Query: 343 EHIFDWSAKLIQETNQEGC 361
             +  W   +I++ + +G 
Sbjct: 297 GPVSGWKIYVIEDASVQGV 315


>gi|183598507|ref|ZP_02960000.1| hypothetical protein PROSTU_01901 [Providencia stuartii ATCC 25827]
 gi|188020684|gb|EDU58724.1| hypothetical protein PROSTU_01901 [Providencia stuartii ATCC 25827]
          Length = 411

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/285 (12%), Positives = 78/285 (27%), Gaps = 28/285 (9%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWL----ISTRPGMSIICIANSETQLKNTL 124
            V  +    ++ A   GRG  KT   A M                I+C       L+ + 
Sbjct: 14  PVFENEGVRYRGAY-GGRGSAKTRTFALMTAIRGYMAAKNGQSGVILCAREYMNSLEESS 72

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
             EV + +  +P                W  +  E                ++  R +  
Sbjct: 73  MEEVKQAIRSVP----------------WLNDFYELGEKYIRTKCRSVSYVFAGLRHNLD 116

Query: 185 VGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
                   +  + DEA    +     +     E      W+   N  +        F   
Sbjct: 117 SIKSKARILIAWVDEAESVSETAWTKLTPTVREAGSE-IWVTW-NPEKDGSATDKRFRKK 174

Query: 245 L-EDWKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYI 302
             ++    +++        S   E  ++     D+        G + +      + + Y+
Sbjct: 175 QPDNAIVVEMNYDDNPWFPSVLEEERLNDQARLDAATYAWIWEGAYLENSDKQVLANKYV 234

Query: 303 EEAMSREAIDDLYAPLIMGCDIAGEGGD-KTVVVFRRGNIIEHIF 346
            ++   + +      L+ G D  G   D  T++     +   +I 
Sbjct: 235 VQSF-PDDLWKKADRLLFGADF-GFAKDLNTLIRMFILDDCLYIE 277


>gi|114319955|ref|YP_741638.1| hypothetical protein Mlg_0794 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226349|gb|ABI56148.1| hypothetical protein Mlg_0794 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 509

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/294 (11%), Positives = 72/294 (24%), Gaps = 30/294 (10%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           A+      +         +    AGR   KT   A + ++L +          A  +  L
Sbjct: 44  ALFKRLSGDREPPQRQARELWAIAGRRSDKTHTAAGIAVYLAT--------IGAELDGTL 95

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
                 E      +   R   ++    +      + ++   +  ++    +     S E 
Sbjct: 96  ARLTAGERGVVQLLAVDRQQAKVALGYVRGLFADSPVMSSLVEKENTEGVLLRNGVSIEV 155

Query: 181 PDTFVG-PHNTHGMAVFNDEASGTPD--------IINKSILGFFTELNPNRFWIMTSNTR 231
                        +A   DE +   D         + ++++            +  S+  
Sbjct: 156 ATNSHRAVRGRTLLAAILDECAFFKDEATATPDVEVYRALVPSLATTGG--MLVGISSPY 213

Query: 232 RLNGWFYDIFN----IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
              G  Y  +      P +              +D             D + A+ E  GQ
Sbjct: 214 ARRGLLYSKWRKHYGKPGDVLVVQGGTLDFNPTLDPRVIAEAE---QDDPEAAKAEWHGQ 270

Query: 288 FPQQEVNNFIPHNYIEEAM---SREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           F       F+    ++        E             D +G   D   +    
Sbjct: 271 FRADVEG-FVTREAVDACTAPGRIELPPVAGERYTAFVDPSGGSKDAFTLAIAH 323


>gi|114319804|ref|YP_741487.1| hypothetical protein Mlg_0643 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226198|gb|ABI55997.1| hypothetical protein Mlg_0643 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 509

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/294 (11%), Positives = 72/294 (24%), Gaps = 30/294 (10%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           A+      +         +    AGR   KT   A + ++L +          A  +  L
Sbjct: 44  ALFKRLSGDREPPQRQARELWAIAGRRSDKTHTAAGIAVYLAT--------IGAELDGTL 95

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
                 E      +   R   ++    +      + ++   +  ++    +     S E 
Sbjct: 96  ARLTAGERGVVQLLAVDRQQAKVALGYVRGLFADSPVMSSLVEKENTEGVLLRNGVSIEV 155

Query: 181 PDTFVG-PHNTHGMAVFNDEASGTPD--------IINKSILGFFTELNPNRFWIMTSNTR 231
                        +A   DE +   D         + ++++            +  S+  
Sbjct: 156 ATNSHRAVRGRTLLAAILDECAFFKDEATATPDVEVYRALVPSLATTGG--MLVGISSPY 213

Query: 232 RLNGWFYDIFN----IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
              G  Y  +      P +              +D             D + A+ E  GQ
Sbjct: 214 ARRGLLYSKWRKHYGKPGDVLVVQGGTLDFNPTLDPRVIAEAE---QDDPEAAKAEWHGQ 270

Query: 288 FPQQEVNNFIPHNYIEEAM---SREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           F       F+    ++        E             D +G   D   +    
Sbjct: 271 FRADVEG-FVTREAVDACTVPARIELPPVAGERYTAFVDPSGGSKDAFTLAIAH 323


>gi|237815048|ref|ZP_04594046.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254697001|ref|ZP_05158829.1| Phage DNA packaging protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254729902|ref|ZP_05188480.1| Phage DNA packaging protein [Brucella abortus bv. 4 str. 292]
 gi|256257118|ref|ZP_05462654.1| Phage DNA packaging protein [Brucella abortus bv. 9 str. C68]
 gi|237789885|gb|EEP64095.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 407

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|273810556|ref|YP_003344937.1| gp2 [Sodalis phage SO-1]
 gi|258619841|gb|ACV84094.1| gp2 [Sodalis phage SO-1]
          Length = 461

 Score = 77.7 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/298 (14%), Positives = 84/298 (28%), Gaps = 30/298 (10%)

Query: 44  PLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIS 103
           P         +Q + +                      + +G G GK+ + A  ++ L++
Sbjct: 24  PTRVAQAVRLYQPDCLPHQVELLRDTKTKILG------LCSGFGGGKSWVAARKVIQLLT 77

Query: 104 TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMG 163
             PG   I    +   L   ++ E+ K       R  F  Q   ++      +       
Sbjct: 78  LNPGHDGIVTEPTIPLLVKIMYPELEKAFDEAGFRWKFNKQ-DKIYSVLVKGKWTRV--- 133

Query: 164 IDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRF 223
                          E  + +      +   +  DE   T   +  +            F
Sbjct: 134 -------------ICESMENYTRLIGVNAAWIVADEFDTTKQDVALAAYHKLLGRLRAGF 180

Query: 224 --WIMTSNTRRLNGWFYDIFNIPLE-DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
               +  +T       Y IF +  +   +  +  T     + + F + + S+Y   +++ 
Sbjct: 181 VRQFVIVSTPEGYRAMYQIFEVEKDSQKRLIRAKTTDNHHLPADFIDTLRSQY--PANLI 238

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
              + G F              EE  S E        LI+G D         VV  RR
Sbjct: 239 DAYLNGLFVNLTSGAVYKMFNREENASTE-EVQPEDTLIIGMDFNVT-KMAAVVYVRR 294


>gi|282857748|ref|ZP_06266957.1| DNA maturase B [Pyramidobacter piscolens W5455]
 gi|282584418|gb|EFB89777.1| DNA maturase B [Pyramidobacter piscolens W5455]
          Length = 591

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/373 (10%), Positives = 86/373 (23%), Gaps = 83/373 (22%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            F+ F+     W     P     +P   Q      +  +  +          +  I A R
Sbjct: 14  DFRAFLYVV--WKHLNLP-----EPTPLQ----YDIANYLQTGPK-------RKIIEAFR 55

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQL---KNTLWAEVSKWLSMLPHRHWFEM 143
           G+GK+ + +   LW +   P ++I+ ++ S+ +           + +   + P +  F  
Sbjct: 56  GVGKSWITSAYALWRLYWNPQLNILVVSASKERADSFSTFTLRLIDEMGILSPLKPDFNK 115

Query: 144 QSLSLHPSGWYAELLEQSM---------GIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
              +   +                    G  +            E  +          ++
Sbjct: 116 GQRNSKIAFDVGPARASHAPSVKSVGIYGQLTGSRADVIIADDIEISNNSYTQMMRDKLS 175

Query: 195 VFNDEASGT--------------PDIINKSILGFFTELNPNRFWIM-TSNTRRLNGWFYD 239
               E                  P +               R W     +  +  G+   
Sbjct: 176 EAVKEFDAILKPADDAEITYLGTPQVEMSLYNALRDRGYSTRIWPARVPSAEKRIGYGDR 235

Query: 240 IFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------QFPQQEV 293
           +     +     +                  + YG      +  +        +FP +  
Sbjct: 236 LAPYVAKMEDVGRTT--DPARFSDNDLREREASYGRSGFALQFMLDTTLSDAERFPLRLN 293

Query: 294 NNFI------------------------------PHNYIEEAMSREAIDDLYAPLIMGCD 323
           +  I                                +     M  +     Y   +M  D
Sbjct: 294 DLIILPLDKDMAPEKVVWSSGPELLIKDLASTGFAGDSFHRPMGIQGEFREYTGSVMFVD 353

Query: 324 IAGEGGDKTVVVF 336
            +G G D+T    
Sbjct: 354 PSGRGMDETAYAV 366


>gi|254688870|ref|ZP_05152124.1| Phage DNA packaging protein [Brucella abortus bv. 6 str. 870]
          Length = 407

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|261757806|ref|ZP_06001515.1| ATP/GTP-binding site domain-containing protein A [Brucella sp.
           F5/99]
 gi|261737790|gb|EEY25786.1| ATP/GTP-binding site domain-containing protein A [Brucella sp.
           F5/99]
          Length = 430

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 78/295 (26%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPR-Q 176

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           ++T+  R +                 +         +  GF + I  RY     + R ++
Sbjct: 177 VVTTTPRAV--PLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQKL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|254718736|ref|ZP_05180547.1| Phage DNA packaging protein [Brucella sp. 83/13]
          Length = 411

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/266 (13%), Positives = 70/266 (26%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  ++T+  R +                 +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TVENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|238027682|ref|YP_002911913.1| gp2 [Burkholderia glumae BGR1]
 gi|237876876|gb|ACR29209.1| gp2 [Burkholderia glumae BGR1]
          Length = 489

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 75/290 (25%), Gaps = 40/290 (13%)

Query: 67  HSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWA 126
                   P   K  +  GRG  KT     ++    ST+    I+C+   +  ++ +  A
Sbjct: 60  QKLERLIYPKRLKI-VWGGRGSAKTRTIVSILTAQASTQRE-RILCLREVQNSIEESSHA 117

Query: 127 EVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVG 186
           E+++ +        F +    +                     T +  ++     +    
Sbjct: 118 ELAEEIERRDLGGSFVVGRKVIRV-----------------PATRSSFSFRGLYRNVTGV 160

Query: 187 PHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL- 245
                    + DEA          +L    E       I++ N  R N   +     P  
Sbjct: 161 KGFAKATKAWVDEAENVSRESWDVLLPTIREPGSEI--IVSFNPNRENDPTWADLVGPYV 218

Query: 246 -----------EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
                       D    + +                     D D  R   LG+F ++   
Sbjct: 219 DRLDEDGCYEDADTLIIRANYTDNPWFTEELELERAKMERTDLDRYRWIWLGKFNRRSDE 278

Query: 295 NFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV--VFRRGNII 342
                 +       +           G D  G   D T +   + RGN +
Sbjct: 279 LIFAGKW----RVEDIEAPPNTRFFFGAD-WGFAVDPTTLNRCWVRGNDL 323


>gi|254707699|ref|ZP_05169527.1| Phage DNA packaging protein [Brucella pinnipedialis M163/99/10]
          Length = 321

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|114766464|ref|ZP_01445429.1| terminase, large subunit, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114541321|gb|EAU44370.1| terminase, large subunit, putative [Roseovarius sp. HTCC2601]
          Length = 434

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/296 (13%), Positives = 82/296 (27%), Gaps = 35/296 (11%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A  +   +             +  +  +  Q++  +    S  L+ 
Sbjct: 40  VIMGGRGAGKTRAGAEWVRTCVEGALPLSPGRCRRVALVGETLDQVREVMVFGESGILAC 99

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     +  +                                        G       A
Sbjct: 100 SPPDRRPDWHAGRRCL------------------VWPNGAEAMVFSAHDPEGLRGPQFDA 141

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +           +          +  +    T R  G   ++  +       + 
Sbjct: 142 AWVDELAKWKKARETWDMLQFALRLGERPQVCVT--TTPRNVGVLKELLELDST-VVTHA 198

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   + + F   + +RYG ++ +AR E+ G               +E A   E   
Sbjct: 199 KTEANRANLAASFLREVRARYG-NTRLARQELDGVLVTDVDGTLWTQAVLERARGAEM-P 256

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG-CPVG 364
           + +  +++  D     G+G D   ++            W A ++++ + +G  P G
Sbjct: 257 ERFDRIVVAVDPPAGEGQGADACGILVAGAVCAGPPQAWRAWVLEDASVQGASPTG 312


>gi|188025504|ref|ZP_02997527.1| hypothetical protein PROSTU_00661 [Providencia stuartii ATCC 25827]
 gi|188023287|gb|EDU61327.1| hypothetical protein PROSTU_00661 [Providencia stuartii ATCC 25827]
          Length = 285

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/285 (12%), Positives = 78/285 (27%), Gaps = 28/285 (9%)

Query: 69  NVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWL----ISTRPGMSIICIANSETQLKNTL 124
            V  +    ++ A   GRG  KT   A M                I+C       L+ + 
Sbjct: 14  PVFENEGVRYRGAY-GGRGSAKTRTFALMTAIRGYMAAKNGQSGVILCAREYMNSLEESS 72

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
             EV + +  +P                W  +  E                ++  R +  
Sbjct: 73  MEEVKQAIRSVP----------------WLNDFYELGEKYIRTKCRSVSYVFAGLRHNLD 116

Query: 185 VGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP 244
                   +  + DEA    +     +     E      W+   N  +        F   
Sbjct: 117 SIKSKARILIAWVDEAESVSETAWTKLTPTVREAGSE-IWVTW-NPEKDGSATDKRFRKK 174

Query: 245 L-EDWKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYI 302
             ++    +++        S   E  ++     D+        G + +      + + Y+
Sbjct: 175 QPDNAIVVEMNYDDNPWFPSVLEEERLNDQARLDAATYAWIWEGAYLENSDKQVLANKYV 234

Query: 303 EEAMSREAIDDLYAPLIMGCDIAGEGGD-KTVVVFRRGNIIEHIF 346
            ++   + +      L+ G D  G   D  T++     +   +I 
Sbjct: 235 VQSF-PDDLWKKADRLLFGADF-GFAKDLNTLIRMFILDDCLYIE 277


>gi|319762771|ref|YP_004126708.1| prophage mumc02, terminase, atpase subunit, putative
           [Alicycliphilus denitrificans BC]
 gi|317117332|gb|ADU99820.1| prophage MuMc02, terminase, ATPase subunit, putative
           [Alicycliphilus denitrificans BC]
          Length = 454

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 78/292 (26%), Gaps = 33/292 (11%)

Query: 77  IFKCAISAGRGIGKTTLNAWMMLWLISTRP----GMSIICIANSETQLKNTLWAEVSKWL 132
            FK A+ A R  GKT  +   +    +           + ++  E Q +  +   V   L
Sbjct: 23  RFKIAMFA-RQCGKTFTSTLELALDCARAEALGQRRRWVILSRGERQAREAMNEGVKLHL 81

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L             +   W   +    + +                P           
Sbjct: 82  AALSAGF-------KAYDYDWEPGIKALEVELPGGSKITA-------LPANPDTARGFSA 127

Query: 193 MAVFNDEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKR 250
             V  DE +       I K++    ++        + S        FYD+     + W R
Sbjct: 128 N-VLLDEFAFHQDSRAIWKALFPVISKPGLKLR--VISTPNGKGNKFYDLMTGADDGWSR 184

Query: 251 YQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSR-- 308
           +  D           +   + +   D D+   E   ++  +    ++P   I        
Sbjct: 185 HTTDIYQAVADGLPRNIEELRKGAGDDDLWAQEFELKWLDEAS-AWLPFELITACEHEAA 243

Query: 309 -EAIDDLYAPLIMGCDIAGEGGDKTVVVFR----RGNIIEHIFDWSAKLIQE 355
            +       P  +G DIA    D  V+           +  I +       E
Sbjct: 244 GKPEHYQGGPCFVGVDIA-SRNDLFVIWVFELVGDVLWVREIIERRRITFAE 294


>gi|116751218|ref|YP_847905.1| hypothetical protein Sfum_3801 [Syntrophobacter fumaroxidans MPOB]
 gi|116700282|gb|ABK19470.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 507

 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 66/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DTIIEEIEFQLDSNPDLMNSIALTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       + +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SDQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|302343251|ref|YP_003807780.1| hypothetical protein Deba_1821 [Desulfarculus baarsii DSM 2075]
 gi|301639864|gb|ADK85186.1| conserved hypothetical protein [Desulfarculus baarsii DSM 2075]
          Length = 507

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 66/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DTIIEEIEFQLDTNPDLMNSIALTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       + +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SDQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|225220117|ref|YP_002720084.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
 gi|224986058|gb|ACN74622.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
          Length = 461

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 45/309 (14%), Positives = 85/309 (27%), Gaps = 31/309 (10%)

Query: 44  PLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIS 103
           P         +Q + +                      + +G G GK+ + A  ++ L++
Sbjct: 24  PTRVAQAVRLYQPDCLPHQVELLRDTKTKILG------LCSGFGGGKSWVAARKVIQLLT 77

Query: 104 TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMG 163
             PG   I    +   L   ++ E+ K       R  F  Q              +    
Sbjct: 78  LNPGYDGIVTEPTIPLLVKIMYPELEKAFDEAGFRWKFNKQ-------------DKIYNV 124

Query: 164 IDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRF 223
           +    +T        E  + +      +   +  DE   T   +  +            F
Sbjct: 125 LVKGKWTRVI----CESMENYTRLIGVNAAWIVADEFDTTKQDVAMAAYHKLLGRLRAGF 180

Query: 224 --WIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVA 280
               +  +T       Y IF        +  +  T     + + F + + S+Y   +++ 
Sbjct: 181 VRQFVIVSTPEGYRAMYQIFEVEKGSQKRLIRAKTTDNHHLPADFIDTLRSQY--PANLI 238

Query: 281 RIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGN 340
              + G F              E   S E        LI+G D         VV  RR  
Sbjct: 239 DAYLNGLFVNLTSGAVYKMFNREGNASTE-EVHPDDTLIIGMDFNVT-KMAAVVYVRR-Q 295

Query: 341 IIEHIFDWS 349
            I    ++ 
Sbjct: 296 RITENKEFR 304


>gi|163842863|ref|YP_001627267.1| hypothetical protein BSUIS_A0614 [Brucella suis ATCC 23445]
 gi|163673586|gb|ABY37697.1| protein of unknown function DUF264 [Brucella suis ATCC 23445]
          Length = 411

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 66/266 (24%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  +    T                    +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPRQVV---TTTPRAVPLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R E+ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACSIVV 267


>gi|260168345|ref|ZP_05755156.1| Phage DNA packaging protein [Brucella sp. F5/99]
          Length = 411

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/266 (12%), Positives = 70/266 (26%), Gaps = 36/266 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+ 
Sbjct: 27  IMGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVS 86

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   ++                               +    +           A 
Sbjct: 87  RL-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAA 127

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +    P      +       +  R  ++T+  R +                 +  
Sbjct: 128 WCDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMR 184

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +  GF + I  RY     + R ++ G+  ++        + IE+         
Sbjct: 185 TAENAGNLAEGFMQTIARRYAGT-RLGRQKLDGELVEERPGALWSRDRIEQCFEEN--PP 241

Query: 314 LYAPLIMGCDI---AGEGGDKTVVVF 336
             A +++  D    +G+  D   +V 
Sbjct: 242 PLARIVVAVDPPASSGKASDACGIVV 267


>gi|62289552|ref|YP_221345.1| terminase large subunit [Brucella abortus bv. 1 str. 9-941]
 gi|62195684|gb|AAX73984.1| hypothetical terminase large subunit [Brucella abortus bv. 1 str.
           9-941]
          Length = 380

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 69/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++        + IE+          
Sbjct: 159 AENAGNLAEGFMQTIARRYAGT-RLGRQELNGELVEERPGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|126735952|ref|ZP_01751696.1| Putative large terminase [Roseobacter sp. CCS2]
 gi|126714509|gb|EBA11376.1| Putative large terminase [Roseobacter sp. CCS2]
          Length = 408

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 38/267 (14%), Positives = 66/267 (24%), Gaps = 35/267 (13%)

Query: 81  AISAGRGIGKTTLNAWM---MLWLISTRPG---MSIICIANSETQLKNTLWAEVSKWLSM 134
            I  GRG GKT   A     M+             +  +  +  Q +  +    S  LS+
Sbjct: 15  VILGGRGAGKTRAGAEWVRRMVEGALPHAPGAARRVALVGETMDQAREVMVFGDSGILSV 74

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E  +                                                A
Sbjct: 75  CPPDRRPEWIAGRRLL------------------VWPNGAEAQVFSAHDPDSLRGPQFDA 116

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
           V+ DE +     D     +       +  R  +    T R +    D+          + 
Sbjct: 117 VWADELAKWRRGDEAWDMLQFALRLGDSPRACVT--TTPRKSQMLSDLLERDTT-VVTHA 173

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F + I  RYG  S + R E+ G    +          +      E   
Sbjct: 174 ATQANRANLADSFLKEIEGRYGGTS-LGRQEMEGVMLTEVEGALWSSADLAGCQVGEV-- 230

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF 336
                +++  D    +  G D+  +V 
Sbjct: 231 SALDRIVVAIDPPGTSHAGSDQCGIVV 257


>gi|224582844|ref|YP_002636642.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467371|gb|ACN45201.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 540

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 42/356 (11%), Positives = 88/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  H E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQHPEMLPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     M   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGKRENGITEKSREMGLSWTAIGMACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DEA+     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R+    D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGIL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP ++++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSG 350


>gi|159184549|ref|NP_353972.2| large terminase phage packaging protein [Agrobacterium tumefaciens
           str. C58]
 gi|159139855|gb|AAK86757.2| large terminase phage packaging protein [Agrobacterium tumefaciens
           str. C58]
          Length = 402

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 70/264 (26%), Gaps = 30/264 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRP--GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
            GRG GKT   A  +  + S      + I  +A +    +  +   +S    +   RH  
Sbjct: 26  GGRGSGKTRAGAEWVHAVASAGKQSDLRIALVAETLGDAREVMIDGISGICRIAR-RHRP 84

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
             +                                     +             ++DE  
Sbjct: 85  AFEVSRRRL------------------LWPNGAMAQVFSSEDPESLRGPQFHLAWSDELG 126

Query: 202 GT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVE 259
               P      +          R  +    T R       + + P              +
Sbjct: 127 KWKYPQETWDMLQFGLRLGEMPRQLVT--TTPRPIPLLKALLSDPTSR-VARMPTAMNAQ 183

Query: 260 GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI 319
            +  GF + +  RYG    + R EI G+   +          +E     EA  +  + ++
Sbjct: 184 NLSPGFLKAMQERYGGT-RLGRQEIGGELIDEREGALWKRADLEA--IIEAAHEPLSRIV 240

Query: 320 MGCD-IAGEGGDKTVVVFRRGNII 342
           +  D  AG G +    +   G  +
Sbjct: 241 VAVDPPAGVGENSCCGIVVAGLGM 264


>gi|322513476|ref|ZP_08066587.1| phage terminase [Actinobacillus ureae ATCC 25976]
 gi|322120735|gb|EFX92618.1| phage terminase [Actinobacillus ureae ATCC 25976]
          Length = 406

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 38/266 (14%), Positives = 70/266 (26%), Gaps = 31/266 (11%)

Query: 84  AGRGIGKTTLNAWMMLWLISTR----PGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M   +   R        I+        L+++   EV + +       
Sbjct: 26  GGRGSAKTRTFAKMTAVIAYKRAMAGDSGVILRGREFMNSLEDSSLEEVKQAIRA----- 80

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        +  +  E                +S  R +          +  + DE
Sbjct: 81  -----------ESFLNDFFEICEKYIRTKCGRVSYIFSGLRHNLDSIKSKARILFAWVDE 129

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLEDWKRYQIDTRTV 258
           A    ++    ++    E N    W+   N  + +      F   P ++    +++    
Sbjct: 130 AESVSEMAWSKLIPTVREHNSE-IWLTW-NPEKRDSATDKRFRQFPPDNSVIVEMNYTYN 187

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   +  ++     D    R    G + +Q         Y E  +  E   D    
Sbjct: 188 PWFPDVLEQERLNDKKRLDDATYRWIWEGAYLEQSEAQIFRDKYQE--LEFEPNPDFDGS 245

Query: 318 LIMGCDIAGEGGDKTVV---VFRRGN 340
              G D  G   D T         G+
Sbjct: 246 YH-GLDF-GFANDPTAAIKCWVFDGD 269


>gi|148560043|ref|YP_001258583.1| putative terminase large subunit [Brucella ovis ATCC 25840]
 gi|148371300|gb|ABQ61279.1| putative terminase large subunit [Brucella ovis ATCC 25840]
          Length = 380

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 69/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDADSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++        + IE+          
Sbjct: 159 AENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERPGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|322420465|ref|YP_004199688.1| hypothetical protein GM18_2968 [Geobacter sp. M18]
 gi|320126852|gb|ADW14412.1| hypothetical protein GM18_2968 [Geobacter sp. M18]
          Length = 507

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 67/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P+    
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DTIIEEIEFQLDTNPDLMNSIALTKYGKPNIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       + +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SDQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|23501474|ref|NP_697601.1| terminase large subunit [Brucella suis 1330]
 gi|23347378|gb|AAN29516.1| terminase large subunit, putative [Brucella suis 1330]
          Length = 384

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/265 (12%), Positives = 70/265 (26%), Gaps = 36/265 (13%)

Query: 83  SAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLP 136
             GRG GKT   A  +  +    P         I  +  +    +  +    S  LS+  
Sbjct: 1   MGGRGSGKTRAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSR 60

Query: 137 HRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
                  ++                               +    +           A +
Sbjct: 61  L-VRPRYEASRRRL------------------IWDNGAVATLFSSEDPDSLRGPQFDAAW 101

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE +    P      +       +  R  ++T+  R +                 +   
Sbjct: 102 CDELAKWKNPQETWDMLQFGLRLGDNPR-QVVTTTPRAV--PLLKALLTDRTVSMTHMRT 158

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
                 +  GF + I  RY     + R E+ G+  ++ +      + IE+          
Sbjct: 159 AENAGNLAEGFMQTIARRYAGT-RLGRQELDGELVEERLGALWSRDRIEQCFEEN--PPP 215

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF 336
            A +++  D    +G+  D   +V 
Sbjct: 216 LARIVVAVDPPASSGKASDACGIVV 240


>gi|225873954|ref|YP_002755413.1| hypothetical protein ACP_2370 [Acidobacterium capsulatum ATCC
           51196]
 gi|225791299|gb|ACO31389.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 492

 Score = 76.5 bits (186), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/315 (11%), Positives = 72/315 (22%), Gaps = 61/315 (19%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            +   R +G +T  A       +  PG   + +A++  +   +L+  V ++   LP    
Sbjct: 69  IVLKARQLGISTWIAARFFLKTALIPGTLTVQVAHT-QEAAESLFQMVHRFYRQLPEDTL 127

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
             +++   +        ++                Y  E               +   E 
Sbjct: 128 VPLRTARANARQLVFPAIDSE--------------YRVETAGDRNAGRGLTITNLHCTEV 173

Query: 201 SGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI-DTR--- 256
           +  P    + + G    L+P    ++ S      G F++ +    E              
Sbjct: 174 ARWPGDAEEVLQGMRAALSPKGELVLESTPMGAAGCFWNTWQSAAETGMVQHFFPWWMEA 233

Query: 257 --------------------TVEGIDSGFHEGIISRYGLDSDVARIEI-----LGQFPQQ 291
                                   +                ++AR E         F   
Sbjct: 234 AYAAEPVDETSLTTEERALMEAHSLSPEQIGYRRQIRANYRELARQEYAETAHDC-FLAS 292

Query: 292 EVNNFIPHNYIEE--------------AMSREAIDDLYAPLIMGCDIAGEG--GDKTVVV 335
               F                       +      +     I+  D AG G  GD +V  
Sbjct: 293 GECYFDAAAIDRRLSAVEAPLRMRLGGRLQIWYPPEGQRRYIVAVDPAGGGSEGDYSVAQ 352

Query: 336 FRRGNIIEHIFDWSA 350
                      +   
Sbjct: 353 VIDEKTGLQCAELQM 367


>gi|86750600|ref|YP_487096.1| hypothetical protein RPB_3490 [Rhodopseudomonas palustris HaA2]
 gi|86573628|gb|ABD08185.1| Protein of unknown function DUF264 [Rhodopseudomonas palustris
           HaA2]
          Length = 423

 Score = 76.5 bits (186), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 73/262 (27%), Gaps = 35/262 (13%)

Query: 84  AGRGIGKTTLNAWMM------LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            GRG GKT   A  +      L   ++ P   I  +  +E  ++  +   VS  L++ P 
Sbjct: 40  GGRGAGKTRAGAEWIRCQALGLAPFASEPVARIALVGETEHDVREVMIEGVSGLLAVHPP 99

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
               + Q                                     D             ++
Sbjct: 100 DQRPQWQPSRKRLE------------------WSNGAVAQAFSADDPQSLRGPQFSCAWS 141

Query: 198 DEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT 255
           DE +           +       +  R   + + T R       +   P      +    
Sbjct: 142 DEMAKWRYAQDAFDMLQFGLRLGSQPRQ--VITTTPRPTALLKRLLADPS-AVTTHAPTR 198

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
                +   F EG+++RY     + R E+ G+  +   +       IE     +A     
Sbjct: 199 ANALNLAPTFLEGVMARYAGT-RLGRQELDGELIEDRPDALWSRALIESCRVVDAPPLQ- 256

Query: 316 APLIMGCDI---AGEGGDKTVV 334
             L++  D    +G+  D   +
Sbjct: 257 -RLVVAVDPPASSGKRADSCGI 277


>gi|300088757|ref|YP_003759279.1| hypothetical protein Dehly_1680 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528490|gb|ADJ26958.1| conserved hypothetical protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 507

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 66/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DTIIEEIEFQLDSNPDLMNSIALTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       E +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SEQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|170751343|ref|YP_001757603.1| hypothetical protein Mrad2831_4961 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657865|gb|ACB26920.1| protein of unknown function DUF264 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 432

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 71/280 (25%), Gaps = 36/280 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSM 134
           A+  GRG GKT   A  +  L    P         I  +  +   +++ +    S  L  
Sbjct: 47  AVIGGRGSGKTRTGAEWVDALARGDPAFAAAPVGRIALVGETHLDVRDVMVEGPSGLLG- 105

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           LP R                                           +           A
Sbjct: 106 LPARGRARPTWSPSRRR----------------VDWSNGAVALAFSAEEPDALRGPQFGA 149

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DEA+    P+     +          R  +    T R       +   P        
Sbjct: 150 AWCDEAAKWRRPEAAFDMLQFGLRLGARPRNLVT--TTPRPVPLIRRLLADPRT-VVSRA 206

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F + ++ RY     + R E+ G+      +       +E    R A  
Sbjct: 207 RTHDNAAHLAPDFLQQVVGRYAGT-RLGRQELDGELIADRDDALWTRAALEA--DRIAAA 263

Query: 313 DLYAPLIMGCDI---AGEGGDKTVVVF--RRGNIIEHIFD 347
                +++  D    +G   D   +V   R G     + D
Sbjct: 264 PDLGRIVVAVDPPAASGARSDACGIVAAGRAGGHAYVLAD 303


>gi|158422729|ref|YP_001524021.1| hypothetical protein AZC_1105 [Azorhizobium caulinodans ORS 571]
 gi|158329618|dbj|BAF87103.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 436

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 35/264 (13%), Positives = 69/264 (26%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +  L   RP         I  +A +   L+  +   VS  L++ 
Sbjct: 51  VLGGRGAGKTRAGAEWVRGLALGRPPFAPAPVGRIALVAETMGDLREVMVEGVSGLLAVH 110

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P       +                                     +           A 
Sbjct: 111 PAAERPRWEPTRRRL------------------VWPNGAVAQGFSAEDPESLRGPQFEAA 152

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     + +   +          R  +    T R +     +   P       + 
Sbjct: 153 WLDELAKWRRAEAVFDMLQFGLRLGAQPRQMVT--TTPRPSALLRRLMADPS--TVLSRA 208

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
            T       +      +      + + R E+ G+  +   +     +      +REA   
Sbjct: 209 TTAQNAFHLAPAFLDTVLARYGGTRLGRQELEGEIIEDRPDALWTRSA--LEAAREAAAP 266

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
             A +++  D    +  G D   +
Sbjct: 267 PLARVVVALDPPASSRAGADACGI 290


>gi|330996205|ref|ZP_08320095.1| phage terminase, large subunit, PBSX family [Paraprevotella
           xylaniphila YIT 11841]
 gi|329573709|gb|EGG55300.1| phage terminase, large subunit, PBSX family [Paraprevotella
           xylaniphila YIT 11841]
          Length = 430

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 34/284 (11%), Positives = 77/284 (27%), Gaps = 42/284 (14%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMM--LWLISTRPGM---SIICIANSETQLKNTLWAEVSK 130
             F   I+ GRG GK+   A  +  L    +R      SI+    +      ++  E+ +
Sbjct: 22  EHFIILITGGRGSGKSFNAATFIERLTFEQSRDRTFAHSILYCRYTMVSANLSIIPEIQE 81

Query: 131 WLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNT 190
            + +     +F+                  +M    +      +T S  +       H  
Sbjct: 82  KIDIDGGSKYFKTT-----------RSDIVNMFSGGRIMFRGIKTSSGNQTAKLKSIHG- 129

Query: 191 HGMAVFNDEASGTPDII-NKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWK 249
                  DEA    +      I+    +       I+  N    N + Y  +        
Sbjct: 130 -ITTFVCDEAEEWTNEQDFDKIMLSIRQKGIQNRIIIIMNPTDSNHFIYKKYIENTHKLV 188

Query: 250 ----------------RYQIDTRTV-EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
                                     + +   F + +      + +     ++G++    
Sbjct: 189 EIDGVPVQISTHPNVLHIHTTYFDNIDNLSPQFIKEVEQMKAENPEKYAHTVIGRWADVA 248

Query: 293 VNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
                    + +++ +         + +G D  G   D+T +V 
Sbjct: 249 EGAIYKKWGVVKSIPQWCK-----KIALGLDF-GFTHDETAIVM 286


>gi|225621691|ref|YP_002724049.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
 gi|225547649|gb|ACN93626.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
          Length = 450

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 44/288 (15%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------DYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYTFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|306845199|ref|ZP_07477775.1| Phage DNA packaging protein [Brucella sp. BO1]
 gi|306274358|gb|EFM56165.1| Phage DNA packaging protein [Brucella sp. BO1]
          Length = 430

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 74/295 (25%), Gaps = 39/295 (13%)

Query: 56  LEFMEAVDVHCHSNVNNSNPTI--FKCA-ISAGRGIGKTTLNAWMMLWLISTRPG----- 107
            + + A D       +   P    ++   I  GRG GKT   A  +  +    P      
Sbjct: 17  RQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALGLPPFAGKP 76

Query: 108 -MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
              I  +  +    +  +    S  LS+         ++                     
Sbjct: 77  SGHIALVGETFNDAREVMVDGPSGILSVSRL-VRPRYEASRRRL---------------- 119

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFW 224
                     +    +           A + DE +    P      +       +  R  
Sbjct: 120 --IWDNGAVATLFSSEDPDSLRGPQFDAAWYDELAKWKNPQETWDMLQFGLRLGDNPRQV 177

Query: 225 IMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
           +    T                    +         +  GF + I  RY     + R E+
Sbjct: 178 V---TTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGT-RLGRQEL 233

Query: 285 LGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVF 336
            G+  ++        + IE+           A +++  D    +G+  D   +V 
Sbjct: 234 DGELVEERPGALWSRDRIEQCFEEN--PPPLARIVVAVDPPASSGKASDACGIVV 286


>gi|78356952|ref|YP_388401.1| hypothetical protein Dde_1909 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219357|gb|ABB38706.1| hypothetical protein Dde_1909 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 507

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 66/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHL-DTIIEEIEFQLDTNPDLMNSIALTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       E +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SEQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|94990333|ref|YP_598433.1| terminase large subunit [Streptococcus phage 10270.2]
 gi|94994256|ref|YP_602354.1| Terminase large subunit [Streptococcus phage 10750.2]
 gi|94543841|gb|ABF33889.1| Terminase large subunit [Streptococcus phage 10270.2]
 gi|94547764|gb|ABF37810.1| Terminase large subunit [Streptococcus phage 10750.2]
          Length = 432

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 41/290 (14%), Positives = 84/290 (28%), Gaps = 29/290 (10%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
           NP I   A   GRG GK++  A  ++  +  +  ++ +CI  ++  L+ +++ ++   +S
Sbjct: 30  NPQILNIACKGGRGSGKSSNIA-FIISRLIIQYPVNAVCIRKTDNTLEQSVYEQIKWAIS 88

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
                 +F+     L             +    +   I  R          +        
Sbjct: 89  EQGLERYFKFNKSPLR------------ITYIPRGNYIVFRGAQNPERIKSLKDSRFPFA 136

Query: 194 AVFNDE-ASGTPDIINKSILGFFTEL----NPNRFWIMTSNTR-RLNGWFYDIFNIPLED 247
             + +E A    +   K+I                +  T N   R   W    +    + 
Sbjct: 137 IGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNPPKRKQSWVNKKYESQFQP 196

Query: 248 WKRY--QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
              +      +    I   F     +         R E LG+         +P + +   
Sbjct: 197 SNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGEAIGSG---VVPFDNLRFE 253

Query: 306 MSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR----GNIIEHIFDWSAK 351
              +     +  +  G D  G   D    V        N I  I ++  +
Sbjct: 254 RITDEQVADFDNIRNGID-YGYATDPLAFVRWHYDKKKNGIYAIDEYYGQ 302


>gi|323139470|ref|ZP_08074518.1| hypothetical protein Met49242DRAFT_3906 [Methylocystis sp. ATCC
           49242]
 gi|322395272|gb|EFX97825.1| hypothetical protein Met49242DRAFT_3906 [Methylocystis sp. ATCC
           49242]
          Length = 439

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 73/256 (28%), Gaps = 33/256 (12%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I  GRG GKT   A  +  L   RP         I  I  +   ++  +   VS  L++ 
Sbjct: 54  ILGGRGAGKTRAGAEWVKGLALGRPHFCTRPVSRIALIGETAADVREVMIEGVSGLLAIH 113

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             R     +S                          +         +           A 
Sbjct: 114 GKRDRPRWESSRRRL------------------VWDSGVVAQAFSAEDPESLRGPQFHAA 155

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +           +       +  R  +    T R      D+   P        +
Sbjct: 156 WCDELAKWRYARETWDMLQFGLRLGDWPRQLVT--TTPRPTPLLKDLIAHPAT-VLTRAL 212

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +   F E ++++Y     + R E+ G+  ++  +     + IE +   +A   
Sbjct: 213 TRENAANLAPSFLESVVAQYAGT-RLGRQELDGEIVEERKDALWTRDLIEASRVADAP-- 269

Query: 314 LYAPLIMGCD-IAGEG 328
             A +++  D  A  G
Sbjct: 270 RLARIVVAVDPPASFG 285


>gi|156564098|ref|YP_001429607.1| terminase large subunit [Bacillus phage 0305phi8-36]
 gi|154622795|gb|ABS83675.1| terminase large subunit [Bacillus phage 0305phi8-36]
          Length = 635

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 67/223 (30%), Gaps = 22/223 (9%)

Query: 45  LEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST 104
           L    +P  W  E ++         +        +  +  GR +GKT     M+LW   T
Sbjct: 50  LAILDKPKFWAAETLKWFCRDYQEPMLQEMADSKRTVLRLGRRLGKTETMCIMILWHAFT 109

Query: 105 RPGM------SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELL 158
           +P         I+ IA  E Q+ + ++  +S+ + M    +               +  +
Sbjct: 110 QPNKGPNNQYDILIIAPYEEQV-DLIFKRLSQLIDMSGDVN--------------PSRDI 154

Query: 159 EQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTEL 218
           ++ + + +        T   +               +  DE     +    +I+    E 
Sbjct: 155 DKHIELPNGTVIH-GITAGSKSGSGAANTRGQRADLIVLDEMDYMGESEITNIMNIRNEA 213

Query: 219 NPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGI 261
                 I+ S        +Y       + + +    TR   G 
Sbjct: 214 PERIKMIVASTPSGRRDSYYKWCVGATKTYAQDDELTRQNGGR 256


>gi|67920466|ref|ZP_00513986.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gi|67857950|gb|EAM53189.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
          Length = 244

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/243 (15%), Positives = 72/243 (29%), Gaps = 37/243 (15%)

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-------------GMSII 111
           H       ++P  F+  +  GR  GK+ L     +      P               +++
Sbjct: 9   HKSQLEVFNDPQKFQVLVC-GRRFGKSHLQVTKHVIDCLMFPKLMPGYNVKQQTMETAVL 67

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
               +  Q +  LW  + K L   P+         ++   G   +++             
Sbjct: 68  VGMPTLKQARKILWKPLVKTLENCPYVDKISRSDYTIRFKGNRPDII------------- 114

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGT-PDIINKSILGFFTELNPNRFWIMTSNT 230
                +    +            V  DE     P +I+  I+    +  P+   + T   
Sbjct: 115 ----LAGLNDNAGDRARGLKLWRVCIDEVQDVRPSVIDAVIIPAMAD-TPHSRALFTGTP 169

Query: 231 RRLNGWFYDIFNIPL--EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +  N   Y++F +    +DWK Y   T T   I     E    R      +   E   Q+
Sbjct: 170 KGKNNHLYNLFTMERDNDDWKSYNFPTWTNPLISKDEVERARKRLS--PRLFSQEFEAQW 227

Query: 289 PQQ 291
            + 
Sbjct: 228 KES 230


>gi|332557899|ref|ZP_08412221.1| hypothetical protein RSWS8N_02570 [Rhodobacter sphaeroides WS8N]
 gi|332275611|gb|EGJ20926.1| hypothetical protein RSWS8N_02570 [Rhodobacter sphaeroides WS8N]
          Length = 432

 Score = 76.5 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 76/288 (26%), Gaps = 35/288 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLIS-TRPG-----MSIICIANSETQLKNTLWAEVSKWLSM 134
            +  GRG GKT   A  +   +   RPG       +  +A +  Q +  +    S  L+ 
Sbjct: 39  VVMGGRGAGKTRAGAEWVRAEVEGARPGDPGRSRHVALVAETIDQAREVMVFGESGILAC 98

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                                                A
Sbjct: 99  SPPDRRPEWEAGRKRL------------------VWPNGAVAQIFSAHDPESLRGPQFDA 140

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +       +  R  ++T+  R +                 + 
Sbjct: 141 AWADELAKWGRAEEAWDMLQFSLRLGDQPR-QVVTTTPRNV--PVLRHILDNPSTVVTHA 197

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RY     + R E+ G   +           IE   SR    
Sbjct: 198 PTEANRAYLARSFLAEVHARYDGT-RLGRQELEGLLLEDVEGALWTTARIEA--SRLEEP 254

Query: 313 DLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                +++  D    G    D+  ++           DW A ++++ +
Sbjct: 255 GPLDRIVVAVDPPVTGTEASDECGILVVGARTAGPPQDWRAVVLEDAS 302


>gi|78355964|ref|YP_387413.1| hypothetical protein Dde_0917 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218369|gb|ABB37718.1| hypothetical protein Dde_0917 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 507

 Score = 76.5 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 66/253 (26%), Gaps = 29/253 (11%)

Query: 38  WGIKGKPLEHFSQPHRW--QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA 95
           WG         S    W  Q+E +     +                   GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYA 155
              L    T  G   +  A  +  L +T+  E+   L   P        +    P     
Sbjct: 66  TDALHYAFTTRGGQGLVAAPHQGHL-DTIIEEIEFQLDTNPDLMNSIALTKYGKPKIHRK 124

Query: 156 ELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFF 215
                     S  Y      Y            + H   V+ DE +   +   K++    
Sbjct: 125 PYFRLEFTNGSVLYFRPAGAY-------GDAFRSLHVGRVWVDEGAWLTERAWKALRQCL 177

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIIS-RYG 274
                 R     S    L    Y       E +  ++  +             ++    G
Sbjct: 178 KAGGTLRI---YSTPNGLRDTTYYRLTS-SEQFHVFRWPSWLNPLWTEDREAELLEFYGG 233

Query: 275 LDSDVARIEILGQ 287
            DS   + E+ G+
Sbjct: 234 RDSSGWQHEVAGE 246


>gi|307591253|ref|YP_003900462.1| hypothetical protein Cyan7822_6211 [Cyanothece sp. PCC 7822]
 gi|306986818|gb|ADN18693.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
          Length = 474

 Score = 76.1 bits (185), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 94/343 (27%), Gaps = 69/343 (20%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P+ +Q   +  +  H                I+  R +G T L A   L+      G   
Sbjct: 50  PYDYQKTLIALIKTHHT------------IVIAKTRQLGITELIANYFLFKACHNEGYLG 97

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           +  + +++   N     + + +  L                 +     +     D +   
Sbjct: 98  VIFSKTQSDTSNIA-KRIRRQIDSL-----------------YEYIETKTDSLTDIELVN 139

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTS 228
                +    P+   G        +  DE++     + I KS +   T +      I+ S
Sbjct: 140 GGRLLFRNSTPNGARGL--ESVSDILYDESAFVDEIEEIYKSSIPCTTVVGSEARIIILS 197

Query: 229 NTRRLNGWFYD--------------------------IFNIPLEDWKRYQIDTRTVEGID 262
                +GW++D                           + I    W ++ +         
Sbjct: 198 TPNGQSGWYWDKLSSNNGDRDILEICEQIRTEKIEPIQYWIDNNQWCKFIVHWLGHPKFS 257

Query: 263 SG---FHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI 319
                +   I +++ L  D+   E    F             + +    +  +D  +  I
Sbjct: 258 QQKETYLRDIKAQFDLPEDIIEQEYNLSF-THSEVIVFSSEIVRKNAIGQWENDPKSNCI 316

Query: 320 M--GCDIAGEGGDKTVVVFRR--GNIIEHIFDW-SAKLIQETN 357
              G D +  G D TV    R   N    +  +   K   E N
Sbjct: 317 YYFGIDTSLLGNDYTVCTILREIDNRYHLVKMYRQRKKTHEYN 359


>gi|125974959|ref|YP_001038869.1| PBSX family phage terminase large subunit [Clostridium thermocellum
           ATCC 27405]
 gi|125715184|gb|ABN53676.1| phage terminase, large subunit, PBSX family [Clostridium
           thermocellum ATCC 27405]
          Length = 418

 Score = 76.1 bits (185), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/260 (11%), Positives = 72/260 (27%), Gaps = 20/260 (7%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            +  GRG  K++  +  ++  +   P  + + +   +  +K++++ ++   +  L    +
Sbjct: 33  WLKGGRGSTKSSFVSIEIILGVMKDPNANAVALRKVKETIKDSVFEQLVWAIEKLKVTEY 92

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
                       W  +     +        I  R   + R    +     +   ++ +E 
Sbjct: 93  ------------WEIKHNPMELTYLPTGQKILFRGADKPRKIKSIKVSRGYVKFIWYEEV 140

Query: 201 -SGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNG-WFYDIFNIPLEDWKRYQIDTRTV 258
                    + I               T N       W  +   I   D K +     TV
Sbjct: 141 DEFLGMEEIRIINQSLMRGGEQFVVFYTYNPPNRVNAWVNEEILIDRPDRKVHHSTYLTV 200

Query: 259 E--GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYA 316
               +   F         ++    R E LG+        F     ++     +     + 
Sbjct: 201 PRDWLGEQFFIEAEHLKKVNEKAYRHEYLGEVTGTGGEVF---TNVKARKINDEEIKAFD 257

Query: 317 PLIMGCDIAGEGGDKTVVVF 336
            +  G D  G   D    + 
Sbjct: 258 RIKRGLDF-GYAVDPAAYIV 276


>gi|188494674|ref|ZP_03001944.1| gp33 TerL [Escherichia coli 53638]
 gi|188489873|gb|EDU64976.1| gp33 TerL [Escherichia coli 53638]
          Length = 539

 Score = 76.1 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 44/365 (12%), Positives = 94/365 (25%), Gaps = 40/365 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E + + K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITDKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                  DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYLVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +N  F    +        +    R+    D  ++     +   +  +   E+   +
Sbjct: 230 SVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKI-DNPVIVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++  + 
Sbjct: 287 QASAEGILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQ 346

Query: 347 DWSAK 351
           +WS K
Sbjct: 347 EWSGK 351


>gi|56808979|ref|ZP_00366686.1| COG1783: Phage terminase large subunit [Streptococcus pyogenes M49
           591]
 gi|71910836|ref|YP_282386.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
 gi|71853618|gb|AAZ51641.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
          Length = 424

 Score = 76.1 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 41/290 (14%), Positives = 84/290 (28%), Gaps = 29/290 (10%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
           NP I   A   GRG GK++  A  ++  +  +  ++ +CI  ++  L+ +++ ++   +S
Sbjct: 22  NPQILNIACKGGRGSGKSSNIA-FIISRLIIQYPVNAVCIRKTDNTLEQSVYEQIKWAIS 80

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
                 +F+     L             +    +   I  R          +        
Sbjct: 81  EQGLERYFKFNKSPLR------------ITYIPRGNYIVFRGAQNPERIKSLKDSRFPFA 128

Query: 194 AVFNDE-ASGTPDIINKSILGFFTEL----NPNRFWIMTSNTR-RLNGWFYDIFNIPLED 247
             + +E A    +   K+I                +  T N   R   W    +    + 
Sbjct: 129 IGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNPPKRKQSWVNKKYESQFQP 188

Query: 248 WKRY--QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
              +      +    I   F     +         R E LG+         +P + +   
Sbjct: 189 SNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGEAIGSG---VVPFDNLRFE 245

Query: 306 MSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR----GNIIEHIFDWSAK 351
              +     +  +  G D  G   D    V        N I  I ++  +
Sbjct: 246 RITDEQVADFDNIRNGID-YGYATDPLAFVRWHYDKKKNGIYAIDEYYGQ 294


>gi|238765385|ref|ZP_04626308.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
 gi|238696377|gb|EEP89171.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
          Length = 501

 Score = 76.1 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 37/267 (13%), Positives = 78/267 (29%), Gaps = 19/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G +  +  +   L      M I   +  E  + +T   +     ++      F    
Sbjct: 64  REMGLSWTSIGLACSLCLFNKEMVIGFGSRKEEYVDSTGDPK-----ALFWKARKFVETL 118

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
            S     W  +     M ++        +  + +                F DE++    
Sbjct: 119 PSEFRGSWSEKKHAPYMRVEFPDTGAVIKGEAGDNIG-----RGDRTTLYFVDESAFLQR 173

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
            +        T        I  S+   +N  F    +        +    R+    D  +
Sbjct: 174 PLLIDAALSQTTRCR----IDLSSVNGMNNPFAQKRHGGK--IPVFTFHWRSDPRKDDEW 227

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD--LYAPLIMGCD 323
           +     +   +  V   E+   +        IP  +++ A+      D       +   D
Sbjct: 228 YRKECEKI-DNPVVVAQELDLNYQASAEGILIPSEWVQAAIDAHIHLDIQPSGARLGAMD 286

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G +++ + +WS 
Sbjct: 287 VADEGRDKNGFAIRYGFLLQDVKEWSG 313


>gi|254504019|ref|ZP_05116170.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222440090|gb|EEE46769.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 438

 Score = 76.1 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/251 (10%), Positives = 61/251 (24%), Gaps = 31/251 (12%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTR----PG--MSIICIANSETQLKNTLWAEVSKWLSML 135
           +  GRG GKT   A  +           PG    I  +  +   ++  +   VS  L++ 
Sbjct: 53  LMGGRGAGKTRAGAEWIRARALGHGWCEPGFAGRIALVGETYADVREVMVEGVSGLLAVH 112

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
           P     +                                       +             
Sbjct: 113 PGGERPQWTPSRRRLE------------------WPNGAVAQTFSAEDPEALRGPQFDIA 154

Query: 196 FNDEASGTP--DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +       +  R   + + T R       +             
Sbjct: 155 WCDELAKWTYAEETFDMLQFGLRLGSKPRQ--LITTTPRPVPLLKRLMKQAGTAIT--HA 210

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
            T+      +      +      + + R E+ G+  +   +     + +E A    A  +
Sbjct: 211 PTKANALFLAPGFLEAVVGRYGGTRLGRQELDGELIEDRPDALWSRDGLEAARV-AAAPE 269

Query: 314 LYAPLIMGCDI 324
               +++  D 
Sbjct: 270 DLTRIVIAIDP 280


>gi|126725398|ref|ZP_01741240.1| Putative large terminase [Rhodobacterales bacterium HTCC2150]
 gi|126704602|gb|EBA03693.1| Putative large terminase [Rhodobacterales bacterium HTCC2150]
          Length = 420

 Score = 76.1 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 38/305 (12%), Positives = 79/305 (25%), Gaps = 36/305 (11%)

Query: 70  VNNSNPTIFKCAIS-AGRGIGKTTLNAWMMLWLI------STRPGMSIICIANSETQLKN 122
                   ++  +   GRG GKT   A  +   +             +  +  +  Q + 
Sbjct: 16  QVAPLGEDWRTWVCLGGRGAGKTRAGAEWVRSEVEGATATCEGRSKRVALVGETIDQARE 75

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
            +    S  L+  P     E Q+                             T       
Sbjct: 76  VMVFGESGILACCPPDRRPEWQAGRKRL------------------VWPNGATAQIFSAH 117

Query: 183 TFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
                      A + DE +     +     +       +  R  I+T+  R +       
Sbjct: 118 DPESLRGPQFDAAWVDELAKWKRAEEAWDQLQFGLRLRDAPR-QIVTTTPRNVA--VLKD 174

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
                               + + F E I  ++     + R E+ G+  +         +
Sbjct: 175 LMKQETTVVTSAPTKANRAYLAASFLEDIHRKFAGT-RLGRQELEGELVEDAEGAMWTSS 233

Query: 301 YIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
            +E     E     +  +++  D    A    D   +V     +      W A +I++ +
Sbjct: 234 MLEAGRIDEFP--EFDRIVVAVDPPVTATSNSDLCGIVVVGACLQGPPQSWQAYVIEDCS 291

Query: 358 QEGCP 362
            +G P
Sbjct: 292 IKGTP 296


>gi|268597147|ref|ZP_06131314.1| phage terminase [Neisseria gonorrhoeae FA19]
 gi|268550935|gb|EEZ45954.1| phage terminase [Neisseria gonorrhoeae FA19]
          Length = 426

 Score = 76.1 bits (185), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 74/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 20  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 77

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 78  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 120

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 121 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 178

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  +  +       G+               +       
Sbjct: 179 EINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQDAFHSGRV 238

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 239 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 277


>gi|240081035|ref|ZP_04725578.1| putative phage associated protein [Neisseria gonorrhoeae FA19]
 gi|240117647|ref|ZP_04731709.1| putative phage associated protein [Neisseria gonorrhoeae PID1]
 gi|240123201|ref|ZP_04736157.1| putative phage associated protein [Neisseria gonorrhoeae PID332]
 gi|268603349|ref|ZP_06137516.1| phage terminase [Neisseria gonorrhoeae PID1]
 gi|268681827|ref|ZP_06148689.1| phage terminase [Neisseria gonorrhoeae PID332]
 gi|268587480|gb|EEZ52156.1| phage terminase [Neisseria gonorrhoeae PID1]
 gi|268622111|gb|EEZ54511.1| phage terminase [Neisseria gonorrhoeae PID332]
          Length = 424

 Score = 76.1 bits (185), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 74/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  +  +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|240115343|ref|ZP_04729405.1| putative phage associated protein [Neisseria gonorrhoeae PID18]
          Length = 424

 Score = 75.8 bits (184), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 74/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  +  +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|323173153|gb|EFZ58784.1| gp33 TerL protein [Escherichia coli LT-68]
          Length = 539

 Score = 75.8 bits (184), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 45/365 (12%), Positives = 95/365 (26%), Gaps = 40/365 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E + + K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITEKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                F DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +N  F    +        +    R+    D  ++     +   +  +   E+   +
Sbjct: 230 SVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKI-DNPVIVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++  + 
Sbjct: 287 QASAEGILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQ 346

Query: 347 DWSAK 351
           +WS K
Sbjct: 347 EWSGK 351


>gi|325529303|gb|EGD06247.1| phage terminase, large subunit [Burkholderia sp. TJI49]
          Length = 411

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 72/273 (26%), Gaps = 33/273 (12%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM-SIICIANSETQLKNTLWAEVSKWLS 133
           P  +K A   GRG GK+       LWL          +C+  +   L+ ++   +   + 
Sbjct: 18  PARYKGA-HGGRGSGKSHFFGE--LWLEENVSDKFDFVCLRETLKSLEFSVKKLLEAKIE 74

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
                 +FE+Q   +        + E                   +              
Sbjct: 75  AFNAGDYFEVQDRRILSRHGGVTIFEG-----------------MQNHTADSIKSLEGFD 117

Query: 194 AVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN--IPLEDWKRY 251
             + +EA    +     +     +      W    N  +       +     P  D    
Sbjct: 118 RAWFEEAQNATEKSLTLLRPTLRKPGSQ-LWFGW-NPGKPTDPIDVLLRGDEPPPDSIVV 175

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           + +      +     E +      D D      LG + Q+       +  +E     E  
Sbjct: 176 EANFMDNPWLPRELQEEMEYDKRRDPDKYAHVWLGGYQQRSEARVFKNWRVE-----EFE 230

Query: 312 DDLYAPLIMGCDIAGEGGDKTVV--VFRRGNII 342
                   +G D  G   D +V+      GN +
Sbjct: 231 RPEGTVFRLGAD-WGFASDPSVLIRCDIDGNRL 262


>gi|62362371|ref|YP_224236.1| putative terminase large subunit [Listonella phage phiHSIC]
 gi|58219993|gb|AAW67505.1| putative terminase large subunit [Listonella phage phiHSIC]
          Length = 408

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/268 (13%), Positives = 73/268 (27%), Gaps = 31/268 (11%)

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNA-WMMLWLISTRPGMSIICIANSETQLKNTLWAEV 128
                   F+ A  + RG GK+   A    +W       M I+C    +  +K +  AE+
Sbjct: 17  EQPRGAVRFRGAYGS-RGSGKSFNFAKMAAIWGAI--EKMRILCTRELQVSIKESFHAEL 73

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
                             ++    W + + +  +     +   T   +   R        
Sbjct: 74  KN----------------AIKSDEWLSSIYDVGIDYIRNNNNGTEFLFKGLRHGMGSVKS 117

Query: 189 NTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI-PLED 247
                    +EA   P+     +L      +    W++  N R+        F     +D
Sbjct: 118 TAQIDLTIVEEAEDVPENAWVELLPTIFRTDKAECWVIW-NPRKKGSPVDKRFRQFKPDD 176

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYG-LDSDVARIEILGQFPQQEVNNFIPHNYIEE-A 305
               +++         G  +        +  ++     LG + +        +  +E+  
Sbjct: 177 AVVVEMNYYDNPFFPKGLEDLRRHDEDTMPPELYAHVWLGAYYEHTEAQVFKNWKVEQVN 236

Query: 306 MSREAIDDLYAPLIMGCDIAGEGGDKTV 333
            +             G D  G   D T 
Sbjct: 237 TNGWEGPYY------GLDF-GFSQDPTA 257


>gi|333006277|gb|EGK25786.1| gp33 TerL [Shigella flexneri K-218]
          Length = 540

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/356 (10%), Positives = 86/356 (24%), Gaps = 24/356 (6%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKPLEHFSQPHRWQL 56
           P      +   + L  +  + E + + K F           WG+   P            
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +          +               R +G +     +   L      M I   +  
Sbjct: 72  FLLFPKQEEWIHWIMERWGNRENGITEKSREMGLSWTAIGLACSLCLFNKEMVIGFGSRK 131

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
           E  + ++     + +           ++         +A  +                  
Sbjct: 132 EEYV-DSTGDPKALFWKARKFVETLPVEFRGSWDEKKHAPYMRVEFP---------ETGA 181

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
             +                  DE++     +        T        I  S+   +   
Sbjct: 182 VIKGEAGDNIGRGDRTTLYLVDESAFLQRPLLIDAALSQTTRCR----IDLSSVNGMANP 237

Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
           F    +        +    R     D  ++     +   +  V   E+   +        
Sbjct: 238 FAQKRHGGK--IPVFTFHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVL 294

Query: 297 IPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           IP  +++ A+              +   D+A EG DK     R G ++E++ +WS 
Sbjct: 295 IPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNSFSTRHGFLLENVREWSG 350


>gi|22855048|ref|NP_690654.1| hypothetical protein SPP1p003 [Bacillus phage SPP1]
 gi|1729903|sp|P54308|TERL_BPSPP RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein G2P; AltName: Full=Terminase large subunit
 gi|15466|emb|CAA39537.1| terminase [Bacillus phage SPP1]
 gi|2764840|emb|CAA66573.1| unnamed protein product [Bacillus phage SPP1]
          Length = 422

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 41/284 (14%), Positives = 80/284 (28%), Gaps = 27/284 (9%)

Query: 65  HCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTL 124
                         K  +  GRG  K+T  A  ++ L+   P ++ + I      ++ ++
Sbjct: 14  FLEVWRTVKAAQHLKYVLKGGRGSAKSTHIAMWIILLMMMMP-ITFLVIRRVYNTVEQSV 72

Query: 125 WAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTF 184
           + ++ + + ML   H +++    L  + +                 I     S+      
Sbjct: 73  FEQLKEAIDMLEVGHLWKVSKSPLRLT-YIPRGNSIIFRGGDDVQKIKSIKASKFPVAGM 131

Query: 185 VGPHNTHGMAVFNDE-ASGTPDIINKSILGFFTE----LNPNRFWIMTSNTR-RLNGWFY 238
                      + +E A    +     I                +  + N   R   W  
Sbjct: 132 -----------WIEELAEFKTEEEVSVIEKSVLRAELPPGCRYIFFYSYNPPKRKQSWVN 180

Query: 239 DIFNIPLEDWKRY--QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296
            +FN        +           +   F E        +    R E LG+      +  
Sbjct: 181 KVFNSSFLPANTFVDHSTYLQNPFLSKAFIEEAEEVKRRNELKYRHEYLGE---ALGSGV 237

Query: 297 IPHN--YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           +P     IEE +  +A    +  +  G D  G G D    V   
Sbjct: 238 VPFENLQIEEGIITDAEVARFDNIRQGLDF-GYGPDPLAFVRWH 280


>gi|268601026|ref|ZP_06135193.1| phage terminase [Neisseria gonorrhoeae PID18]
 gi|268585157|gb|EEZ49833.1| phage terminase [Neisseria gonorrhoeae PID18]
          Length = 417

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 74/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 11  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 68

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 69  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 111

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 112 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 169

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  +  +       G+               +       
Sbjct: 170 EINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQDAFHSGRV 229

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 230 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 268


>gi|332088044|gb|EGI93169.1| gp33 TerL [Shigella boydii 5216-82]
          Length = 539

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 45/365 (12%), Positives = 95/365 (26%), Gaps = 40/365 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E + + K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPALKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITDKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                F DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +N  F    +        +    R+    D  ++     +   +  +   E+   +
Sbjct: 230 SVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKI-DNPVIVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++  + 
Sbjct: 287 QASAEGILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQ 346

Query: 347 DWSAK 351
           +WS K
Sbjct: 347 EWSGK 351


>gi|217979215|ref|YP_002363362.1| hypothetical protein Msil_3091 [Methylocella silvestris BL2]
 gi|217504591|gb|ACK52000.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 490

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 41/296 (13%), Positives = 68/296 (22%), Gaps = 50/296 (16%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMM-------LWLISTRPGMS--II 111
            +   C               +  GR  GKT   A +         W     PG    ++
Sbjct: 44  ELFRQCTGRAEAQGAAFGFLWLVIGRRGGKTFAMALLACFLGLFRDWTSRLAPGERAVVL 103

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
            +A    Q K  L   +S  L                       E              I
Sbjct: 104 LVAADREQAK-ILRRYISGILEAP--------------MLAKMVEAETADTIELKGRVVI 148

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--------PDIINKSILGFFTELNPNRF 223
              T S      +             DE +             +  +I         +  
Sbjct: 149 EVATCS------YRTVRGRSVCVALLDEVAFWRRDDSVSPDTEVFVAIRASMATFGDDAM 202

Query: 224 WIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT-----RTVEGIDSGFHEGIISRYGLDSD 278
            ++ S+    +G  +  +           +            +   F +  I     D  
Sbjct: 203 MVVASSPYSKSGLLWTNYRKYFGKPDAQNLVWQAATRTMNPSVPQSFIDAEIE---RDPV 259

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAM---SREAIDDLYAPLIMGCDIAGEGGDK 331
            A  E   QF + +V  F+    IE  +    RE         +   D +G   D 
Sbjct: 260 SAAAEYGAQF-RTDVAAFVDREAIEACVASGRRELPPAPGVRYVAFADPSGGSSDS 314


>gi|323186590|gb|EFZ71927.1| gp33 TerL protein [Escherichia coli 1357]
          Length = 503

 Score = 75.8 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 45/365 (12%), Positives = 94/365 (25%), Gaps = 40/365 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E +   K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPVLKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITEKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                F DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +N  F    +        +    R+    D  ++     +   +  +   E+   +
Sbjct: 230 SVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKI-DNPVIVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++  + 
Sbjct: 287 QASAEGILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQ 346

Query: 347 DWSAK 351
           +WS K
Sbjct: 347 EWSGK 351


>gi|328472888|gb|EGF43736.1| terminase large subunit [Vibrio parahaemolyticus 10329]
          Length = 431

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 68/284 (23%), Gaps = 42/284 (14%)

Query: 80  CAISAGRGIGKTTLNAWMMLW--LISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
             +  GRG GKT      ML             + +   +T +++++ + VS  +     
Sbjct: 27  IVLKGGRGSGKTFAIICYMLEQSFEEKYRDSLFLVLREIQTSIEDSVHSVVSDLIKQAGL 86

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
             +F++    +       E     +              S  + +   G H      VF 
Sbjct: 87  EQYFKITHSKIINKLTNVEFAFTGLRSTGG-------KTSFSQVNKIKGKH--KVRMVFM 137

Query: 198 DEASGTPDIINKSILGFF--------TELNPNRFWIMTS---------------NTRRLN 234
           DEA          +            T        +                  N     
Sbjct: 138 DEAQDASQDSLDVLFPTVNRSGNVSFTSEYERLLRLAFGAEEVDLTEARFFFAMNPNFAE 197

Query: 235 GWFYDIFNIPLEDWKRYQIDTRTVEGI--DSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
                      +      I+   +     D+   E      G          LG+   + 
Sbjct: 198 DPVITKVRSFGDRAVIKHINIFDLPKRYQDTQLLEQAERERGE--VTWPHVWLGEPSPKI 255

Query: 293 VNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
                     E  +     D+     +   D + +G D T + F
Sbjct: 256 SGYPFA----ETPVVTAEEDEELLQCVAFLDPSYKGDDFTALSF 295


>gi|282878109|ref|ZP_06286910.1| phage terminase, large subunit, PBSX family [Prevotella buccalis
           ATCC 35310]
 gi|281299767|gb|EFA92135.1| phage terminase, large subunit, PBSX family [Prevotella buccalis
           ATCC 35310]
          Length = 423

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/295 (10%), Positives = 75/295 (25%), Gaps = 42/295 (14%)

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMM--LWLISTRPGM---SIICIANS 116
           +  H       +N   F   I+ GR  GK+   +  +  L    T        I+    +
Sbjct: 2   IKTHKVYYPIYANKDKFIILITGGRASGKSHFVSSFLERLTFEMTPVDKIVHQILYTRYT 61

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
                 ++  E  +   +   + +F      +      + ++ + +            T 
Sbjct: 62  MVSANISIIPEFLEKAELDGTQKYFRSTRSDVTNRMTGSTVMFRGLK-----------TS 110

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGT-PDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
           S  +       H         DEA     +   ++I+    +        +  N    N 
Sbjct: 111 SGNQTAKLKSIHG--ITTFVVDEAEEWVSEKEFETIMLSIRQKGIQNRIFIIMNPTDNNH 168

Query: 236 WFYDIFNIPLED---WKRYQIDTRTVEGI--------------DSGFHEGIISRYGLDSD 278
           W Y  F         +    +   T   +                 F   +      + +
Sbjct: 169 WVYKRFIENTHKEVMYDGIPVQISTHPNVLHIHTTYLDNLENLSQEFINEVEDMKANNPE 228

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTV 333
                ++G++          H  + +   +         + +G D      D + 
Sbjct: 229 KYAHTVMGRWADVAEGAVFKHIGVVKEFPKWCK-----KVAIGLDFGYT-NDVSA 277


>gi|16127022|ref|NP_421586.1| hypothetical protein CC_2790 [Caulobacter crescentus CB15]
 gi|221235816|ref|YP_002518253.1| phage DNA packaging protein [Caulobacter crescentus NA1000]
 gi|13424390|gb|AAK24754.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964989|gb|ACL96345.1| phage DNA packaging protein [Caulobacter crescentus NA1000]
          Length = 567

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 79/301 (26%), Gaps = 28/301 (9%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
           +P   Q     A+       + +         +  GRG GKT   A  + W     P   
Sbjct: 165 EPEDQQRLLSAALAEPLIHQLASPFSPWSTWLMLGGRGAGKTFAGARWITWNALAYPSQ- 223

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I  +   ++  +    S   +M    +    ++                        
Sbjct: 224 -ALIGPTLHDVREVMIEGPSGLKAMGGPAYRPRWEASRRRL------------------V 264

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                       +           A + DE    P       +  F         ++ + 
Sbjct: 265 WPNGAVAYAFSAEDPESLRGPQFHAAWADEFCAWPKPAETLAMLRFGLRLGEDPRLVVTT 324

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
           T + +     +   P          +     +   F   + S YG    +A  E+ G   
Sbjct: 325 TPKPHRALKTLMAEP-GVALTRAGTSANAGNLAPAFLRTLASLYGGT-RLAAQELDGVVV 382

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF--RRGNIIEHIF 346
           + +   F   +      +R A  D    +++  D  A   GD   +V   RR +    + 
Sbjct: 383 ETDGGLFRAEDLARCRAARPARLD---RVVVAVDPPATATGDACGIVVVGRRDDRAFVLA 439

Query: 347 D 347
           D
Sbjct: 440 D 440


>gi|332759085|gb|EGJ89395.1| gp33 TerL [Shigella flexneri 4343-70]
          Length = 519

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/267 (11%), Positives = 69/267 (25%), Gaps = 19/267 (7%)

Query: 86  RGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           R +G +     +   L      M I   +  E  + ++     + +           ++ 
Sbjct: 80  REMGLSWTAIGLACSLCLFNKEMVIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEF 138

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
                   +A  +                    +                  DE++    
Sbjct: 139 RGSWDEKKHAPYMRVEFP---------ETGAVIKGEAGDNIGRGDRTTLYLVDESAFLQR 189

Query: 206 IINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGF 265
            +        T        I  S+   +   F    +        +    R     D  +
Sbjct: 190 PLLIDAALSQTTRCR----IDLSSVNGMANPFAQKRHGGK--IPVFTFHWRDDPRKDEEW 243

Query: 266 HEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCD 323
           +     +   +  V   E+   +        IP  +++ A+              +   D
Sbjct: 244 YRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMD 302

Query: 324 IAGEGGDKTVVVFRRGNIIEHIFDWSA 350
           +A EG DK     R G ++E++ +WS 
Sbjct: 303 VADEGRDKNSFSTRHGFLLENVREWSG 329


>gi|194098237|ref|YP_002001293.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|240125445|ref|ZP_04738331.1| putative phage associated protein [Neisseria gonorrhoeae SK-92-679]
 gi|268684040|ref|ZP_06150902.1| phage terminase [Neisseria gonorrhoeae SK-92-679]
 gi|193933527|gb|ACF29351.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|268624324|gb|EEZ56724.1| phage terminase [Neisseria gonorrhoeae SK-92-679]
          Length = 424

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/279 (12%), Positives = 76/279 (27%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C+   +  +++T+   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCVREIQKSMRDTVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|169344384|ref|ZP_02865357.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
 gi|169297509|gb|EDS79616.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
          Length = 415

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 40/303 (13%), Positives = 84/303 (27%), Gaps = 32/303 (10%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIA 114
           +++  + V    +     +    F      G G GK+      M++     PG   + + 
Sbjct: 3   RIKINKRVFNEVYLPQLQNYEKRFNVFYGGG-GSGKSHFVVQKMIYKYLKYPGRKCLVVR 61

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
              + LK +++A     LS        ++    L        L       D +       
Sbjct: 62  KVNSTLKESIFALFRSVLSDWQIYDECKINKTDLTIELPNKSLFIFKGIDDPEKIKSIAG 121

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
                               +  +E +   +     +       NP     +  N    +
Sbjct: 122 IDD-----------------IVVEECTEIDEFDFDQLNLRLRSKNPYNQIHVMFNPVSKS 164

Query: 235 GWFYDIF---NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
            W Y  +       +D        +  + +   + + ++     +    RI  LG+F   
Sbjct: 165 NWVYKRWFKNGYDTKDTIVLHTTYKNNKFLPKDYIDSLLKLEKDNPVYFRIYALGEFATL 224

Query: 292 EVNNFIPHNYIEEAMSRE--AIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWS 349
             +  I  N+ EE+   +    ++     I   D      D T        +   I   +
Sbjct: 225 --DKLIYTNWKEESFDYKEILKNNRNTKAIFSLDFGYT-NDPTAF------VCSIIDKIN 275

Query: 350 AKL 352
            KL
Sbjct: 276 KKL 278


>gi|77463023|ref|YP_352527.1| putative large terminase [Rhodobacter sphaeroides 2.4.1]
 gi|126461897|ref|YP_001043011.1| hypothetical protein Rsph17029_1129 [Rhodobacter sphaeroides ATCC
           17029]
 gi|77387441|gb|ABA78626.1| Putative large terminase [Rhodobacter sphaeroides 2.4.1]
 gi|126103561|gb|ABN76239.1| protein of unknown function DUF264 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 414

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 75/288 (26%), Gaps = 35/288 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLIS-TRPG-----MSIICIANSETQLKNTLWAEVSKWLSM 134
            +  GRG GKT   A  +   +   RPG       +  +  +  Q +  +    S  L+ 
Sbjct: 21  VVMGGRGAGKTRAGAEWVRAEVEGARPGDPGRSRHVALVGETIDQAREVMVFGESGILAC 80

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                                                A
Sbjct: 81  SPPDRRPEWEAGRRRL------------------VWPNGAVAQIFSAHDPESLRGPQFDA 122

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +       +  R  ++T+  R +                 + 
Sbjct: 123 AWADELAKWGRAEEAWDMLQFSLRLGDQPR-QVVTTTPRNV--PVLRHILDNPSTVMTHA 179

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RY     + R E+ G   +           IE   SR    
Sbjct: 180 PTEANRAYLARSFLAEVHARYDGT-RLGRQELEGLLLEDVEGALWTTARIEA--SRLEEP 236

Query: 313 DLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                +++  D    G    D+  ++           DW A ++++ +
Sbjct: 237 GPLDRIVVAVDPPVTGTEASDECGILVVGARTAGPPQDWRAVVLEDAS 284


>gi|298290710|ref|YP_003692649.1| hypothetical protein Snov_0699 [Starkeya novella DSM 506]
 gi|296927221|gb|ADH88030.1| protein of unknown function DUF264 [Starkeya novella DSM 506]
          Length = 428

 Score = 75.4 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 46/297 (15%), Positives = 79/297 (26%), Gaps = 37/297 (12%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTR---PGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           +  GRG GKT   A  +  L   R   P   I  +A S   L+  +   VS  L++ P  
Sbjct: 42  VLGGRGAGKTRAGAEWVRALAFGRAGPPAGRIALVAESLGDLREVMVEGVSGLLAVHPRG 101

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFND 198
                +                                     D           A + D
Sbjct: 102 ERPTWEPTRKRLE------------------WPNGAVAQGFSADDPESLRGPQFDAAWCD 143

Query: 199 EASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTR 256
           E +          ++          R  + T+                            
Sbjct: 144 ELAKWRYAQAAFDNLQFGLRLGARPRQMVTTT---PRPTTLLRALLADPRTAVTRMGTAE 200

Query: 257 TVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID--DL 314
               +   F E ++ RY     + R E+ G+  +   +       IE      A +    
Sbjct: 201 NAAHLAPHFLETVVGRYAGT-RLGRQELDGELIEDRPDALWSRALIEAGREAAAPEMVRQ 259

Query: 315 YAPLIMGCDI---AGEGGDKTVVVF----RRGNIIEHIFDWSAKLIQETNQEGCPVG 364
              +++  D    + +  D   +V     R G  +  + D SA+ +  T   G  VG
Sbjct: 260 MERIVVAVDPPASSRKHADACGLVAAGIDRDGL-VHVLADESAQGLTPTGWGGRAVG 315


>gi|221638881|ref|YP_002525143.1| hypothetical protein RSKD131_0782 [Rhodobacter sphaeroides KD131]
 gi|221159662|gb|ACM00642.1| Hypothetical Protein RSKD131_0782 [Rhodobacter sphaeroides KD131]
          Length = 432

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 75/288 (26%), Gaps = 35/288 (12%)

Query: 81  AISAGRGIGKTTLNAWMMLWLIS-TRPG-----MSIICIANSETQLKNTLWAEVSKWLSM 134
            +  GRG GKT   A  +   +   RPG       +  +  +  Q +  +    S  L+ 
Sbjct: 39  VVMGGRGAGKTRAGAEWVRAEVEGARPGDPGRSRHVALVGETIDQAREVMVFGESGILAC 98

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
            P     E ++                                                A
Sbjct: 99  SPPDRRPEWEAGRKRL------------------VWPNGAVAQIFSAHDPESLRGPQFDA 140

Query: 195 VFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQ 252
            + DE +     +     +       +  R  ++T+  R +                 + 
Sbjct: 141 AWADELAKWGRAEEAWDMLQFSLRLGDQPR-QVVTTTPRNV--PVLRHILDNPSTVVTHA 197

Query: 253 IDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312
                   +   F   + +RY     + R E+ G   +           IE   SR    
Sbjct: 198 PTEANRAYLARSFLAEVHARYDGT-RLGRQELEGLLLEDVEGALWTTARIEA--SRLEEP 254

Query: 313 DLYAPLIMGCDIAGEG---GDKTVVVFRRGNIIEHIFDWSAKLIQETN 357
                +++  D    G    D+  ++           DW A ++++ +
Sbjct: 255 GPLDRIVVAVDPPVTGTEASDECGILVVGARTAGPPQDWRAVVLEDAS 302


>gi|94971392|ref|YP_593440.1| hypothetical protein Acid345_4366 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553442|gb|ABF43366.1| hypothetical protein Acid345_4366 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 496

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 39/316 (12%), Positives = 82/316 (25%), Gaps = 57/316 (18%)

Query: 78  FKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            +  +   R +G TT  A         RPG   + +A+ +      ++  V +++  LP 
Sbjct: 76  RRNIVLKARQLGITTYVASRFFLSTIMRPGTVTVQVAH-DQTAAEEIFRIVHRFVENLPE 134

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                        +   + L  + +            + ++      +  HN H      
Sbjct: 135 EM--------RKGALTTSRLNTRQIVFPKLDSAYLVESAADVNAGRGLTIHNLH-----C 181

Query: 198 DEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIP------LEDWKRY 251
            E +  P    + +      +  +   ++ S      G FYD +            +  +
Sbjct: 182 SEVARWPGDAAEVLASLRAAVPKHGEIVLESTPNGAGGCFYDEWQHAEEKGYTQHFFPWW 241

Query: 252 QIDTRTVEGIDSGFHEGIISRYG-----LDSDVARIEILGQF-----------PQQ---- 291
              + T+            S  G      +    R E+   F           P++    
Sbjct: 242 WEKSYTIGHRAEELSPEEESLVGRYGLSREQIAFRRELQFNFGKLARQEYAETPEECFLA 301

Query: 292 EVNNFIPHNYIEE---------------AMSREAIDDLYAPLIMGCDIAGEG--GDKTVV 334
                   + IE+                +            ++G D AG G  GD    
Sbjct: 302 SGECVFEVDVIEKRLAELRGPVETRENGRIETYYPPVRGREYVIGVDPAGGGSEGDYAAA 361

Query: 335 VFRRGNIIEHIFDWSA 350
                +      +   
Sbjct: 362 QVIERSTGLQCAELRG 377


>gi|268594527|ref|ZP_06128694.1| phage terminase [Neisseria gonorrhoeae 35/02]
 gi|268547916|gb|EEZ43334.1| phage terminase [Neisseria gonorrhoeae 35/02]
          Length = 426

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/279 (12%), Positives = 76/279 (27%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C+   +  +++T+   +   +
Sbjct: 20  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCVREIQKSMRDTVHRLLKDKV 77

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 78  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 120

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 121 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 178

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 179 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 238

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 239 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLMSVRIIG 277


>gi|224984406|ref|YP_002641809.1| phage terminase, large subunit, pbsx family [Borrelia valaisiana
           VS116]
 gi|224497005|gb|ACN52640.1| phage terminase, large subunit, pbsx family [Borrelia valaisiana
           VS116]
          Length = 450

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 78/288 (27%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------DYSKVIFSGGIASGKTFLASYLLIKKLIENKSLYERDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K    L    + + +S          EL            
Sbjct: 99  NFIIGNSIGLLMTNTIKQIEKICGFLGI-DYQKKKSGESFCKIAGLELN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y     D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGRNRDAFSKIRGGNSAIIYVNEATVIHKETLLEVIKRLRKG--KSIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F E     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
               +                 D  +   IM  D A   GGD T +  
Sbjct: 260 L-NESALFNEMIFN-------QDYEFKSPIMYIDPAFSVGGDNTAICV 299


>gi|26989017|ref|NP_744442.1| DNA maturase B [Pseudomonas putida KT2440]
 gi|24983840|gb|AAN67906.1|AE016423_1 DNA maturase B [Pseudomonas putida KT2440]
          Length = 562

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 44/375 (11%), Positives = 81/375 (21%), Gaps = 84/375 (22%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            F+ F+     W     P     +P   Q +    +                +C I A R
Sbjct: 13  DFRKFIYLV--WKHLNLP-----EPTPVQYDIARYLQHGPR-----------RCVIEAFR 54

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ + A  + WL+   P + I+ ++ S  +              M   +H       
Sbjct: 55  GVGKSWVTAAFVCWLLWRNPQLRILVVSASSARADAFSSFVKRLIHEMPLLQHLKPGPDQ 114

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTYSE----------ERPDTFVGPHNTHGMAVF 196
                 +             K   I  +              E P+          ++  
Sbjct: 115 IDKMVAFEVAPALPDQSPSVKSVGIMGQITGSRADIIIADDIEIPNNSATQMMRDKLSEA 174

Query: 197 NDEASGT-------------PDIINKSILGFFTELNPNR-FWIMTSNTRRLNGWFYD--- 239
             E                       S+     E       W             Y    
Sbjct: 175 VKEFDAILKPLQSARIIYLGTPQCEMSLYNRLPERGYEIRVWPALY-PTLQKVPHYKGSL 233

Query: 240 --IFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------QFPQQ 291
                  +E               D       ++ YG      +  +        +FP +
Sbjct: 234 APFITQAMEADPTLSGKPTDPRRFDEKDLMERMASYGRAGFALQFMLDTSLSDGDKFPLK 293

Query: 292 EVNNFI------------------------------PHNYIEEAMSREAIDDLYAPLIMG 321
             +  +                                +     M   +    Y   +M 
Sbjct: 294 VQDLMVMNLNPIMAHVKLAWAASPELCINDMPTVALTGDRFYRPMWHASEMSEYTGCVMA 353

Query: 322 CDIAGEGGDKTVVVF 336
            D +G G D+T    
Sbjct: 354 IDPSGRGQDETGYAV 368


>gi|239998675|ref|ZP_04718599.1| putative phage associated protein [Neisseria gonorrhoeae 35/02]
 gi|317163958|gb|ADV07499.1| putative phage associated protein [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 424

 Score = 75.0 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/279 (12%), Positives = 76/279 (27%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C+   +  +++T+   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCVREIQKSMRDTVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLMSVRIIG 275


>gi|293399332|ref|ZP_06643497.1| PBSX family phage terminase, large subunit [Neisseria gonorrhoeae
           F62]
 gi|291610746|gb|EFF39856.1| PBSX family phage terminase, large subunit [Neisseria gonorrhoeae
           F62]
          Length = 426

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 20  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 77

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 78  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 120

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 121 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 178

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 179 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 238

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 239 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 277


>gi|291044162|ref|ZP_06569878.1| phage terminase [Neisseria gonorrhoeae DGI2]
 gi|291012625|gb|EFE04614.1| phage terminase [Neisseria gonorrhoeae DGI2]
          Length = 426

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 20  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 77

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 78  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 120

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 121 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 178

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 179 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 238

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 239 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 277


>gi|240014419|ref|ZP_04721332.1| putative phage associated protein [Neisseria gonorrhoeae DGI18]
 gi|240016852|ref|ZP_04723392.1| putative phage associated protein [Neisseria gonorrhoeae FA6140]
 gi|240120865|ref|ZP_04733827.1| putative phage associated protein [Neisseria gonorrhoeae PID24-1]
 gi|254493400|ref|ZP_05106571.1| phage terminase [Neisseria gonorrhoeae 1291]
 gi|226512440|gb|EEH61785.1| phage terminase [Neisseria gonorrhoeae 1291]
          Length = 424

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|59801465|ref|YP_208177.1| putative phage associated protein [Neisseria gonorrhoeae FA 1090]
 gi|260440843|ref|ZP_05794659.1| putative phage associated protein [Neisseria gonorrhoeae DGI2]
 gi|59718360|gb|AAW89765.1| hypothetical protein, putative phage associated protein [Neisseria
           gonorrhoeae FA 1090]
          Length = 424

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|17570838|ref|NP_523347.1| DNA packaging protein B [Enterobacteria phage T3]
 gi|17384322|emb|CAC86310.1| DNA packaging protein B [Enterobacteria phage T3]
          Length = 586

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 98/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P      
Sbjct: 112 AELKPRPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATQ 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRSR 231

Query: 233 LNGWFY------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y       +     + ++  Q         D          YG      +  +  
Sbjct: 232 EEDLYYGERLAPMLREEFNDGFEMLQGQPTDPVRFDMEDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA----------MSREAIDD----------------- 313
                + +P +  +  +     E+A           +R                      
Sbjct: 292 NLSDAEKYPLRLRDAIVCGLDFEKAPMHYQWLPNRQNRNEELPNVGLKGDDIHSYHSCSQ 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NTGQYQQRILVIDPSGRGKDETGYAV 377


>gi|165928475|ref|ZP_02224307.1| P-loop protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165919510|gb|EDR36843.1| P-loop protein [Yersinia pestis biovar Orientalis str. F1991016]
          Length = 397

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/272 (12%), Positives = 73/272 (26%), Gaps = 56/272 (20%)

Query: 59  MEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSET 118
           +  V +H        +P  FK  + AGR  GK+ L+   ++   +      +  +A +  
Sbjct: 7   LSLVQLHSGQMQVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE 178
             +  LW ++ + L     R   +                   + + +            
Sbjct: 66  MARQILWDDLQEVLPRKWVRKKNDTTMT---------------IVLKNGSEIALKG---- 106

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFY 238
                                 +  PD   K +    +        ++     +    F+
Sbjct: 107 ----------------------ADKPDTWYKVLRPTLSS--TRGGALIIGTP-KGFSEFH 141

Query: 239 DIFNIPLE-------DWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQ 291
            ++ I           WK +Q  T     + S   E   +    D      E L  F   
Sbjct: 142 KLWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDM--DPKSFAQEYLASFENM 199

Query: 292 EVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
               + P +       +    +   P+ +G D
Sbjct: 200 SGRVYYPFD--RNVHVKPLQFNPKLPIWVGQD 229


>gi|189427245|ref|YP_001949795.1| gp19 [Salmonella phage phiSG-JL2]
 gi|189085898|gb|ACD75713.1| gp19 [Salmonella phage phiSG-JL2]
          Length = 587

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 96/386 (24%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P      P + Q++    +    +           
Sbjct: 11  LIIAQLKGDFVAFL--FVLWKALALP-----PPTKCQIDMARCLANGDNK---------- 53

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 54  KFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 112

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P      
Sbjct: 113 AELKPRPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATQ 172

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 173 GAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRSR 232

Query: 233 LNGWFY------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y       +     + ++  Q         D          YG      +  +  
Sbjct: 233 EEDLYYGDRLAPMLREEFNDGFEMLQGQPTDPVRFDMEDLRERELEYGKAGFTLQFMLNP 292

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA----------MSREAIDD----------------- 313
                + +P +  +  +     E+A           +R                      
Sbjct: 293 NLSDAEKYPLRLRDAIVCGLDFEKAPMHYQWLPNRQNRNEELPNVGLKGDDIHSYHSCSQ 352

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 353 NTGQYQQRILVIDPSGRGKDETGYAV 378


>gi|240112597|ref|ZP_04727087.1| putative phage associated protein [Neisseria gonorrhoeae MS11]
 gi|268598667|ref|ZP_06132834.1| phage terminase [Neisseria gonorrhoeae MS11]
 gi|268582798|gb|EEZ47474.1| phage terminase [Neisseria gonorrhoeae MS11]
          Length = 424

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 74/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLGHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  +  +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMSKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|170676278|ref|YP_001742039.1| large terminase subunit [Salmonella phage E1]
 gi|170321588|emb|CAM33107.1| phage large terminase subunit [Salmonella phage Vi II-E1]
          Length = 474

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/271 (11%), Positives = 71/271 (26%), Gaps = 36/271 (13%)

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
           P  FK     GRG  K+      ++     R    + C    +  +K + +AE+   ++ 
Sbjct: 76  PRRFKVFY-GGRGSAKSRSCISYLIEKARFR-NSRVGCFREIQNSIKESSYAELVDEINR 133

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
             H   +      +                 ++   +    +                  
Sbjct: 134 KGHTQEYRCVDGEI-------------THHSTRSKFVFRGLWRNITAIKG----MAGLTD 176

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL--------- 245
           VF +E+     +   +++            I+  N  +     +  F  P          
Sbjct: 177 VFCEESENISQVSWDTLIPTVRAAGSEI--IIVFNPNKETDPTWTNFVEPYINKMVDGIY 234

Query: 246 --EDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
             +D     ++            + +     +D D       G+F ++         +  
Sbjct: 235 QDDDIVVVNVNYVHNPWFTEELKQHMNQMKTVDYDRYLWVYEGKFNKRSDEQVFGGKWRI 294

Query: 304 EAMSREAIDDLYAPLIMGCDIAGEGGDKTVV 334
           +    +     + P   G D  G   D T +
Sbjct: 295 DNFEVKPEW--HGPY-FGMDF-GFSTDPTAM 321


>gi|53793591|ref|YP_112491.1| terminase large subunit [Flavobacterium phage 11b]
 gi|53748181|emb|CAH56642.1| terminase large subunit [Flavobacterium phage 11b]
          Length = 432

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/277 (14%), Positives = 80/277 (28%), Gaps = 30/277 (10%)

Query: 90  KTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLH 149
           K+ L    ++      PG   +   +    LK T      +  S+L     +   +    
Sbjct: 32  KSALGILWLIEQCQAYPGTRWLMGRSKLKALKETTLNTFFEQASILKITEQYNYNAQ--- 88

Query: 150 PSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINK 209
                       +  ++    +    Y+      F    +      F DE +       +
Sbjct: 89  ---------SGVIYWNNGSEILLKDLYAYPSDQNFDSLGSLEISGAFIDECNQITYKAWQ 139

Query: 210 S----ILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPL------EDWKRYQIDTRTVE 259
                I     +       + T N  +   W Y  F +         D K  Q       
Sbjct: 140 IVKSRIRYKLNQYGIEPKMLGTCNPAK--NWVYAQFYLKDKNGTLDNDKKFIQALPTDNP 197

Query: 260 GIDSGFHEGIISRYGLDSDVARIEILGQFP-QQEVNNFIPHNYIEEAMSREAIDDLYAPL 318
            + + +   ++S    D +  +    G +    +    I +  I+   +   I   +  +
Sbjct: 198 HLPASYLTSLLSL---DENSKQRLYYGNWEYDNDPAKLIDYEKIQNCFTNTFIP--FGEM 252

Query: 319 IMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQE 355
            +  DIA  G DK V+    G  +  IF  +   I E
Sbjct: 253 YISADIARFGSDKMVICVWSGFRVVEIFSMAKSSITE 289


>gi|9634048|ref|NP_052122.1| DNA packaging protein B [Yersinia phage phiYeO3-12]
 gi|6599039|emb|CAB63643.1| DNA packaging protein B [Yersinia phage phiYeO3-12]
          Length = 587

 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 96/386 (24%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P      P + Q++    +    +           
Sbjct: 11  LIIAQLKGDFVAFL--FVLWKALALP-----PPTKCQIDMARCLANGDNK---------- 53

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 54  KFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 112

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P      
Sbjct: 113 AELKPRPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATQ 172

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 173 GAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRSR 232

Query: 233 LNGWFY------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y       +     + ++  Q         D          YG      +  +  
Sbjct: 233 EEDLYYGDRLAPMLREEFNDGFEMLQGQPTDPVRFDMEDLRERELEYGKAGFTLQFMLNP 292

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA----------MSREAIDD----------------- 313
                + +P +  +  +     E+A           +R                      
Sbjct: 293 NLSDAEKYPLRLRDAIVCGLDFEKAPMHYQWLPNRQNRNEELPNVGLKGDDIHSYHSCSQ 352

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 353 NTGQYQQRILVIDPSGRGKDETGYAV 378


>gi|320179507|gb|EFW54461.1| Phage terminase, large subunit [Shigella boydii ATCC 9905]
          Length = 539

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 45/365 (12%), Positives = 94/365 (25%), Gaps = 40/365 (10%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIK--------GKPLEHF 48
           P      +   + L  +  + E +   K F           WG+         G P+   
Sbjct: 12  PDYQMVFEWRMERLQRIRQNPEILPVLKQFYRTNPAQFIIDWGMTTDPRNIDYGLPVTIP 71

Query: 49  SQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM 108
                 Q E++  +     +  N              R +G +     +   L      M
Sbjct: 72  FLLFPKQEEWIHWIMERWSNRENGITEKS--------REMGLSWTAIGLACSLCLFNKEM 123

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKH 168
            I   +  E  + ++     + +           ++         +A  +          
Sbjct: 124 VIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFP----- 177

Query: 169 YTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTS 228
                     +                F DEA+     +        T        I  S
Sbjct: 178 ----ETGAVIKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----IDLS 229

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
           +   +N  F    +        +    R+    D  ++     +   +  +   E+   +
Sbjct: 230 SVNGMNNPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECDKI-DNPVIVAQELDLNY 286

Query: 289 PQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                   IP  +++ A+              +   D+A EG DK     R G ++  + 
Sbjct: 287 QASAEGILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQ 346

Query: 347 DWSAK 351
           +WS K
Sbjct: 347 EWSGK 351


>gi|261881105|ref|ZP_06007532.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270332111|gb|EFA42897.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 423

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/295 (11%), Positives = 74/295 (25%), Gaps = 42/295 (14%)

Query: 62  VDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMM--LWLISTRPGM---SIICIANS 116
           +  H       SN   F   I+ GR  GK+   +  +  L    T        I+    +
Sbjct: 2   IKTHKVYYPIYSNKDKFIILITGGRASGKSHFVSSFLERLTFEMTPIDKIVHQILYTRYT 61

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
                 ++  E  +   +   + +F      +      + ++ + +            T 
Sbjct: 62  MVSANISIIPEFLEKAELDGTQKYFRSTRSDVTNRMTGSTVMFRGLK-----------TS 110

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGT-PDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
           S  +       H         DEA     +   ++I+    +       I+  N    N 
Sbjct: 111 SGNQTAKLKSIHG--ITTFVVDEAEEWVSEKEFETIMLSIRQKGIQNRIIIVMNPTDNNH 168

Query: 236 WFYDIFNIPLEDWK----------------RYQIDTRTV-EGIDSGFHEGIISRYGLDSD 278
           W Y  F                                  E +   F   +      + +
Sbjct: 169 WVYKRFIENTHKEVMYDGVPVQISTHPNVLHIHTTYLDNLENLSQEFINEVEDMKANNPE 228

Query: 279 VARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTV 333
                ++G++          H  + +   +         + +G D      D + 
Sbjct: 229 KYAHTVMGRWADVAEGAVFKHIGVVKEFPKWCK-----KVAIGLDFGYT-NDVSA 277


>gi|30387500|ref|NP_848309.1| DNA maturase B [Yersinia pestis phage phiA1122]
 gi|30314137|gb|AAP20545.1| DNA maturase B [Yersinia pestis phage phiA1122]
          Length = 586

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 47/386 (12%), Positives = 100/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P      
Sbjct: 112 AELKPRPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLTSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NSGQYQQKILVIDPSGRGKDETGYAV 377


>gi|219499179|ref|YP_002455350.1| putative phage terminase, pbsx family protein [Borrelia burgdorferi
           ZS7]
 gi|218164189|gb|ACK74256.1| putative phage terminase, pbsx family protein [Borrelia burgdorferi
           ZS7]
          Length = 450

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHRETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQAQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|317487266|ref|ZP_07946061.1| hypothetical protein HMPREF0179_03424 [Bilophila wadsworthia 3_1_6]
 gi|316921456|gb|EFV42747.1| hypothetical protein HMPREF0179_03424 [Bilophila wadsworthia 3_1_6]
          Length = 601

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 42/379 (11%), Positives = 90/379 (23%), Gaps = 82/379 (21%)

Query: 22  AECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCA 81
            E +  F+ F+     W     P      P   QL+    + ++             +  
Sbjct: 2   PEKLTDFRVFLTLV--WRHLNLP-----DPTPIQLD----IALYLQHGP-------RRKI 43

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           I A RG+GK+ + A  ++W +   P +  + ++ S+ +  N     +     +   +   
Sbjct: 44  IEAFRGVGKSWITAAYVVWRLRQNPNLKFMVLSASKDRADNFTTFCLRLINEIPILQCLI 103

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSE----------ERPDTFVGPHNTH 191
                      +                 I  +              E P+         
Sbjct: 104 PRADQRCSKLSFDVGPARADHAPSVTSKGIFSQITGGRADEIISDDVEVPNNSFTQAMRD 163

Query: 192 GMAVFNDEASGT-----------PDIINKSILGFFTELN-PNRFWIMTS-NTRRLNGWFY 238
            ++    E                    +S+     +     R W     +  +L  +  
Sbjct: 164 KLSEAVKEFDAILKPGGTITYLGTPQTEQSLYNQLPDRGYAIRIWPARYPSEDQLINYGN 223

Query: 239 DIFNIPLEDW----KRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ------F 288
           +     +  W          T                 YG      +  +  +      +
Sbjct: 224 ERLAPFILRWLEGEPTLVGRTTDPRRFSDDDLLERELSYGRSGFQLQFMLDTRLSDMEKY 283

Query: 289 PQQEVNNFI----PHNYIEEAMS---------------------------REAIDDLYAP 317
           P +  +  +      +  E+ +                                   Y  
Sbjct: 284 PLKLGDLIVMSCSATDAPEKPIWAAGTTNILNDVPCVGLNGDSRYYGPAFLHGTWLPYTG 343

Query: 318 LIMGCDIAGEGGDKTVVVF 336
            +M  D AG G D+T V  
Sbjct: 344 SVMAIDPAGRGKDETAVCV 362


>gi|240127880|ref|ZP_04740541.1| putative phage associated protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 424

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 18  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 75

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 76  AQLGLAHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 118

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 119 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 176

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 177 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 236

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 237 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 275


>gi|126728773|ref|ZP_01744588.1| terminase, large subunit, putative [Sagittula stellata E-37]
 gi|126710703|gb|EBA09754.1| terminase, large subunit, putative [Sagittula stellata E-37]
          Length = 432

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/291 (10%), Positives = 68/291 (23%), Gaps = 36/291 (12%)

Query: 58  FMEAVDVHCHSNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLWLISTRPG------MSI 110
            +  +               ++  +   GRG GKT   A  +   +             +
Sbjct: 16  ALPYLFDFWAHPHQLPPEGDWRTWVILGGRGAGKTRAGAEWVRAQVEGARPMKPGRCKRM 75

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
             I  +  Q +  +    S  L+  P       Q+                         
Sbjct: 76  AIIGETFDQAREVMVFGDSGILACSPPDRRPLWQASRKCL------------------VW 117

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTP--DIINKSILGFFTELNPNRFWIMTS 228
                                    + DE +           +       +  +  +   
Sbjct: 118 PNGAEAMIYSASEPEALRGPQFDGAWVDELAKWKRGQDTWDMLQFGLRLGDHPQVCVT-- 175

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
            T R  G               +         +   F + + SRY  +S +   E+ G  
Sbjct: 176 TTPRNVG-VLKALLALESTVTTHAPTEVNAAHLARSFLDEVRSRYA-NSSLGMQELDGLL 233

Query: 289 PQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEG--GDKTVVVF 336
             +        + ++    R  +      +++  D  AG+G   D   +V 
Sbjct: 234 LDEVDGAMWTRDLLDA--QRCGMLPALDRIVVAVDPPAGDGKRSDACGIVV 282


>gi|332560992|ref|ZP_08415310.1| hypothetical protein RSWS8N_18139 [Rhodobacter sphaeroides WS8N]
 gi|332274790|gb|EGJ20106.1| hypothetical protein RSWS8N_18139 [Rhodobacter sphaeroides WS8N]
          Length = 468

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/282 (12%), Positives = 73/282 (25%), Gaps = 32/282 (11%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLIST--RPGMSI--ICIANSETQLKNTLWAEVS 129
           + + FK  + + R  GKT       +    T  +       + ++  E Q    +   + 
Sbjct: 23  DDSRFKIGMFS-RQTGKTFSTCGECVDACFTAWKDDRRTRWVILSRGERQAAEAMTEVIK 81

Query: 130 -------KWLSMLPHRHWFEMQSLSLH---PSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
                  +  + L        +          G  A      +   +             
Sbjct: 82  PFTRAFYEVYNTLVKGGEPRFEEGEFRAPQEKGPDAVYKALEVAFPNGSRITA------- 134

Query: 180 RPDTFVGPHNTHGMAVFNDEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
            P             V  DE +       I  ++    ++        + S        F
Sbjct: 135 LPANPDTARGFSAN-VILDEFAFHAKSREIWAALFPVISKGGQKLR--VISTPNGKGNKF 191

Query: 238 YDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFI 297
           Y++       W R+ +D              ++     D D    E   ++  +  N ++
Sbjct: 192 YELMTAEGSVWSRHVVDIHEAVRQGLDRDIDMLRAGMADEDAWAQEYELKWLDEA-NAWL 250

Query: 298 PHNYIEEAMS---REAIDDLYAPLIMGCDIAGEGGDKTVVVF 336
            ++ I              +  P  +G DIA    D  V+  
Sbjct: 251 DYDLISACEHPAAGMPGLYMGGPCFVGVDIAAR-NDLFVIWV 291


>gi|194100409|ref|YP_002003984.1| gp19 [Enterobacteria phage 13a]
 gi|193201456|gb|ACF15933.1| gp19 [Enterobacteria phage 13a]
          Length = 586

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 47/386 (12%), Positives = 100/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +     +       K   IT +              E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLPSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NSGQYQQKILVIDPSGRGKDETGYAV 377


>gi|313892516|ref|ZP_07826105.1| DNA maturase B [Dialister microaerophilus UPII 345-E]
 gi|313119095|gb|EFR42298.1| DNA maturase B [Dialister microaerophilus UPII 345-E]
          Length = 567

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 44/395 (11%), Positives = 95/395 (24%), Gaps = 87/395 (22%)

Query: 8   DQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCH 67
               EQ++       +    F+ FV     W   G P     +P   Q +  E +    +
Sbjct: 1   MYWTEQQI------TKAKEDFRIFVFIV--WRSIGLP-----EPTEIQYDIAETLMNTPN 47

Query: 68  SNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAE 127
                      +  I   RG+ K+ L    ++W +   P + ++ ++ S+ +        
Sbjct: 48  D----------RFIIEGFRGVAKSFLTCAYVVWKLWKDPQLKVLVVSASKDRADANAIFI 97

Query: 128 VSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY----------S 177
               L +         +      + +   L    +    K   IT +             
Sbjct: 98  KRIILLIDFLDILRPQKGQRDTQNLFDVGLAIPDISPSVKSVGITGQITGSRADLLIADD 157

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGT------------PDIINKSILGFFTELNPNRFWI 225
            E P+          +     E                P                 R W 
Sbjct: 158 VEIPNNSSTQTQRMQLQERVKEFDAVLKPKGQIIYLGTPQNEMSLYNELTKRGYKKRIWT 217

Query: 226 MT--SNTRRLNGWFYDIFNIPLEDWKR----YQIDTRTVEGIDSGFHEGIISRYGLDSDV 279
           +   S  +    +  ++  +  E +      Y          ++         YG     
Sbjct: 218 VQYPSTKKERENYGDELAPLIAERYDNAPQAYAGQPTDPTRFNTEEIAKRKLSYGKAGFA 277

Query: 280 ARIEILGQ------FPQQEVNNFIP------------------------------HNYIE 303
            +  +         +P +  +  +                                +Y  
Sbjct: 278 LQFMLNTNLSDAEKYPLKIKDLIVTDIDNTKGSLKYSWCSERSHRLIDIPCVALKGDYFY 337

Query: 304 EAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
             +      + Y   +M  D +G G D+T     +
Sbjct: 338 SPLGMAEETEEYTGCVMAIDPSGRGKDETAYAIIK 372


>gi|226246423|ref|YP_002775825.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           29805]
 gi|226201818|gb|ACO38403.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           29805]
          Length = 450

 Score = 73.8 bits (179), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHRETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSTDFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|317483571|ref|ZP_07942553.1| phage terminase [Bifidobacterium sp. 12_1_47BFAA]
 gi|316914997|gb|EFV36437.1| phage terminase [Bifidobacterium sp. 12_1_47BFAA]
          Length = 487

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/281 (11%), Positives = 71/281 (25%), Gaps = 39/281 (13%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            RWQ   +  +             ++    +S  R  GKT   + +++ L +  P +++I
Sbjct: 42  DRWQQGLLTLI--LGRRADGTFAASVGGVVLSICRQTGKTFTVSSLVVILCTLIPNLTVI 99

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+      N  +  V   +       + +    +    G       Q +   +    +
Sbjct: 100 WTAHHNRTNSN-TFDHVRTLVRNPALIGYLDHSGRTDGVRGGNG---MQEITFANGSKIL 155

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                                  +  DEA    +     ++   T  +PN   +      
Sbjct: 156 FGARAQGFARGN------DAVDIIVFDEAQILTEQAISDMVPA-TNTSPNALVLYIGTPP 208

Query: 232 RLNGWFYDIFNIPLE-----------------------DWKRYQIDTRTVEGIDSGFHEG 268
           R             +                         +  + +              
Sbjct: 209 RPADPGEAFTERRRQALAGEDDMLYVEFSADRDADSDDRAQWRKANPSFPRRTSETSMLR 268

Query: 269 IISRYGLDSDVARIEILGQFPQQEVN-NFIPHNYIEEAMSR 308
           +  + G DS   R E LG + +   N    P  + + A   
Sbjct: 269 MQRQLGKDS--FRREALGIWDETATNRAINPEQWTKAATGT 307


>gi|268686275|ref|ZP_06153137.1| phage terminase [Neisseria gonorrhoeae SK-93-1035]
 gi|268626559|gb|EEZ58959.1| phage terminase [Neisseria gonorrhoeae SK-93-1035]
          Length = 417

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/279 (11%), Positives = 75/279 (26%), Gaps = 26/279 (9%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWL 132
             P  +K       G  K+   A  +L L + RP + I+C    +  +++++   +   +
Sbjct: 11  FKPCRYKVMYGGRGGG-KSHGAASALLALGAQRP-LRILCAREIQKSMRDSVHRLLKDKV 68

Query: 133 SMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHG 192
           + L   H++E+                  +   +    +     S               
Sbjct: 69  AQLGLAHFYEITD--------------FEIRGANGTLFVFSGLQS---HTVDSIKSFEGI 111

Query: 193 MAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF-NIPLEDWKRY 251
             V+ +E  G        +     +     +  +  N        Y  F  +P ED    
Sbjct: 112 DIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITL--NPDMETDETYRRFIAMPSEDTWLC 169

Query: 252 QIDTRTVEGIDSGFHEGI-ISRYGLDSDVARIEILGQFPQQEVNNFIP---HNYIEEAMS 307
           +I+ R         +     ++  ++ +       G+               +       
Sbjct: 170 EINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQDAFHSGRV 229

Query: 308 REAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
                D   P+    D+         +V R    +  I 
Sbjct: 230 TLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIG 268


>gi|203288609|ref|YP_002223516.1| bsr protein [Borrelia duttonii Ly]
 gi|201084316|gb|ACH93904.1| bsr protein [Borrelia duttonii Ly]
          Length = 450

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 42/290 (14%), Positives = 85/290 (29%), Gaps = 43/290 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST-----RPGMS 109
           Q E +  +           N    K   + G   GKT L +++++ L+           +
Sbjct: 49  QKEVLRDI----------DNNFCSKIIFNGGISSGKTFLASYLLIKLLIINRDHYHKDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              + +S   L      ++ K  S+L   +                   + S  +     
Sbjct: 99  NFIVGSSIGTLLANTLKQIEKICSLLNIEYLL-----------------KDSRQVTCTIA 141

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
            +T   Y  +  D+F     ++   V+ +EA+         I+    +       I  +N
Sbjct: 142 GLTLNIYGGKNIDSFTKIRGSNSALVYVNEATLMHKETLLEIMKRLRQ--KPGIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + ++ Y  +          F +   + Y   S      +LG++ 
Sbjct: 200 PDHPAHYFKVDYIDNRDVYRTYNFNIYDNPLNSKDFIKTQEAIYKNLSAYKARVLLGEWT 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVFRR 338
               + F  +  I                IM  D A   G D T +    
Sbjct: 260 ASIDSCF--NEVILNCEYTFKSP------IMYIDPAFSVGMDNTAICVFE 301


>gi|209885731|ref|YP_002289588.1| phage DNA Packaging Protein [Oligotropha carboxidovorans OM5]
 gi|209873927|gb|ACI93723.1| phage DNA Packaging Protein [Oligotropha carboxidovorans OM5]
          Length = 434

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/262 (12%), Positives = 70/262 (26%), Gaps = 35/262 (13%)

Query: 84  AGRGIGKTTLNAWMM------LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            GRG GKT   A  +      L  ++ +P   I  +  +E  ++  +   VS  L++   
Sbjct: 52  GGRGAGKTRAGAEWIRAQALGLAPLAQQPAGRIALVGETEHDVREVMIEGVSGLLAVHRR 111

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                 Q                                     +             + 
Sbjct: 112 DERPMWQPSRRRLE------------------WKNGAVAHAFSAEDPESLRGPQFACAWA 153

Query: 198 DEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT 255
           DE +     +     +          R   + + T R       + N             
Sbjct: 154 DELAKWRYAEAAFDMLQFGLRLGAQPRQ--LITTTPRPTALIKRLLN-DESCVTTRAATR 210

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
                +   F + +++RY     + R E+ G+  ++  +       IE     EA     
Sbjct: 211 SNALHLAPTFLQSVMARYAGT-RLGRQELDGELIEERPDALWSRGLIETCRISEAPPLQ- 268

Query: 316 APLIMGCDI---AGEGGDKTVV 334
             +++  D    +G+  D   +
Sbjct: 269 -RIVVAVDPPATSGKRADACGI 289


>gi|247553170|gb|ACS94899.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           297]
          Length = 450

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHRETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|11496928|ref|NP_045704.1| hypothetical protein BBA31 [Borrelia burgdorferi B31]
 gi|195942693|ref|ZP_03088075.1| hypothetical protein Bbur8_07694 [Borrelia burgdorferi 80a]
 gi|224796822|ref|YP_002642504.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|224796893|ref|YP_002642572.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
 gi|225573840|ref|YP_002724449.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           94a]
 gi|226234883|ref|YP_002775758.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
 gi|2690260|gb|AAC66261.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|221237191|gb|ACM10059.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|224554443|gb|ACN55827.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
 gi|225546432|gb|ACN92439.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           94a]
 gi|226202357|gb|ACO38016.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
 gi|247552767|gb|ACS94776.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           N40]
          Length = 450

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHRETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|254560550|ref|YP_003067645.1| hypothetical protein METDI2093 [Methylobacterium extorquens DM4]
 gi|254267828|emb|CAX23679.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 421

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 42/290 (14%), Positives = 80/290 (27%), Gaps = 35/290 (12%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMMLWLISTR------PGMS 109
             +EA  +H   +     P  +   A+  GRG GKT   A  +  L          P   
Sbjct: 10  RLLEADWLHLARHDQLPPPGNWTTWAVIGGRGSGKTRTGAEWVRGLAYGDPVFSPEPVER 69

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I  +  +   +++ +    S  L++                 G    + + S     +  
Sbjct: 70  IALVGETFADVRDVMIEGPSGLLALPRL--------------GGAPPVWQPSRR---RVV 112

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMT 227
                       +           AV++DE +     +     I          R  +  
Sbjct: 113 FGNGAVALAFSAEEPDSLRGPQFGAVWSDEVAKWREAEATYDMIQFGLRLGTHPRGLVT- 171

Query: 228 SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
             T R       +   P              + +   F E ++ RY     + R E+ G+
Sbjct: 172 -TTPRPVPLIRRLLADPRT-VVTRSRTADNAQNLAPSFLEEVVGRYAGT-RLGRQELDGE 228

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVV 334
             +   +     + IE A   E        + +  D    +  G D   +
Sbjct: 229 LIEDRPDALWTRDSIERARVSEVPPLQ--RIAVAIDPPASSRVGADACGI 276


>gi|119637788|ref|YP_919024.1| DNA packaging protein B [Yersinia phage Berlin]
 gi|119391819|emb|CAJ70692.1| hypothetical protein [Yersinia phage Berlin]
 gi|312436388|gb|ADQ83197.1| DNA maturase B [Yersinia phage Yep-phi]
          Length = 585

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 45/387 (11%), Positives = 99/387 (25%), Gaps = 88/387 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P     +P + Q++    +    H           
Sbjct: 10  LIVAQLKGDFVAFL--FVLWKALNLP-----KPTKCQIDMARTLADGDHK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W++   P + ++ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +   L +       K   IT +              E P      
Sbjct: 112 AELKPRPGQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADIIIADDVEVPGNSSTS 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W      R 
Sbjct: 172 SAREKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKGYSTVIWPAQY-PRN 230

Query: 233 LNGWFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI- 284
                Y    +         E ++  +         D+         YG      +  + 
Sbjct: 231 DAEALYYGDRLAPMLKAEYDEGFELLRGQPTDPVRFDTDDLRERELEYGKAGYTLQFMLN 290

Query: 285 ----LGQ-FPQQEVNNFI----------PHNYIEEAMSREAIDD---------------- 313
                 + +P +  +  +           + ++    +R                     
Sbjct: 291 PNLSDAEKYPLRLRDAIVCAVDPERAPLSYQWLPNRQNRNEELPNVGLKGDDIHSFHTCS 350

Query: 314 ----LYAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 351 SRTAEYQSKILVIDPSGRGKDETGYAV 377


>gi|94263678|ref|ZP_01287487.1| hypothetical protein MldDRAFT_1386 [delta proteobacterium MLMS-1]
 gi|93455983|gb|EAT06138.1| hypothetical protein MldDRAFT_1386 [delta proteobacterium MLMS-1]
          Length = 457

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 84/321 (26%), Gaps = 47/321 (14%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            +        +     + +    AGR  GKT   A + ++L +         I  +   L
Sbjct: 41  ELFTRLAGGRSAPTERVRELWAIAGRRSGKTNATAGIAVYLAT---------IGAAVDGL 91

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLH--PSGWYAELLEQSMGIDSKHYTITCRTYSE 178
            + L       +++L         +L            L +  +  D++   +  R   E
Sbjct: 92  LDKLAPGERGVVALLAVDRQQAKVALRYIAGMFEASPVLAQMVVKRDAEALHLDNRISIE 151

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPD--------IINKSILGFFTELNPNRFWIMTSNT 230
              + +        +A   DE +   D           ++IL            +  S+ 
Sbjct: 152 VSTNNYRSVRGRTLLAAVLDEVAFFRDDQSANPDVETYRAILPGLATTGG--LLVGISSP 209

Query: 231 RRLNGWFYDIFNI---PLEDWKRYQIDTRT-VEGIDSGFHEGIISRYGLDSDVARIEILG 286
               G  Y  +        D    Q  T      I +       +     +        G
Sbjct: 210 YAKRGLLYQKWRKHYGQDGDILVIQGATPDFNPTIPTSVITDAEADDPAAARAEWF---G 266

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAIDDLYAP---LIMGCDIAGEGGDKTVVVF------- 336
            F       F+    +E       +   Y          D AG G D+  +         
Sbjct: 267 LFRDDVEG-FLTREVVEACTRPSPLVIPYNRENIYTAFADPAGGGRDEFCLAIGHQEGEV 325

Query: 337 --------RRGNIIEHIFDWS 349
                   RRG   + + +++
Sbjct: 326 VVVDNLQARRGAPAKIVAEYA 346


>gi|247553003|gb|ACS94840.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|219807285|ref|YP_002477581.1| phage terminase, pbsx family protein [Borrelia burgdorferi 156a]
 gi|224797061|ref|YP_002642778.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|225571759|ref|YP_002724342.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
 gi|219692550|gb|ACL33771.1| phage terminase, pbsx family protein [Borrelia burgdorferi 156a]
 gi|223929616|gb|ACN24327.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|225547179|gb|ACN93166.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESTLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|137614|sp|P10310|VDMB_BPT3 RecName: Full=DNA maturase B; AltName: Full=DNA-packaging protein
           B; AltName: Full=GP19
 gi|215814|gb|AAA92528.1| DNA-packaging protein B [Enterobacteria phage T3]
          Length = 586

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 47/387 (12%), Positives = 100/387 (25%), Gaps = 88/387 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLK-NTLWAEVSKWLSMLPH 137
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +   N+++  +   + +LP 
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADLNSIF--IKNIIDLLPF 110

Query: 138 RHWFEMQSLSLHPSGWYAE-LLEQSMGIDSKHYTITCRTY----------SEERPDTFVG 186
               +           +     +       K   IT +              E P     
Sbjct: 111 LDELKPSPGQRDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSAT 170

Query: 187 PHNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTR 231
                 +     E                       ++     +        W       
Sbjct: 171 QGAREKLWTLVQEFRALLKPLPTSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRS 230

Query: 232 RLNGWFY------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI- 284
           R    +Y       +     + ++  Q         D          YG      +  + 
Sbjct: 231 REEDLYYGERLAPMLREEFNDGFEMLQGQPTDPVRFDMEDLRERELEYGKAGFTLQFMLN 290

Query: 285 ----LGQ-FPQQEVNNFIPHNYIEEA----------MSREAIDD---------------- 313
                 + +P +  +  +     E+A           +R                     
Sbjct: 291 PNLSDAEKYPLRLRDAIVCGLDFEKAPMHYQWLPNRQNRNEELPNVGLKGDDIHSYHSCS 350

Query: 314 ----LYAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 351 QNTGQYQQRILVIDPSGRGKDETGYAV 377


>gi|203288341|ref|YP_002223391.1| bsr protein [Borrelia recurrentis A1]
 gi|201085561|gb|ACH95134.1| bsr protein [Borrelia recurrentis A1]
          Length = 412

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 42/290 (14%), Positives = 83/290 (28%), Gaps = 43/290 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLIST-----RPGMS 109
           Q E +  +           N    K   + G   GKT L +++++ L+           +
Sbjct: 11  QKEVLRDI----------DNNFCSKIIFNGGISSGKTFLASYLLIKLLIINRDNYHKDTN 60

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
                +S   L      ++ K  S+L   +                   + S  +     
Sbjct: 61  NFIFGSSIGTLLANTLKQIEKICSLLNIEYLL-----------------KDSRQVTCTIA 103

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
            +T   Y  +  D+F     ++   V+ +EA+         I+    +       I  +N
Sbjct: 104 GLTLNIYGGKNIDSFTKIRGSNSALVYVNEATLMHKETLLEIMKRLRQ--KPGIIIFDTN 161

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + ++ Y             F +   + Y   S      +LG++ 
Sbjct: 162 PDHPAHYFKVDYIDNRDVYRTYNFSIYDNPLNSKDFIKTQEAIYKNLSAYKARVLLGEWT 221

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVFRR 338
               + F  +  I                IM  D A   G D T +    
Sbjct: 222 ASIDSCF--NEVILNCEYTFKSP------IMYIDPAFSVGMDNTAICVFE 263


>gi|325272814|ref|ZP_08139151.1| DNA maturase B [Pseudomonas sp. TJI-51]
 gi|324102019|gb|EGB99528.1| DNA maturase B [Pseudomonas sp. TJI-51]
          Length = 562

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 44/375 (11%), Positives = 81/375 (21%), Gaps = 84/375 (22%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            F+ F+     W     P     +P   Q +    +                +C I A R
Sbjct: 13  DFRKFIYLV--WKHLNLP-----EPTPVQYDIARYLQHGPR-----------RCVIEAFR 54

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ + A  + WL+   P + I+ ++ S  +              M   +H       
Sbjct: 55  GVGKSWVTAAFVCWLLWRNPQLRILVVSASSARADAFSTFVKRLIHEMPLLQHLKPGPDQ 114

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTYSE----------ERPDTFVGPHNTHGMAVF 196
                 +             K   I  +              E P+          ++  
Sbjct: 115 IDKMVAFEVAPALPDQSPSVKSVGIMGQITGSRADIIIADDIEIPNNSATQMMRDKLSEA 174

Query: 197 NDEASGT-------------PDIINKSILGFFTELNPNR-FWIMTSNTRRLNGWFYD--- 239
             E                       S+     E       W             Y    
Sbjct: 175 VKEFDAILKPLQSARIIYLGTPQCEMSLYNRLPERGYEIRVWPALY-PTLQKVPHYKGSL 233

Query: 240 --IFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------QFPQQ 291
                  +E               D       ++ YG      +  +        +FP +
Sbjct: 234 APFITQAMEADPSLSGKPTDPRRFDDKDLMERMASYGRAGFALQFMLDTSLSDGDKFPLK 293

Query: 292 EVNNFI------------------------------PHNYIEEAMSREAIDDLYAPLIMG 321
             +  +                                +     M   +    Y   +M 
Sbjct: 294 VQDLMVMNLNPIMAHVKLAWAASPELCINDMPTVALTGDRFYRPMWHASEMSEYTGCVMA 353

Query: 322 CDIAGEGGDKTVVVF 336
            D +G G D+T    
Sbjct: 354 IDPSGRGQDETGYAV 368


>gi|212712338|ref|ZP_03320466.1| hypothetical protein PROVALCAL_03426 [Providencia alcalifaciens DSM
           30120]
 gi|212685084|gb|EEB44612.1| hypothetical protein PROVALCAL_03426 [Providencia alcalifaciens DSM
           30120]
          Length = 411

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 40/269 (14%), Positives = 74/269 (27%), Gaps = 28/269 (10%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMMLWLIST----RPGMSIICIANSETQLKNTLWAEVSKW 131
             ++C+   GRG  KT   A M                I+C       L+ +   EV + 
Sbjct: 22  KRYRCSY-GGRGSAKTRTFALMSAVRAYQASNNGESGVILCAREFMNSLEESSMEEVKQA 80

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +  +P              +  +    +    +D K   + C      R +         
Sbjct: 81  IRAVP------------WLAAHFDIGEKYIRTVDRKVSYVFC----GLRHNLDSIKSKAR 124

Query: 192 GMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKR 250
            +  + DEA    +   + +     E N    W+   N  +        F     +D   
Sbjct: 125 ILLCWVDEAETVSETAWQKLDPTVREDNSE-IWVTW-NPEKDGSATDKRFRKNASDDCIT 182

Query: 251 YQIDTRTVEGIDSGFH-EGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSRE 309
            +++        S         R  LD         G + +      +   Y E     +
Sbjct: 183 VEMNYSDNPWFPSVLEGVRQKDRERLDDATYAWVWEGAYLENSEKQVLAGKY-EIRSFSD 241

Query: 310 AIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
            +      L+ G D  G   D   +  R+
Sbjct: 242 DLWKKADRLLFGADF-GFAKDPNTL-LRQ 268


>gi|251810445|ref|ZP_04824918.1| large terminase subunit [Staphylococcus epidermidis BCM-HMP0060]
 gi|251806049|gb|EES58706.1| large terminase subunit [Staphylococcus epidermidis BCM-HMP0060]
          Length = 420

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/291 (11%), Positives = 85/291 (29%), Gaps = 29/291 (9%)

Query: 72  NSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKW 131
             +          GRG GK++  + ++   +  R  M+ + +  ++  L  +++ ++   
Sbjct: 21  TKDREKLNIVAKGGRGSGKSSDISIIIT-QLIMRYPMNAVVVRKTDNTLATSVFEQIKWA 79

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +      H F+++   +             +    +   I  R          +      
Sbjct: 80  IEEQKVSHLFKVKVSPM------------EITYVPRGNRIIFRGAQNPERLKSLKDSRFP 127

Query: 192 GMAVFNDE-ASGTPDIINKSILGFFTEL----NPNRFWIMTSNTR-RLNGWFYDIFN--I 243
              ++ +E A    +    +I                +  + N   R   W    +    
Sbjct: 128 FSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNPPKRKQSWVNKKYETSF 187

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
             ++   +         I   F +   S    +    R E +G+         +P N ++
Sbjct: 188 QPDNTFVHHSTYLDNPFISKQFIQEAESAKERNEQRYRWEYMGEAIGSG---VVPFNNLQ 244

Query: 304 EAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGN----IIEHIFDWSA 350
                + + D +  +  G D  G   D    V    +    +I  I ++  
Sbjct: 245 IETIPQEMIDGFDNIRNGLDF-GYADDPLAFVRWHYDKKKRVIYAIDEYYG 294


>gi|323940932|gb|EGB37119.1| hypothetical protein ERDG_02336 [Escherichia coli E482]
          Length = 443

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 53/288 (18%), Positives = 82/288 (28%), Gaps = 38/288 (13%)

Query: 81  AISAGRGIGKTTLNAWMMLWLI---STRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
           A+  GR  GKT + +   +        RPGM I               AE  ++  +   
Sbjct: 27  AVRCGRRWGKTFMLSSAAVTYATSQFRRPGMDIELGGRVG-----IFTAEYRQYQEIYDK 81

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                +             LL+    ID                D  +         +  
Sbjct: 82  LEEILLPLKKSFSRQEKRLLLKNGGKIDFWVTN-----------DNKLAGRGREYEIILI 130

Query: 198 DEASG------TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY 251
           DEA+         +I  KSI           +   T +      +FY I +     +  +
Sbjct: 131 DEAAFTKSPEMLKEIWPKSIKPTLLTTKGRAYVFSTPDGVDEENFFYAICHNKDLGFHEH 190

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
              T +   +     E    R   D  V R E L +F      +        E  +++  
Sbjct: 191 HAPTSSNPFVPPEELEK--ERQNNDPRVFRQEFLAEFVDWSAASLFDVRKWFEGENQDQP 248

Query: 312 DDLYA---PLIMGCDIAGEGG---DKTVVVF-----RRGNIIEHIFDW 348
            D       +    D A +GG   D T VV+     R G     I DW
Sbjct: 249 VDYPEMCQAVFAVMDTAVKGGTDHDGTAVVYYAVDTRPGIQRLTILDW 296


>gi|218964078|ref|YP_002455438.1| putative phage terminase, pbsx family protein [Borrelia afzelii
           ACA-1]
 gi|216752969|gb|ACJ73583.1| putative phage terminase, pbsx family protein [Borrelia afzelii
           ACA-1]
          Length = 450

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 84/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H          T  K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------TYSKVIFSGGIASGKTFLASYLLIKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K   +L    + + +S          EL            
Sbjct: 99  NFIIGNSIGLLMTNTIKQIEKICGLLGI-DYQKKKSGQSFCKIAGLELN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         +             I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETL--LEVMKRLRKGKSIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F E     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWV 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E + F      E   +++     +   IM  D A   GGD T V  
Sbjct: 260 LNESSLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAVCV 299


>gi|117621599|ref|YP_853855.1| hypothetical protein BAPKO_2028 [Borrelia afzelii PKo]
 gi|110890985|gb|ABH02150.1| hypothetical protein BAPKO_2028 [Borrelia afzelii PKo]
          Length = 450

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 84/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ H          T  K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESH----------TYSKVIFSGGIASGKTFLASYLLIKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K   +L    + + +S          EL            
Sbjct: 99  NFIIGNSIGLLMTNTIKQIEKICGLLGI-DYQKKKSGQSFCKIAGLELN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         +             I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHKETL--LEVMKRLRKGKSIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F E     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWV 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E + F      E   +++     +   IM  D A   GGD T V  
Sbjct: 260 LNESSLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAVCV 299


>gi|222147998|ref|YP_002548955.1| large terminase [Agrobacterium vitis S4]
 gi|221734986|gb|ACM35949.1| large terminase [Agrobacterium vitis S4]
          Length = 459

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/277 (12%), Positives = 73/277 (26%), Gaps = 30/277 (10%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM--SIICIA 114
               +  +  H              +  GRG GKT   A  +  + S        I  + 
Sbjct: 56  RLARSWALLRHPLQAPPEGAWRNWLLMGGRGSGKTRAGAEWVHEIASAGEKSAVRIALVG 115

Query: 115 NSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCR 174
            +    +  +   +S    +  H+   E++                              
Sbjct: 116 ETLGDAREVMVDGLSGIARIARHK-RPEVEISRRRL------------------VWPNGA 156

Query: 175 TYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRR 232
                  +             + DE +     +     +       +  R   + + T R
Sbjct: 157 MAQMFSAEDPESLRGPQFHYAWCDEIAKWKHAEETFDMLQFSLRLGDDPRQ--VITTTPR 214

Query: 233 LNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQE 292
                  +   P                +  GF E + +RYG    + R E+ G+  +  
Sbjct: 215 PVPILKRLLADPGTR-LTRLSTFGNACNLAPGFIEALQARYGGT-RLGRQELDGELIEDR 272

Query: 293 VNNFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEG 328
            +     + +E+   R +       +++G D  +G G
Sbjct: 273 EDALWRRDRLEQLTVRLSEP--LHRIVVGVDPPSGAG 307


>gi|329735579|gb|EGG71866.1| phage terminase, large subunit, PBSX family [Staphylococcus
           epidermidis VCU028]
          Length = 420

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 34/291 (11%), Positives = 85/291 (29%), Gaps = 29/291 (9%)

Query: 72  NSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKW 131
             +          GRG GK++  + ++   +  R  M+ + +  ++  L  +++ ++   
Sbjct: 21  TKDRKKLNVVAKGGRGSGKSSDISIIIT-QLIMRYPMNAVVVRKTDNTLATSVFEQIKWA 79

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +      H F+++   +             +    +   I  R          +      
Sbjct: 80  IEEQKVSHLFKVKVSPM------------EITYVPRGNRIIFRGAQNPERLKSLKDSRFP 127

Query: 192 GMAVFNDE-ASGTPDIINKSILGFFTEL----NPNRFWIMTSNTR-RLNGWFYDIFN--I 243
              ++ +E A    +    +I                +  + N   R   W    +    
Sbjct: 128 FSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNPPKRKQSWVNKKYETSF 187

Query: 244 PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIE 303
             ++   +         I   F +   S    +    R E +G+         +P N ++
Sbjct: 188 QPDNTFVHHSTYLDNPFISKQFIQEAESTKERNELRYRWEYMGEAIGSG---VVPFNNLQ 244

Query: 304 EAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGN----IIEHIFDWSA 350
                + + D +  +  G D  G   D    V    +    +I  I ++  
Sbjct: 245 IETIPQEMIDGFDNIRNGLDF-GYADDPLAFVRWHYDKKKRVIYAIDEYYG 294


>gi|296445591|ref|ZP_06887546.1| protein of unknown function DUF264 [Methylosinus trichosporium
           OB3b]
 gi|296256836|gb|EFH03908.1| protein of unknown function DUF264 [Methylosinus trichosporium
           OB3b]
          Length = 442

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 74/264 (28%), Gaps = 35/264 (13%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSML 135
           I +GRG GKT   A  +  +   RP         I  I  +   +++ +   VS  L+  
Sbjct: 58  ILSGRGAGKTRAGAEWVKGIARGRPQFATRPLSPIALIGETAADVRDVMIEGVSGILAAH 117

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
                   +S     +                              +           A 
Sbjct: 118 SRSERPLWESSRRRLT------------------FDNGVVAQAFSAEDPESLRGPQFAAA 159

Query: 196 FNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           + DE +     +     +       +  R  +    T R       +             
Sbjct: 160 WCDELAKWRYAEETWDMLQFGLRLGDWPRQLVT--TTPRPMPLIKRLLTEN-GVAVTRAK 216

Query: 254 DTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
                  +   F E ++S+YG    + R E+ G+  +Q  +     + +E A  R     
Sbjct: 217 TRANAANLAPSFLETVLSQYGGT-RLGRQELDGEIVEQRADALWTRDMLERA--RILAPP 273

Query: 314 LYAPLIMGCDI---AGEGGDKTVV 334
               +++  D    +G+  D+  +
Sbjct: 274 PLERIVVAIDPPASSGKRADRCGI 297


>gi|115523910|ref|YP_780821.1| hypothetical protein RPE_1893 [Rhodopseudomonas palustris BisA53]
 gi|115517857|gb|ABJ05841.1| protein of unknown function DUF264 [Rhodopseudomonas palustris
           BisA53]
          Length = 423

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/278 (12%), Positives = 72/278 (25%), Gaps = 38/278 (13%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            GRG GKT   A  +       P         I  +  +E  ++  +   VS  L++ P 
Sbjct: 40  GGRGSGKTRAGAEWIRAQALGLPPFADRPMSRIALVGETEHDVREVMIEGVSGLLAVHPR 99

Query: 138 RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFN 197
                 Q                                     +             ++
Sbjct: 100 HERPNWQPSRKRLE------------------WKNGAVAQAFSAEDPESLRGPQFSCAWS 141

Query: 198 DEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT 255
           DE +     +     +          R   + + T R       +   PL      +  T
Sbjct: 142 DEMAKWRYAEATFDMLQFGLRLGPQPRQ--LITTTPRPIALLKRLIADPLS--VVTRAPT 197

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
           R      +      + +    + + R E+ G+  +   +       IE+   R       
Sbjct: 198 RANAFNLAPTFLQSVMKRYDGTRLGRQELDGEIIEDRPDALWSRALIEQC--RVEAAPPL 255

Query: 316 APLIMGCDI---AGEGGDKTVVV---FRRGNIIEHIFD 347
             +++  D    + +  D   +V       N++  + D
Sbjct: 256 RRIVVAVDPPVSSTKRSDACGIVAAGLADNNVVHVLAD 293


>gi|37526791|ref|NP_930135.1| hypothetical protein plu2901 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786223|emb|CAE15275.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 409

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/257 (13%), Positives = 65/257 (25%), Gaps = 26/257 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGM----SIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M                I+C       L+ +   EV + +  +P   
Sbjct: 29  GGRGSAKTRTFAMMSAVRAYQAAESGTSGVILCAREFMNSLEESSMEEVKQAIRSIP--- 85

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  E           +    +   R +          +  + DE
Sbjct: 86  -------------WLDDYFEIGEKYIRTKNRLVNYVFCGLRHNLDSIKSKARILLAWIDE 132

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTV 258
           A    +   K +     E      W+   N  +            P +     +++    
Sbjct: 133 AESVSETAWKKLRPTVRESGSE-IWVTW-NPEKDGSATDKRLRKKPPKSSIIVEMNYSDN 190

Query: 259 EGIDSGFHEGIISR-YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   E        LD         G + +      + + Y  E+   + +      
Sbjct: 191 PWFPDVLEEERQEDLESLDHSDYAWIWEGAYLENSEKQVLANKYKIESF-PDDLWMQADR 249

Query: 318 LIMGCDIAGEGGDKTVV 334
           L+ G D  G   D + +
Sbjct: 250 LLFGADF-GFARDPSTL 265


>gi|37956903|gb|AAP34169.1| gene 19 [Enterobacteria phage T7]
          Length = 586

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 97/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFLAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAEL-----------LEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
              + +         +                   G  +            E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGPANPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLSSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NSGQYQQKILVIDPSGRGKDETGYAV 377


>gi|295688413|ref|YP_003592106.1| hypothetical protein Cseg_0983 [Caulobacter segnis ATCC 21756]
 gi|295430316|gb|ADG09488.1| protein of unknown function DUF264 [Caulobacter segnis ATCC 21756]
          Length = 445

 Score = 73.1 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 39/296 (13%), Positives = 78/296 (26%), Gaps = 36/296 (12%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
             +   + H     +     +F      GRG GKT   A  ++   +   G  +  +  +
Sbjct: 54  RTLRIREDHQLPPPDPWVTWLF----LGGRGAGKTYAGAAWLIEQATA--GARLALVGPT 107

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
              ++  +    S   ++         ++                             T 
Sbjct: 108 FHDVREVMIEGPSGLKALSLPDEHPRWEASRRRL------------------VWPNGATA 149

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLN 234
                +           A + DE    P        +          R  +    T + +
Sbjct: 150 YAFSAEDPDSLRGPQFHAAWADEFCAWPKPGDTLAMLRFGLRLGADPRLVVT--TTPKPH 207

Query: 235 GWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVN 294
                +   P          +     +   F   + S YG    +A  E+ G   + +  
Sbjct: 208 RALKVLMAEP-GVSLTRAGTSANAGNLAPAFLRTLESLYGGT-RLAAQELDGVIVETDGG 265

Query: 295 NFIPHNYIEEAMSREAIDDLYAPLIMGCD-IAGEGGDKTVVVF--RRGNIIEHIFD 347
            F   +      +R A  D    +++  D  A  GGD   +V   RR +    + D
Sbjct: 266 LFRAEDLARCRAARPARLD---RVVVAVDPPATAGGDACGIVVVGRRDDRAFVLAD 318


>gi|296141561|ref|YP_003648804.1| terminase [Tsukamurella paurometabola DSM 20162]
 gi|296029695|gb|ADG80465.1| Terminase [Tsukamurella paurometabola DSM 20162]
          Length = 489

 Score = 73.1 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 51/353 (14%), Positives = 87/353 (24%), Gaps = 64/353 (18%)

Query: 29  KNFVMRF--FPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
           + F+     F    KG   +       WQ++    V       V    P          R
Sbjct: 25  ERFLAFADKFLRVPKGTGAKGKLHLRDWQVDVARDVLDSGARTVGIMFP----------R 74

Query: 87  GIGKTTLNAWMMLW-LISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQS 145
           G GKTTLNA + L+   +   G ++  +A  E Q                         S
Sbjct: 75  GQGKTTLNAAIALYRFFTGGEGANVCVVAVDERQA--------------------GLAFS 114

Query: 146 LSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPD 205
            +        EL  +      + Y  T  +  +  P +         +    DEA     
Sbjct: 115 AARRMVELNEELSARCQIFKDRLYLPTTDSVFQCLPASPTALEGLDYVLALVDEAGVVNR 174

Query: 206 IINKSILGFFTELNPNRFWIMTSNT-------------------RRLNGWFYDIFNIPL- 245
            + + +             +                               +  F+    
Sbjct: 175 DVFEVVQ-LAQGKREKSVLVAIGTPGPNLDDQVLLSLRDYHLEHPDDASLRWREFSAAGF 233

Query: 246 EDWKRYQIDTRT--VEGIDSGFHEGIIS---RYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           ED               +D   H   +             R   L QF      +F+P  
Sbjct: 234 EDHPVDCTHCWELANPALDDFLHRDALVALLPPKTRESTFRRARLCQFAADTEGSFLPAG 293

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVV---VFRRGNIIEHIFDWSA 350
             E   + E +  L A +++  D +    D T +             +  W  
Sbjct: 294 VWEGLSTGEPVP-LGAEVVIALDGS-FSDDTTALLLGTVAAAPHFHPLRVWER 344


>gi|87307615|ref|ZP_01089759.1| hypothetical protein DSM3645_28877 [Blastopirellula marina DSM
           3645]
 gi|87289785|gb|EAQ81675.1| hypothetical protein DSM3645_28877 [Blastopirellula marina DSM
           3645]
          Length = 429

 Score = 73.1 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 34/287 (11%), Positives = 68/287 (23%), Gaps = 37/287 (12%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P   Q E +     H                +  GR  GKT   A ++  ++        
Sbjct: 26  PLPHQREILRDRHRHKR--------------VICGRRWGKT--GAGLIAAILGHGDPS-- 67

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLH-PSGWYAELLEQSMGIDSKHY 169
                         W  +    ++      F             +A      +  + +  
Sbjct: 68  ---GPGH-------WKGMVDGGTLYWVAPTFAQSKKIERDIMLAFANSGLVYVKSEGRIE 117

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIIN-KSILGFFTELNPNRFWIMTS 228
             +  + + +     V         +  DE +     +   ++    ++    R W M  
Sbjct: 118 HPSGGSITIKTAAAPVSLRGEGLDGMIGDEFAFVRKEVWSDALRPALSD---RRGWSMFL 174

Query: 229 NTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQF 288
            T     W  D  ++   D         T +       E   +   L       E   QF
Sbjct: 175 TTPNGPNWMKDQHDLDGVDPTYKSWQCPTSDNCLIDQAELDSALLDLGQASFDQEYRAQF 234

Query: 289 PQQEVNNFIPHNYIEEA---MSREAIDDLYAPLIMGCDIAGEGGDKT 332
                       Y +           +      ++G D +    DK+
Sbjct: 235 VDVS-GAEFSGLYFQTPKFWFDDWPPESEIRFRVIGLDPSKGKNDKS 280


>gi|114320225|ref|YP_741908.1| hypothetical protein Mlg_1066 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226619|gb|ABI56418.1| hypothetical protein Mlg_1066 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 463

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 44/294 (14%), Positives = 86/294 (29%), Gaps = 34/294 (11%)

Query: 66  CHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIIC---IANSETQLKN 122
                +       +  +  GR  GK+   A + ++    +     +    +A +     +
Sbjct: 50  LTDRESAPQSAHDELWLVVGRRGGKSNAAALLAVYEACFKDHRDALAPGEVATTRVMAAD 109

Query: 123 TLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPD 182
              A           R  F   S  +H +     L+ +    D +   ++ R   E    
Sbjct: 110 RAQA-----------RSVFRYISGLMHANPMLERLIVRE---DRESIELSNRAVIEVGTA 155

Query: 183 TFVGPHNTHGMAVFNDEASGT--------PDIINKSILGFFTELNPNRFWIMTSNTRRLN 234
           +F         AV  DE +             I  ++      LN     I  S+     
Sbjct: 156 SFRTTRGYTFAAVIADEVAFWRSDDSANPDSEIIAAVRPGLATLNGKL--IALSSPYARR 213

Query: 235 GWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGII-SRYGLDSDVARIEILGQFPQQEV 293
           G  ++ +           +       ++    E ++      D   A  E L +F + +V
Sbjct: 214 GELWENYRRHYGKASPILVAQAPSRTMNPSLPERVVTEAMERDPASAAAEYLAEF-RTDV 272

Query: 294 NNFIPHNYIEEAMSREAIDDLYA---PLIMGCDIAGEGGDK--TVVVFRRGNII 342
             F+    +E A     ++  Y          D AG G D+    +  R G  +
Sbjct: 273 ETFLQREVVEAATRPTPLELPYNKRVTYTAFVDPAGGGADEFTAAIGHREGERV 326


>gi|194100512|ref|YP_002003357.1| gp19 [Yersinia phage Yepe2]
 gi|193201245|gb|ACF15726.1| gp19 [Yersinia phage Yepe2]
          Length = 585

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 44/384 (11%), Positives = 97/384 (25%), Gaps = 88/384 (22%)

Query: 22  AECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCA 81
           A+    F  F+  F  W     P     +P + Q++    +    H           K  
Sbjct: 13  AQLKGDFVAFL--FVLWKALNLP-----KPTKCQIDMARTLADGDHK----------KFI 55

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           + A RGIGK+ +    ++W++   P + ++ ++ S+ +        +   + +LP     
Sbjct: 56  LQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIF-IKNIIDLLPFLAEL 114

Query: 142 EMQSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNT 190
           + +         +   L +       K   IT +              E P         
Sbjct: 115 KPRPGQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADIIIADDVEVPGNSSTSSAR 174

Query: 191 HGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRRLNG 235
             +     E +                     ++     +        W      R    
Sbjct: 175 EKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKGYSTVIWPAQY-PRNDAE 233

Query: 236 WFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI---- 284
             Y    +         E ++  +         D+         YG      +  +    
Sbjct: 234 ALYYGDRLAPMLKAEYDEGFEILRGQPTDPVRFDTDDLRERELEYGKAGYTLQFMLNPNL 293

Query: 285 -LGQ-FPQQEVNNFI----------PHNYIEEAMSREAIDD------------------- 313
              + +P +  +  +           + ++    +R                        
Sbjct: 294 SDAEKYPLRLRDAIVCAVDPERAPLSYQWLPNRQNRNEELPNVGLKGDDIHSFHTCSSRT 353

Query: 314 -LYAPLIMGCDIAGEGGDKTVVVF 336
             Y   I+  D +G G D+T    
Sbjct: 354 AEYQSKILVIDPSGRGKDETGYAV 377


>gi|308451045|ref|XP_003088525.1| hypothetical protein CRE_30323 [Caenorhabditis remanei]
 gi|308247019|gb|EFO90971.1| hypothetical protein CRE_30323 [Caenorhabditis remanei]
          Length = 490

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/298 (9%), Positives = 73/298 (24%), Gaps = 49/298 (16%)

Query: 80  CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
             +S  R +GKT L   +++ L    P ++++  A+       T               H
Sbjct: 54  VQLSIPRQVGKTFLVGMIIIALCILTPRLTVLWTAHRTKTATKTFQTMQGMVKKKKIRGH 113

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
               ++  +          EQ +   +    +          +   G           DE
Sbjct: 114 LAPGRNDGIR-----TANGEQEIRFRNGSVIMFGA------REGGFGRGFDEVDIEVFDE 162

Query: 200 ASGTPDIINKSILGFFTELNPN--RFWIMTSNTRRLNGWFYDIFNI-------------- 243
           A    +   + ++    +                R      +                  
Sbjct: 163 AQILTEKALEDMVAATNQSRQKSGALLFFMGTPPRATDPGEEWLERRNDALEIKPMDQVV 222

Query: 244 ------------------PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEIL 285
                             P +  +  + +              +      + D  + E +
Sbjct: 223 GLSEDTVYVEFSADKDADPDDMEQLAKANPSFPHRTPLESVMRMRKNL-KNEDSFKREAM 281

Query: 286 GQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTV-VVFRRGNII 342
           G +   +    I  + +  +   +        L +  D+A +    +V +  RR + +
Sbjct: 282 GIYDALDSGQVI--DDVSWSRVADPASMPIERLTLAIDVAPDRSMASVSLAGRRADGL 337


>gi|150016242|ref|YP_001308496.1| hypothetical protein Cbei_1360 [Clostridium beijerinckii NCIMB
           8052]
 gi|149902707|gb|ABR33540.1| conserved hypothetical protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 521

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/343 (9%), Positives = 98/343 (28%), Gaps = 49/343 (14%)

Query: 15  LHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSN 74
           +++     +       F   F     K   L  F   ++ Q +FME +            
Sbjct: 1   MNDEEKFLKVWNDPALFSYNFMEIQDKNDELVPFK-FNKLQRDFMENMS----------- 48

Query: 75  PTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSM 134
              +   + + R +G + +     +WL  T P  + + ++ ++   K  ++ ++ +    
Sbjct: 49  --RYNIILKS-RQLGFSVMICAYAIWLAITTPNSNCLMLSYNDES-KRAIFNKLKQIYKS 104

Query: 135 LPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMA 194
           +P                         + +++          S                 
Sbjct: 105 IPEE-----------VKPKLLRNNRSELQMENGSII------SCSPMGNVDKGRGNTCSL 147

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF---NIPLEDWKRY 251
           ++  E +     + +  +    +   ++  ++   T     +F+ ++         +K +
Sbjct: 148 IWISEFAFVKSDVAEKQILSLEQALNSKGKLIIETTANGLNFFHGMYIKSKRKENFYKSF 207

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARI----------EILGQFPQQEVNNFIPHNY 301
             +    + +    +E     +    +              E+L  +P   ++      +
Sbjct: 208 FYNYLDGKEMFLEQYEEARDTWKNLHNNVPFSEKDLKDDEKELLKNYPNMTLDVL---CW 264

Query: 302 IEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH 344
               +   + D       +  D+A      +V   +R + +  
Sbjct: 265 RRLKIENSSEDKFNQEYPISDDVAFISTGASVFDNKRVSTVLQ 307


>gi|227500282|ref|ZP_03930349.1| terminase [Anaerococcus tetradius ATCC 35098]
 gi|227217568|gb|EEI82880.1| terminase [Anaerococcus tetradius ATCC 35098]
          Length = 466

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 38/315 (12%), Positives = 89/315 (28%), Gaps = 49/315 (15%)

Query: 39  GIKGKPLEHFSQ--PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAW 96
           G +   +   +   P+ WQ + ++ +       +   +   +       R  GKT +   
Sbjct: 22  GQEAIDIYKKTGLSPYPWQEKLIKDIFAVNDDGLWTHSKFGYAV----PRRNGKTEIVYM 77

Query: 97  MMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAE 156
             LW +    G +II  A+  +    + + ++ K+L  +      + +S+          
Sbjct: 78  AELWFLM--DGKNIIHTAHRISTSH-SSFKKLKKYLEKMGLVDKVDFKSIKAKGQ----- 129

Query: 157 LLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFT 216
                +           RT +                 +  DEA    +    ++    T
Sbjct: 130 -EMIELIKTGGVIQFRTRTETGGL--------GEGFDLLVIDEAQEYTEGQESALKYTVT 180

Query: 217 ELNPNRFWIMTSNTRR--LNGWFYDIFNIPL-------EDWKRYQIDTRTVEGIDSGFHE 267
           + +     +M          G  +  +   +         W  + +   T       +++
Sbjct: 181 DSDNPMI-LMCGTPPTLVSGGTVFSKYRDLILSGGKNHNGWAEWSVSEMTNPYDIDAWYK 239

Query: 268 ------------GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLY 315
                        +    G D     I+ LG + +    + I     +  +    +  L 
Sbjct: 240 TNPSMGYKLRERAVEEEIGPDETDFNIQRLGYWVKYNQKSVISKLDWDR-LKLTRLPSLV 298

Query: 316 APLIMGCDIAGEGGD 330
             L +G      G D
Sbjct: 299 GKLHVGI---KYGND 310


>gi|212671426|ref|YP_002308426.1| DNA packaging protein B [Kluyvera phage Kvp1]
 gi|211997270|gb|ACJ14587.1| DNA packaging protein B [Kluyvera phage Kvp1]
          Length = 585

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 45/387 (11%), Positives = 98/387 (25%), Gaps = 88/387 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P     +P + Q++    +    H           
Sbjct: 10  LIVAQLKGDFVAFL--FVLWKALNLP-----KPTKCQIDMARTLANGDHK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W++   P + ++ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +   L +       K   IT +              E P      
Sbjct: 112 AELKPRPGQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADIIIADDVEVPGNSSTS 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W      R 
Sbjct: 172 SAREKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKGYSTVIWPAQY-PRN 230

Query: 233 LNGWFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI- 284
                Y    +         E ++  +         D          YG      +  + 
Sbjct: 231 DAEALYYGDRLAPMLKAEYDEGFELLRGQPTDPVRFDMDDLRERELEYGKAGYTLQFMLN 290

Query: 285 ----LGQ-FPQQEVNNFI----------PHNYIEEAMSREAIDD---------------- 313
                 + +P +  +  +           + ++    +R                     
Sbjct: 291 PNLSDAEKYPLRLRDAIVCAVDTERAPLSYQWLPNRQNRNEELPNVGLKGDDIHSFHVCS 350

Query: 314 ----LYAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 351 SKTAEYQQKILVIDPSGRGKDETGYAV 377


>gi|330507947|ref|YP_004384375.1| phage terminase, large subunit, PBSx family [Methanosaeta concilii
           GP-6]
 gi|328928755|gb|AEB68557.1| phage terminase, large subunit, PBSx family [Methanosaeta concilii
           GP-6]
          Length = 422

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 35/267 (13%), Positives = 74/267 (27%), Gaps = 30/267 (11%)

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            + V    +     P        + R   KT      +L  I T P  +I+ + N+ T L
Sbjct: 5   ELPVGKQRDFILEEPARINLLYGSVRST-KTWSVNIKILKDILTLPTGNILFVGNTGTSL 63

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
              +   +   +                    +     ++   I  +   I       + 
Sbjct: 64  YRNVLTPIKDLVG----------------EKNFELRAGKKECEIFGRTVWIEG----ADN 103

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
             ++        +  + DE +  P+     +L   ++     +  +T N      + Y  
Sbjct: 104 TSSYKKIEGESLLRAYVDEGTTIPENFTNMLLSRLSDKGACLY--LTCNPETPRNYIYRN 161

Query: 241 FNIPLED--WKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIP 298
           +    ++   K ++        +   +   +   Y   +      ILG +   E   F  
Sbjct: 162 WIARQDELNIKVWKFTLDDNPYLPLEYKRDLEKEYPKGTVFYDRFILGNWVAAEGRVF-- 219

Query: 299 HNYIEEAMSREAIDDLYAP--LIMGCD 323
                  M  E       P  L +G D
Sbjct: 220 -GLFARGMHCEVPPATLRPKELRIGAD 245


>gi|37956745|gb|AAP34014.1| gene 19 [Enterobacteria phage T7]
          Length = 586

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 97/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAEL-----------LEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
              + +         +                   G  +            E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGPANPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLPSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NLGQYQQKILVIDPSGRGKDETGYAV 377


>gi|37956850|gb|AAP34117.1| gene 19 [Enterobacteria phage T7]
          Length = 586

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 97/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAEL-----------LEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
              + +         +                   G  +            E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGPANPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLSSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NSGQYQQKILVIDPSGRGKDETGYAV 377


>gi|9627482|ref|NP_042010.1| DNA maturation protein [Enterobacteria phage T7]
 gi|137615|sp|P03694|VDMB_BPT7 RecName: Full=DNA maturase B; AltName: Full=DNA-packaging protein
           B; AltName: Full=GP19
 gi|579206|emb|CAA24440.1| unnamed protein product [Enterobacteria phage T7]
 gi|37956692|gb|AAP33962.1| gene 19 [Enterobacteria phage T7]
 gi|265525013|gb|ACY75876.1| DNA maturation protein [Enterobacteria phage T7]
          Length = 586

 Score = 73.1 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 45/386 (11%), Positives = 97/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P+     P + Q++  + +    +           
Sbjct: 10  LVVAQLKGDFVAFL--FVLWKALNLPV-----PTKCQIDMAKVLANGDNK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W +   P + I+ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAEL-----------LEQSMGIDSKHYTITCRTYSEERPDTFVGP 187
              + +         +                   G  +            E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGPANPDHSPSVKSVGITGQLTGSRADIIIADDVEIPSNSATM 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W       R
Sbjct: 172 GAREKLWTLVQEFAALLKPLPSSRVIYLGTPQTEMTLYKELEDNRGYTTIIWPALYPRTR 231

Query: 233 LNGWFYDIFNIP------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y     P       E+ +            D          YG      +  +  
Sbjct: 232 EENLYYSQRLAPMLRAEYDENPEALAGTPTDPVRFDRDDLRERELEYGKAGFTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFIPHNYIEEA-MSREAIDD-------------------------- 313
                + +P +  +  +    +E+A M  + + +                          
Sbjct: 292 NLSDAEKYPLRLRDAIVAALDLEKAPMHYQWLPNRQNIIEDLPNVGLKGDDLHTYHDCSN 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 NSGQYQQKILVIDPSGRGKDETGYAV 377


>gi|163850863|ref|YP_001638906.1| hypothetical protein Mext_1434 [Methylobacterium extorquens PA1]
 gi|163662468|gb|ABY29835.1| protein of unknown function DUF264 [Methylobacterium extorquens
           PA1]
          Length = 458

 Score = 72.7 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 43/290 (14%), Positives = 81/290 (27%), Gaps = 35/290 (12%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMMLWLISTR------PGMS 109
             +EA  +H   +     P  +   A+  GRG GKT   A  +  L          P   
Sbjct: 47  RLLEADWLHLARHDQLPPPGNWTTWAVIGGRGSGKTRTGAEWVRGLAHGDPVFTPEPVER 106

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I  +  +   +++ +    S  L++                 G    + + S     +  
Sbjct: 107 IALVGETFADVRDVMIEGPSGLLALPRL--------------GGAPPVWQPSRR---RVV 149

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMT 227
                       +           AV++DE +     +     I          R  +  
Sbjct: 150 FGNGAVALAFSAEEPDSLRGPQFGAVWSDEVAKWREAEATYDMIQFGLRLGTHPRGLVT- 208

Query: 228 SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
             T R       +   P              + +   F E ++ RY     + R E+ G+
Sbjct: 209 -TTPRPVPLIRRLLADPRT-VVTRSRTADNAQNLAPSFLEEVVGRYAGT-RLRRQELDGE 265

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVV 334
             +   +     + IE A   EA       + +  D    +  G D   +
Sbjct: 266 LIEDRPDALWTRDAIERARVSEAPPLQ--RIAVAIDPPASSRVGADACGI 313


>gi|187476925|ref|YP_784949.1| phage terminase large subunit [Bordetella avium 197N]
 gi|115421511|emb|CAJ48020.1| Putative phage terminase large subunit [Bordetella avium 197N]
          Length = 512

 Score = 72.7 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 58/222 (26%), Gaps = 47/222 (21%)

Query: 179 ERPDTFVGPHNTHGMAVFNDEASGTPDII--NKSILGFFTELNPNRFWIMTSNTRRLN-- 234
           + P             +  DEA+   +            T+       +MT N       
Sbjct: 129 DNPGDENRWRGRPHDLIVLDEATELREHQARFVLGWNRTTKAGQRCRVLMTFNPPTTVEG 188

Query: 235 --------GWFYDIFNIPLEDWKRYQIDTRTVEGIDSG------------------FHEG 268
                    W       P +  +         + ++                    F   
Sbjct: 189 RWVVEYFAPWLDPKHPHPAKPGELRWFAVIDGKEVEVEGGAPFAHNGETIVPRSRTFIPS 248

Query: 269 IISR-------------YGLDSDVARIEILGQFPQQEVN---NFIPHNYIEEAMSREAID 312
            I+                L   +    + G F     +     IP  ++E A +R    
Sbjct: 249 RIADNPFLMGTGYESVLQSLPEPLRSQMLYGDFNAGIEDDPWQVIPTAWVEAAQARWKRP 308

Query: 313 DLYAPLI-MGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLI 353
           D  AP+  +G D+A  G DKT++  R G   +    +  K  
Sbjct: 309 DRLAPMDSLGLDVARGGRDKTILARRHGWWFDEPLVYPGKDT 350


>gi|326536146|ref|YP_004300581.1| gp19 [Enterobacteria phage 285P]
 gi|256861535|gb|ACV32491.1| gp19 [Enterobacteria phage 285P]
          Length = 585

 Score = 72.7 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 45/387 (11%), Positives = 98/387 (25%), Gaps = 88/387 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P     +P + Q++    +    H           
Sbjct: 10  LIVAQLKGDFVAFL--FVLWKALNLP-----KPTKCQIDMARTLANGDHK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W++   P + ++ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +   L +       K   IT +              E P      
Sbjct: 112 SELKPRPGQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADIIIADDVEVPGNSSTS 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W      R 
Sbjct: 172 SAREKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKGYSTVIWPAQY-PRN 230

Query: 233 LNGWFYDIFNIP-------LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI- 284
                Y    +         E ++  +         D          YG      +  + 
Sbjct: 231 DAEALYYGDRLAPMLKTEYDEGFELLRGQPTDPVRFDMDDLRERELEYGKAGYTLQFMLN 290

Query: 285 ----LGQ-FPQQEVNNFI----------PHNYIEEAMSREAIDD---------------- 313
                 + +P +  +  +           + ++    +R                     
Sbjct: 291 PNLSDAEKYPLRLRDAIVCAVDPERAPLSYQWLPNRQNRNEELPNVGLKGDDIHAFHTCS 350

Query: 314 ----LYAPLIMGCDIAGEGGDKTVVVF 336
                Y   I+  D +G G D+T    
Sbjct: 351 SRTAEYQSKILVIDPSGRGKDETGYAV 377


>gi|99080642|ref|YP_612796.1| hypothetical protein TM1040_0801 [Ruegeria sp. TM1040]
 gi|99036922|gb|ABF63534.1| hypothetical protein TM1040_0801 [Ruegeria sp. TM1040]
          Length = 416

 Score = 72.7 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 79/283 (27%), Gaps = 29/283 (10%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
           A   G G GKT +    +       P       A +   +++T W  V +    L     
Sbjct: 24  AYVGGFGSGKTYVGCLDLGLFAGQHPKTVQGYFAPTYRDIRDTFWPTVDEAAHSLGF--- 80

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
               +  +  +    E          + Y  T    S + P                DE 
Sbjct: 81  ----TTKVKSADKEVE------FYRGRSYYGTTICRSMDDPGG---IVGFKIARALVDEI 127

Query: 201 SGTPDIINKSILGFFTELNPNRF-----WIMTSNTRRLNGWFYDIF-NIPLEDWKRYQID 254
                   ++                   I  + T     + YD F   P  ++   Q  
Sbjct: 128 DILSKDKAQAAWRKIIARMRLVLPGVVNGIGVTTTPEGFRFVYDSFKREPKSNYSMVQAS 187

Query: 255 TRTVE-GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDD 313
           T   E  +   +   ++  Y  +  + +  ++G+F           +Y            
Sbjct: 188 TYENEAFLPPDYISTLLEDYPEE--LIKAYLMGEFVNLTSGTVY-RSYDRLRHRSTQSIQ 244

Query: 314 LYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQET 356
              PL +G D    G   +VV  +RG     + +     +Q+T
Sbjct: 245 PREPLHIGQDF-NVGNMASVVFVQRGEDWHAVDELQG--LQDT 284


>gi|310286612|ref|YP_003937870.1| phage terminase [Bifidobacterium bifidum S17]
 gi|309250548|gb|ADO52296.1| phage terminase [Bifidobacterium bifidum S17]
          Length = 483

 Score = 72.7 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/295 (11%), Positives = 74/295 (25%), Gaps = 46/295 (15%)

Query: 52  HRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSII 111
            RWQ +    +             +    A+S  R +GKT         +   +P  +++
Sbjct: 45  DRWQDDLCRLMLA--KRADGEYAASAGGVAMSLCRQVGKTFTVGTNAAIMCLLQPDFTVL 102

Query: 112 CIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTI 171
             A+     +    AE  K +  +  +        ++  +       ++S+   +    +
Sbjct: 103 WTAH-----RTRTSAETFKSMQAIVRQPGLTRHVKAIRRANG-----QESIEFANGSRIL 152

Query: 172 TCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTR 231
                                     DEA    +     ++   T    N   +      
Sbjct: 153 FGAREQGFGRG------FAGIDMEIFDEAQILTEKALDDMVPA-TNAAKNPLIVFMGTPP 205

Query: 232 RLNGWFY-----------------------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEG 268
           R N                           D    P +  +  + +              
Sbjct: 206 RPNDPGDVFKLKRSQGLANEDGMTYVEFSADRDADPHDRNQWAKANPSYPTRTKPAAMLR 265

Query: 269 IISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCD 323
           ++   G DS   R E LG + +      I  +  ++A            +  G D
Sbjct: 266 MLKNLGEDS--FRREALGIWDETTDRRAIDPDQWQQA--ETGERRPGGWVAFGVD 316


>gi|21241826|ref|NP_641408.1| phage-related DNA maturase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21107205|gb|AAM35944.1| phage-related DNA maturase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 526

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 44/373 (11%), Positives = 78/373 (20%), Gaps = 81/373 (21%)

Query: 27  SFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGR 86
            F+NF      W     P      P   Q +    +       +           + A R
Sbjct: 17  DFRNFAFDL--WTHLALP-----SPTPVQYDICSYLQHGPRRRM-----------VQAFR 58

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G+GK+ L A  + WL+   P   I+ ++ S+ +             +  P  H       
Sbjct: 59  GVGKSFLTAGYVCWLLWKDPQHKIMVVSASKERADAFSVFVKQIIETFEPLSHLRPRSDQ 118

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTY----------SEERPDTFVGPHNTHGMAVF 196
                 +             K   IT +              E             +A  
Sbjct: 119 RNSNLAFDVGPALPDQSPSVKSVGITGQLTGSRANTIIPDDIEVVKNSQTIVQREKLAEL 178

Query: 197 NDEASGT------------PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIF--- 241
             E                P                 R W             Y      
Sbjct: 179 IKEFDAVLKPGGQVIYLGTPQTEESLYNKLPERGYDIRIWPARFPKNMKQRVAYGAMLAP 238

Query: 242 --NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG------QFPQQEV 293
                 +D +            D        + YG      +  +        ++P +  
Sbjct: 239 VIAAAFDDNQALAWTPTDSRRFDEKDLMEREASYGRAGFALQFMLDTTLSDAEKYPLKLS 298

Query: 294 NNF------------------------------IPHNYIEEAMSREAIDDLYAPLIMGCD 323
           +                                   +   + M      + +   +M  D
Sbjct: 299 DFIVMDVDREVAPIRVVWSSGKQHVVEELPSVGFSGDRWHQPMYVAPEMEEFTGSLMTVD 358

Query: 324 IAGEGGDKTVVVF 336
            +G GGD+T    
Sbjct: 359 PSGRGGDETGFCV 371


>gi|146310462|ref|YP_001175536.1| hypothetical protein Ent638_0800 [Enterobacter sp. 638]
 gi|145317338|gb|ABP59485.1| conserved hypothetical protein [Enterobacter sp. 638]
          Length = 445

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 45/366 (12%), Positives = 100/366 (27%), Gaps = 44/366 (12%)

Query: 2   PRLISTDQKLEQELHEMLMHAECVLSFKNFVM-----RFFPWGIKGKP--LEHFSQ---- 50
           P      +   + L  +  ++E + + K F           WG+   P  L++       
Sbjct: 12  PDYQLVFEWRMERLQRIRQNSEMLPALKQFYRTNPAQFIIDWGMTTDPRNLDYGLPATIP 71

Query: 51  ----PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP 106
               P   Q E++  +     S  +              R +G +  +  +   L     
Sbjct: 72  FLLFPR--QEEWINWIMDRRSSLEHGLTEKS--------REMGLSWTSIGLACSLCLFNK 121

Query: 107 GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDS 166
            M I   +  E  + ++     + +           ++         +A  +        
Sbjct: 122 EMVIGFGSRKEEYV-DSTGDPKALFWKARKFVETLPVEFRGSWDEKKHAPYMRVEFPD-- 178

Query: 167 KHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIM 226
                       +                F DEA+     +        T        I 
Sbjct: 179 -------TGAVIKGEAGDNIGRGDRTTLYFVDEAAFLQRPLLIDAALSQTTRCR----ID 227

Query: 227 TSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
            S+   ++  F    +        +    R+    D+ ++     +   +  +   E+  
Sbjct: 228 LSSVNGMSNPFAQKRH--SGKIPVFTFHWRSDPRKDNEWYRKECEKI-DNPVIVAQELDL 284

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAI--DDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEH 344
            +        IP  +++ A+              +   DIA EG DK     R G +++ 
Sbjct: 285 NYQASAEGILIPSEWVQAAVDAHIKLGIQPSGQRLGSMDIADEGKDKNGFSSRYGFLLQS 344

Query: 345 IFDWSA 350
           + +WS 
Sbjct: 345 VHEWSG 350


>gi|283780022|ref|YP_003370777.1| hypothetical protein Psta_2246 [Pirellula staleyi DSM 6068]
 gi|283438475|gb|ADB16917.1| conserved hypothetical protein [Pirellula staleyi DSM 6068]
          Length = 465

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/297 (13%), Positives = 86/297 (28%), Gaps = 51/297 (17%)

Query: 68  SNVNNSNPTIFKCAI-SAGRGIGKTTLNAWMMLW---------LISTRPGMSIICIANSE 117
            N +      F  A+   GR  GK+ + A +  +          +ST     +   A ++
Sbjct: 53  RNPHKLPDDGFNTALFLTGRRSGKSRIAAVIASYEAALAGRESRLSTGERGVVAVCAPTK 112

Query: 118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
            Q +      V  ++                    + + +L   +  +++          
Sbjct: 113 YQAR-----VVKDYIRGC-----------------FTSPMLSGEVTQETQEGFTLANGVR 150

Query: 178 EER-PDTFVGPHNTHGMAVFNDEASGT----------PDIINKSILGFFTELNPNRFWIM 226
                  +        +A   DEA+               + ++I      +      I 
Sbjct: 151 IAVLAGDWRTIRGYTLLAAIVDEAAFFGYDAESKVKSDTELIRAIKPGLATVGGKL--IA 208

Query: 227 TSNTRRLNGWFYDIF--NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI 284
            S+     GW +  +  N    + K    +  +           I      D   A+ E 
Sbjct: 209 ISSPYARKGWCFKTYQRNFGNNEGKTLVWNCPSKTMNPKLPQSVIDEALAEDLASAKAEY 268

Query: 285 LGQFPQQEVNNFIPHNYIEEAM---SREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           LG+F + +V+ F+P   + + +     E + +         D++G   D   +    
Sbjct: 269 LGEF-RDDVSLFLPREVVAKLVVPGRYELLPNQKHRYFGFADLSGGRSDDAALAIAH 324


>gi|152969966|ref|YP_001335075.1| hypothetical protein KPN_01413 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150954815|gb|ABR76845.1| hypothetical protein KPN_01413 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 434

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 46/301 (15%), Positives = 87/301 (28%), Gaps = 34/301 (11%)

Query: 61  AVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
           A+    +          +K  A  AG G GKT +    +   +   P ++    A +  Q
Sbjct: 2   AIAPTLNIPQAKFLAMQYKFKAYVAGFGSGKTWVGCGGICKGMWEHPKINQGYFAPTYPQ 61

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
           +++  +  V +                    +    E  ++      + Y  T    S E
Sbjct: 62  IRDIFYPTVEEVAHDWG-------------LNVKINEGNKEVHFYAGRQYRGTTICRSME 108

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFT-ELNPNRFWIMTSNTRRLN 234
           +P                DE    P     +  + I+      +   R  I  + T    
Sbjct: 109 KP---QTIVGFKIGNALIDELDVMPAKKAQLAWRKIIARMRYNVAGLRNGIDVTTTPEGF 165

Query: 235 GWFYDIFNIPLED-------WKRYQIDTRTVE-GIDSGFHEGIISRYGLDSDVARIEILG 286
            + Y  F   + D       +   Q  T   E  +   +   ++  Y    ++ +  + G
Sbjct: 166 KFVYQQFAKAVRDKPSLSTLYGLVQASTFDNEKNLPPDYIPSLMESY--PPELIKAYLRG 223

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
           QF              +    RE  +    PL +G D    G    VV   R  +   + 
Sbjct: 224 QFTNLTSGTIYHQFDRKLNNCRE-EEQPGEPLYIGMDF-NVGKMAGVVHVLRLGLPFAVT 281

Query: 347 D 347
           +
Sbjct: 282 E 282


>gi|170748408|ref|YP_001754668.1| hypothetical protein Mrad2831_1990 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654930|gb|ACB23985.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 478

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/304 (13%), Positives = 74/304 (24%), Gaps = 45/304 (14%)

Query: 60  EAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLN-------AWMMLWLISTRPGMSI-- 110
            A+              + +     GR  GK+          A ++ +     PG  I  
Sbjct: 50  RAIFTALTGREREPERPVDELWGIVGRRGGKSRAFSVLGAYLAGLVDYSAVQAPGERIKL 109

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
             +A++  Q        +  +      R   +    S          +E           
Sbjct: 110 PIMASTTVQAAKIFSYMLGVFEHSAELRDMVDGDPTSETIRLLSGVDIEV---------- 159

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT-------PDI-INKSILGFFTELNPNR 222
                    RP  +             DE +         PD  I  ++           
Sbjct: 160 ---------RPANYKTIRGETLAGCLADEVAFWHLENSANPDTLILDAVRPGLATTGGPL 210

Query: 223 FWIMTSNTRRLNGWFYDIFNI---PLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDV 279
              + S+     G  Y        P  D     +   +     S     +   Y  D   
Sbjct: 211 --CVLSSPYARKGELYRTHQRDFGPSGDPAVLVLRAPSQTMNPSLDPAVVKRAYTRDPAA 268

Query: 280 ARIEILGQFPQQEVNNFIPHNYIEEAMSREAI---DDLYAPLIMGCDIAGEGGDKTVVVF 336
           A  E   +F + +V  FI    ++  M+ + +             CD +G G D   +  
Sbjct: 269 ASAEYGAEF-RADVEAFISLEAVQACMAGDLLERAPAPGLTYQAFCDPSGGGADSMTLAI 327

Query: 337 RRGN 340
               
Sbjct: 328 GHAE 331


>gi|160899533|ref|YP_001565115.1| PBSX family phage terminase large subunit [Delftia acidovorans
           SPH-1]
 gi|160365117|gb|ABX36730.1| phage terminase, large subunit, PBSX family [Delftia acidovorans
           SPH-1]
          Length = 414

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/268 (13%), Positives = 64/268 (23%), Gaps = 31/268 (11%)

Query: 73  SNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGM----SIICIANSETQLKNTLWAEV 128
           S    ++CA   GRG  KT   A M                I+        L  +   E+
Sbjct: 17  SGEARYRCA-HGGRGSAKTRSFAMMTAVRAYMFAEAGVSGVILGAREYMNSLSESSMEEI 75

Query: 129 SKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPH 188
            + +  +P                W     E                ++  R +      
Sbjct: 76  KQAIRSVP----------------WLDAYFEIGEQYIRTKNRRVSYVFAGLRHNLDSIKS 119

Query: 189 NTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLED 247
               +  + DEA    ++  + +     E      W+   N  +        F   P  +
Sbjct: 120 KARILIAWVDEAESVSEVAWQKLAPTVREQGSE-IWVTW-NPEKDGSPTDKRFRKEPPPN 177

Query: 248 WKRYQIDTRTVEGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAM 306
            K  +++            +   +     D         G + +      +   Y     
Sbjct: 178 SKVVELNYSDNPWFPEVLDQERQADRDRLDDQTYAWVWDGAYRENSDAQILSGKYRVAEF 237

Query: 307 SREAIDD-LYAPLIMGCDIAGEGGDKTV 333
             +   D  Y  L  G        D T 
Sbjct: 238 EPQPGWDGPYFGLDWG-----FSQDPTA 260


>gi|126443353|ref|YP_001063348.1| hypothetical protein BURPS668_A2354 [Burkholderia pseudomallei 668]
 gi|126222844|gb|ABN86349.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 490

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/322 (11%), Positives = 77/322 (23%), Gaps = 46/322 (14%)

Query: 43  KPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLI 102
             L H   P R+Q      +       ++            A R  GK  +   M+ W  
Sbjct: 8   IELPHNWTPRRYQGRLWNYLIGGGKRAIDI-----------AHRRWGKDEV---MLHWTA 53

Query: 103 STRPGM--SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQ 160
                   +   +    TQ +  +W  V+                       +   + ++
Sbjct: 54  VAAHDRVANYWHMLPKATQARKAIWTAVN------------PHTGKRRIDEAFPEAIRKR 101

Query: 161 SMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNP 220
           +   D         T+     D +     +    +   E +     +   +     E   
Sbjct: 102 TRDQDMFIEFNNGSTWQVLGSDNYDNYVGSPPAGIVLSEWALCNPAVWAYLKPILDENGG 161

Query: 221 NRFWIMTSNTRRLNGWFYDI--FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRY----- 273
              W     T R     + +    +    W     +            E   + Y     
Sbjct: 162 ---WAAFITTPRGKNHAHKMLQMALANPKWFAEVSNVLKTGRFSLAELEEQRAEYRALYG 218

Query: 274 -GLDSDVARIEILGQFPQQEVNNFIPHNYI---EEAMSREAIDDLYAPLIMGCDIAGEGG 329
                 +   E++  F    +  +          +        D   P+I   D+     
Sbjct: 219 EEQGDAMFEQELMCSFEAAILGAYYGKEMAAAERDGRIGRVPHDPNLPVITVWDLGH--S 276

Query: 330 DKTVVVFRRGNI--IEHIFDWS 349
           D T + F + +   I  I  + 
Sbjct: 277 DDTSIWFAQVHWGEIRLIDHYR 298


>gi|114707517|ref|ZP_01440413.1| Phage DNA Packaging Protein [Fulvimarina pelagi HTCC2506]
 gi|114537076|gb|EAU40204.1| Phage DNA Packaging Protein [Fulvimarina pelagi HTCC2506]
          Length = 448

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/250 (15%), Positives = 68/250 (27%), Gaps = 35/250 (14%)

Query: 84  AGRGIGKTTLNAWMMLWLIS------TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH 137
            GRG GKT   A  +  L        + P   I  +A +    +  +    S   +++ +
Sbjct: 68  GGRGSGKTRAGAEWITGLALGLSPFASLPHRRIALVAETLADAREVMIEGESGLKAIVGN 127

Query: 138 -RHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVF 196
            R  FE+    L                          T      +           A +
Sbjct: 128 ERPVFEVTRRRL--------------------VFANGATAQIFSSEDPDSIRGYQFDAAW 167

Query: 197 NDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQID 254
            DE      P+    +++         R   + + T R       +   P          
Sbjct: 168 GDELGKWVKPEESFDNLMLALRLGERPR--ALFTTTPRNVPILKRLMADPQTA-VTRMRT 224

Query: 255 TRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDL 314
              VE +  GF E +  RY       R E+ G+      +       +E +    A    
Sbjct: 225 AENVENLAPGFLEAMARRYDGT-RFGRQELDGELLDDRKDGLFERALVERSRVTNAPP-- 281

Query: 315 YAPLIMGCDI 324
              +++  D 
Sbjct: 282 LKRIVVAVDP 291


>gi|253991059|ref|YP_003042415.1| phage terminase large subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782509|emb|CAQ85673.1| similar to phage terminase large subunit [Photorhabdus asymbiotica]
          Length = 411

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/257 (13%), Positives = 64/257 (24%), Gaps = 26/257 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGM----SIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M                I+C       L+ +   EV + +  +P   
Sbjct: 29  GGRGSAKTRTFAMMSAVRAYQAAESGTSGVILCAREFMNSLEESSMEEVKQAIRSIP--- 85

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  +           +    +   R +          +  + DE
Sbjct: 86  -------------WLDDYFDIGEKYIRTKNRLVNYVFCGLRHNLDSIKSKARILLAWVDE 132

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY-QIDTRTV 258
           A    +I  K +     E      W+   N  +        F           +++    
Sbjct: 133 AESVSEIAWKKLRPTVRESGSE-IWVTW-NPEKDGSATDKRFRKKPPRSSIIVEMNYSDN 190

Query: 259 EGIDSGFHEGIISR-YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   E        L+         G + +      + + Y  E+   + +      
Sbjct: 191 PWFPDVLEEERQEDLESLEHSDYAWIWEGAYLENSEKQVLANKYKIESF-PDDLWMKADR 249

Query: 318 LIMGCDIAGEGGDKTVV 334
           L+ G D  G   D   +
Sbjct: 250 LLFGADF-GFAKDPNTL 265


>gi|194100300|ref|YP_002003498.1| gp19 [Enterobacteria phage BA14]
 gi|193201295|gb|ACF15775.1| gp19 [Enterobacteria phage BA14]
          Length = 585

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 44/386 (11%), Positives = 98/386 (25%), Gaps = 86/386 (22%)

Query: 19  LMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIF 78
           L+ A+    F  F+  F  W     P     +P + Q++    +    H           
Sbjct: 10  LIVAQLKGDFVAFL--FVLWKALNLP-----KPTKCQIDMARTLANGDHK---------- 52

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K  + A RGIGK+ +    ++W++   P + ++ ++ S+ +        +   + +LP  
Sbjct: 53  KFILQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIF-IKNIIDLLPFL 111

Query: 139 HWFEMQSLSLHPSGWYAELL-EQSMGIDSKHYTITCRTY----------SEERPDTFVGP 187
              + +         +   L +       K   IT +              E P      
Sbjct: 112 AELKPRPGQRDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADIIIADDVEVPGNSSTS 171

Query: 188 HNTHGMAVFNDEASGT-------------PDIINKSILGFFTE--LNPNRFWIMTSNTRR 232
                +     E +                     ++     +        W        
Sbjct: 172 SAREKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKGYSTVIWPAQYPRND 231

Query: 233 LNGWFY------DIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEI-- 284
               +Y       +     E ++  +         D          YG      +  +  
Sbjct: 232 AEALYYGDRLAPMLKQEYDEGYEILRGQPTDPIRFDMDDLRERELEYGKAGYTLQFMLNP 291

Query: 285 ---LGQ-FPQQEVNNFI----------PHNYIEEAMSREAIDD----------------- 313
                + +P +  +  +           + ++    +R                      
Sbjct: 292 NLSDAEKYPLRLRDAIVCAVDTERAPLSYQWLPNRQNRNEELPNVGLKGDDIHSFHVCSS 351

Query: 314 ---LYAPLIMGCDIAGEGGDKTVVVF 336
               Y   I+  D +G G D+T    
Sbjct: 352 KTAEYQQKILVIDPSGRGKDETGYAV 377


>gi|253990592|ref|YP_003041948.1| Phage terminase, large subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782042|emb|CAQ85206.1| Phage terminase, large subunit [Photorhabdus asymbiotica]
          Length = 405

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/257 (13%), Positives = 64/257 (24%), Gaps = 26/257 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGM----SIICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M                I+C       L+ +   EV + +  +P   
Sbjct: 23  GGRGSAKTRTFAMMSAVRAYQAAESGTSGVILCAREFMNSLEESSMEEVKQAIRSIP--- 79

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  +           +    +   R +          +  + DE
Sbjct: 80  -------------WLDDYFDIGEKYIRTKNRLVNYVFCGLRHNLDSIKSKARILLAWVDE 126

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY-QIDTRTV 258
           A    +I  K +     E      W+   N  +        F           +++    
Sbjct: 127 AESVSEIAWKKLRPTVRESGSE-IWVTW-NPEKDGSATDKRFRKKPPRSSIIVEMNYSDN 184

Query: 259 EGIDSGFHEGIISR-YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
                   E        L+         G + +      + + Y  E+   + +      
Sbjct: 185 PWFPDVLEEERQEDLESLEHSDYAWIWEGAYLENSEKQVLANKYKIESF-PDDLWMKADR 243

Query: 318 LIMGCDIAGEGGDKTVV 334
           L+ G D  G   D   +
Sbjct: 244 LLFGADF-GFAKDPNTL 259


>gi|85059645|ref|YP_455347.1| hypothetical protein SG1667 [Sodalis glossinidius str. 'morsitans']
 gi|84780165|dbj|BAE74942.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 413

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 74/267 (27%), Gaps = 27/267 (10%)

Query: 76  TIFKCAISAGRGIGKTTLNAWMMLWLIST----RPGMSIICIANSETQLKNTLWAEVSKW 131
             ++CA   GRG  KT + A M                I+C       L+ +   EV   
Sbjct: 21  KRYRCAY-GGRGSAKTRIFALMTAVKAYQAARNSESGVILCAREFMNSLEESSMQEVKLA 79

Query: 132 LSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTH 191
           +  +P              +  +    +    +D +   +    +S  R +         
Sbjct: 80  IQSVP------------WLAAHFDIGEKYIRTLDRRVSYV----FSGLRHNLDSIKSKAR 123

Query: 192 GMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLED-WKR 250
            +  + DEA    +I  + +     E      W+   N           F    +D    
Sbjct: 124 ILLCWVDEAETVSEIAWQKLDPTVREPGSEV-WVTW-NPETEGSATDKRFRKDSDDAIIA 181

Query: 251 YQIDTRTVEGIDSGFHE-GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSRE 309
            +++        S   +        LDS        G + +      +   Y+ E    +
Sbjct: 182 VEMNYMDNPWFHSVLEQVRQRDLRMLDSATYAWIWEGAYLENANKQVMSGKYVFETF-PD 240

Query: 310 AIDDLYAPLIMGCDIAGEGGDKTVVVF 336
            +      L  G D  G   D   ++ 
Sbjct: 241 DLWKQADRLFFGADF-GFAQDPNTLIR 266


>gi|167647445|ref|YP_001685108.1| hypothetical protein Caul_3483 [Caulobacter sp. K31]
 gi|167349875|gb|ABZ72610.1| protein of unknown function DUF264 [Caulobacter sp. K31]
          Length = 453

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/304 (12%), Positives = 80/304 (26%), Gaps = 33/304 (10%)

Query: 38  WGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNA-W 96
           W    +             + +       + +    +      A+  GRG GKT   +  
Sbjct: 28  WHSLDEETFELV------EQALSDPGFGLNPHQIMPDGEWRIWALFMGRGGGKTYAASKG 81

Query: 97  MMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAE 156
             +      PG + I +  +   +++T+    S  ++                       
Sbjct: 82  SNVLAEEVFPGGTGILVGATVKDVRDTMIEGESGIIATARPGFVPHYN------------ 129

Query: 157 LLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT-PDIINKSILGFF 215
                   D+               D             + DE      +    ++    
Sbjct: 130 ------KHDNVLIWPNGSKALIRTADNPEDIRGPTVNWAWADELVKWRSEKSWDNLNRCV 183

Query: 216 TELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGL 275
             L+ N   I+ + T +    +              +  +     +D+ + EGI      
Sbjct: 184 RNLHENGTKIIVTTTPKKAKQWIKDIESLPGTIVS-RASSLDNPHMDAAYLEGIRREAET 242

Query: 276 DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSR-----EAIDDLYAPLIMGCDIAGEGGD 330
            S  AR EI G++ +           IEE   R     E +        +  D +    D
Sbjct: 243 GSARAREEIFGEWIEG-DGELWTEKSIEEMRQRPSVSLEVMAKSMDRRYISVDPSSGKHD 301

Query: 331 KTVV 334
           +T +
Sbjct: 302 ETGI 305


>gi|332884414|gb|EGK04674.1| hypothetical protein HMPREF9456_03377 [Dysgonomonas mossii DSM
           22836]
          Length = 450

 Score = 72.3 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/263 (13%), Positives = 70/263 (26%), Gaps = 18/263 (6%)

Query: 87  GIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSL 146
           G GK+ L ++ +       P    +        LK T    + K  SM        +   
Sbjct: 29  GGGKSILESYWLTKNSLKYPDTKWLLGRAKMKTLKETTLKSLFKVFSMQG------ITPN 82

Query: 147 SLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDI 206
               +G   +    ++   +    I    +       F    +        DE S   + 
Sbjct: 83  YYKYNGANDKENPNTIQFYNGSLIILKDLFYYPSDPEFDELGSLEITGAAIDENSQITEK 142

Query: 207 INKSILGFFTELNPN----RFWIMTSNTRRL--NGWFYDIFNIP--LEDWKRYQIDTRTV 258
               ++                    N  +      FY         +D    Q      
Sbjct: 143 CWNIVMSRIRHDVAKNGLIPKMFGACNPTKNFVYNRFYKPHRDGILPDDKAFIQALVTDN 202

Query: 259 EGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPL 318
             +D  + E + +    D       + G++ + + + ++   Y +             P 
Sbjct: 203 PFVDKFYIENLKNL---DPISRARLLDGEW-EYDDDPYVLMQYEKIVDLFTNSHVSGGPR 258

Query: 319 IMGCDIAGEGGDKTVVVFRRGNI 341
            M  D+A  G D T +    G I
Sbjct: 259 YMTIDVARLGKDDTTIRIWEGLI 281


>gi|224796679|ref|YP_002641707.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
 gi|224553883|gb|ACN55283.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 85/288 (29%), Gaps = 43/288 (14%)

Query: 55  QLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRP-----GMS 109
           Q E +  ++ +             K   S G   GKT L +++++  +           +
Sbjct: 49  QKEVLFDIESN----------NYSKVIFSGGIASGKTFLASYLLVKKLIENKSFYEQDTN 98

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
              I NS   L      ++ K  S+L    + + +S          +L            
Sbjct: 99  NFIIGNSIGLLMTNTVKQIEKICSLLGI-DYEKKKSGQSFCKIAGLKLN----------- 146

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSN 229
                 Y  +  D F      +   ++ +EA+         ++    +       I  +N
Sbjct: 147 -----IYGGKNRDAFSKIRGGNSAIIYVNEATVIHRETLLEVIKRLRKG--KEIIIFDTN 199

Query: 230 TRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFP 289
                 +F   +    + +K Y   T       + F +     Y          + G++ 
Sbjct: 200 PESPAHYFKTDYIENTDVFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWI 259

Query: 290 QQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGE-GGDKTVVVF 336
             E   F      E   +++     +   IM  D A   GGD T +  
Sbjct: 260 LNESMLFN-----EMIFNQDYE---FKSPIMYIDPAFSVGGDNTAICV 299


>gi|298346517|ref|YP_003719204.1| phage terminase protein [Mobiluncus curtisii ATCC 43063]
 gi|298236578|gb|ADI67710.1| phage terminase protein [Mobiluncus curtisii ATCC 43063]
          Length = 470

 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 75/306 (24%), Gaps = 45/306 (14%)

Query: 53  RWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIIC 112
            WQ    +          +          ++  R  GKTTL   +M  +    PG  +  
Sbjct: 32  PWQKLVADVAGE--RQAEHPERARYQTVVVTVPRQSGKTTLIKALMAAVAQANPGCQVYY 89

Query: 113 IANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTIT 172
            A +        W E++K L     +                    E+ +   ++   + 
Sbjct: 90  TAQTRKDAVEK-WGELAKQLR----KDMGIAPDGKPRVKVLEGTGNERIVFRGTESMIMP 144

Query: 173 CRTYSEERPDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGF-FTELNPNRFWIMT 227
                     T  G H      V  DEA        D +  +      T  +   + I T
Sbjct: 145 FAP-------TVEGIHGKTSPLVVVDEAWAFDQARGDDLMAAFNPVGLTIPHSQVWIIST 197

Query: 228 -------------------SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEG 268
                               N       F++            + D         GF + 
Sbjct: 198 AGDTRSEWLRSLVDKGRQAINDPGTTTAFFEWSADEEMAAANLRSDEALAFHPAIGFTQE 257

Query: 269 IISRYG----LDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI 324
           +             + R   L  +P     + +     E+    E        + +G D+
Sbjct: 258 LWKIQSLAQTEPDHLYRRSYLNLWPTAAETSIVDLEAWEKLAEPEPASMPPD-VAIGFDV 316

Query: 325 --AGEG 328
             A  G
Sbjct: 317 ATARTG 322


>gi|146277344|ref|YP_001167503.1| hypothetical protein Rsph17025_1297 [Rhodobacter sphaeroides ATCC
           17025]
 gi|146278140|ref|YP_001168299.1| hypothetical protein Rsph17025_2103 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555585|gb|ABP70198.1| protein of unknown function DUF264 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556381|gb|ABP70994.1| protein of unknown function DUF264 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 476

 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/284 (11%), Positives = 71/284 (25%), Gaps = 32/284 (11%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLIS----TRPGMSIICIANSETQLKNTLWAEVS 129
           + + FK  + + R  GKT       +               + ++  E Q    +   + 
Sbjct: 23  DDSRFKIGMFS-RQTGKTFSTCGECVDDCFTAWKDDRKTRWVILSRGERQAAEAMTEVIK 81

Query: 130 -------KWLSMLPHRHWFEMQSLSLH---PSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
                  +  + L        +          G  A      +   +             
Sbjct: 82  PFTRAFYEVYNTLVKGGEPRFEEGEFRAPQEKGPDAVYKALEVAFPNGSRITA------- 134

Query: 180 RPDTFVGPHNTHGMAVFNDEASG--TPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
            P             V  DE +       I  ++    ++        + S        F
Sbjct: 135 LPANPDTARGFSAN-VILDEFAFHAKSREIWAALFPVISKGRQKLR--VISTPNGKGNKF 191

Query: 238 YDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFI 297
           Y++       W R+ +D              ++     D D    E   ++  +    ++
Sbjct: 192 YELMTAEGSVWSRHVVDIYEAVRQGLDRDVDMLRAGMADEDAWAQEYELKWLDEAS-AWL 250

Query: 298 PHNYIEEAMSR---EAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
            ++ I    S    +       P  +G DIA    D  V+    
Sbjct: 251 DYDLISSCESELAGKPEGYQGGPCFVGVDIAAR-NDLFVIWVME 293


>gi|288934973|ref|YP_003439032.1| hypothetical protein Kvar_2101 [Klebsiella variicola At-22]
 gi|288889682|gb|ADC58000.1| protein of unknown function DUF264 [Klebsiella variicola At-22]
          Length = 434

 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 46/304 (15%), Positives = 87/304 (28%), Gaps = 34/304 (11%)

Query: 61  AVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
           A+    +          +K  A  AG G GKT +    +   +   P ++    A +  Q
Sbjct: 2   AIAPTLNIPQAKFLAMQYKFKAYVAGFGSGKTWVGCGGICKGMWEHPKINQGYFAPTYPQ 61

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
           +++  +  V +                    +    E  ++      + Y  T    S E
Sbjct: 62  IRDIFYPTVEEVAHDWG-------------LNVKINEGNKEVHFYAGRQYRGTTICRSME 108

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTP----DIINKSILGFFT-ELNPNRFWIMTSNTRRLN 234
           +P                DE    P     +  + I+      +   R  I  + T    
Sbjct: 109 KP---QTIVGFKIGNALIDELDVMPAKKAQLAWRKIIARMRYNVAGLRNGIDVTTTPEGF 165

Query: 235 GWFYDIFNIPLED-------WKRYQIDTRTVE-GIDSGFHEGIISRYGLDSDVARIEILG 286
            + Y  F   + D       +   Q  T   E  +   +   ++  Y    ++ +  + G
Sbjct: 166 KFVYQQFAKAVRDKPSLSTLYGLVQASTFDNEKNLPPDYIPSLMESY--PPELIKAYLRG 223

Query: 287 QFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIF 346
           QF              +    RE  +    PL +G D    G    VV   R  +   + 
Sbjct: 224 QFTNLTSGTIYHQFDRKLNNCRE-EEQPGEPLYIGMDF-NVGKMAGVVHVLRLGLPFAVN 281

Query: 347 DWSA 350
           +   
Sbjct: 282 EIVK 285


>gi|62362215|ref|YP_224140.1| gp2 [Enterobacteria phage ES18]
 gi|58339058|gb|AAW70473.1| gp2 [Enterobacteria phage ES18]
          Length = 439

 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/259 (12%), Positives = 66/259 (25%), Gaps = 26/259 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSI----ICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M           +I    +C       L+ +   EV + +       
Sbjct: 29  GGRGSAKTRTFALMTAVKAYQAAEANISGVILCAREYMNSLEESSMEEVKQAIR------ 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  +                +   R +          +  + DE
Sbjct: 83  ----------SVAWLDDYFDIGEKYIRTKNRKVSYVFCGLRHNLDSIKSKARILVAWVDE 132

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTV 258
           A        K +     E      W+   N  +       +F   P +     +++    
Sbjct: 133 AESVSSTAWKKLRPTVREEGSE-IWVTW-NPEKDGSATDKLFRKNPPKSSMIVEMNYVDN 190

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
               +   E         D         G + +      + + Y+ ++   + +      
Sbjct: 191 PWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYVVQSFE-DNLWRKSER 249

Query: 318 LIMGCDIAGEGGDKTVVVF 336
           L+ G D  G   D + ++ 
Sbjct: 250 LLFGADF-GFAKDPSTLIR 267


>gi|251783038|ref|YP_002997341.1| terminase large subunit [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242391668|dbj|BAH82127.1| terminase large subunit [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 424

 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 78/273 (28%), Gaps = 25/273 (9%)

Query: 74  NPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLS 133
           NP I   A   GRG GK++  A  ++  +  +  ++ +CI  ++  L+ +++ ++   +S
Sbjct: 22  NPKILNIACKGGRGSGKSSNIA-FIISRLIIQYPVNAVCIRKTDNTLEQSVYEQIKWAIS 80

Query: 134 MLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGM 193
                 +F+     L             +    +   I  R          +        
Sbjct: 81  EQGLERYFKFNKSPLR------------ITYIPRGNYIVFRGAQNPERIKSLKDSRFPFA 128

Query: 194 AVFNDE-ASGTPDIINKSILGFFTEL----NPNRFWIMTSNTR-RLNGWFYDIFNIPLED 247
             + +E A    +   K+I                +  T N   R   W    +    + 
Sbjct: 129 IGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNPPKRKQSWVNKKYESQFQP 188

Query: 248 WKRY--QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEA 305
              +      +    I   F     +         R E LG+         +P + +   
Sbjct: 189 KNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGEAIGSG---VVPFDNLRFE 245

Query: 306 MSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
              + +   +  +    D  G   D    V   
Sbjct: 246 TIPDELYRSFDNIRNAVDF-GYATDPLAFVRWH 277


>gi|75675353|ref|YP_317774.1| hypothetical protein Nwi_1160 [Nitrobacter winogradskyi Nb-255]
 gi|74420223|gb|ABA04422.1| Protein of unknown function DUF264 [Nitrobacter winogradskyi
           Nb-255]
          Length = 422

 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 66/269 (24%), Gaps = 33/269 (12%)

Query: 65  HCHSNVNNSNPTIFKCAIS-AGRGIGKTTLNAWMMLWLISTRPG------MSIICIANSE 117
           H        N   +   +   GRG GKT   A  +       P         I  +  +E
Sbjct: 20  HQRPPELAPNGAPWLIWLMIGGRGAGKTRAGAEWVRAQALGLPPFAGEAVSRIALVGETE 79

Query: 118 TQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
              +  +   VS  L++                                           
Sbjct: 80  HDAREVMIEGVSGLLAVHAAHERPSWSPSRKRLE------------------WSNGAVAQ 121

Query: 178 EERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNG 235
               D             ++DE +     +     +       +  R   + + T R   
Sbjct: 122 AFSADDPESLRGPQFGCAWSDEMAKWRYAEAAFDMLQFGLRLGSQPRQ--LITTTPRPTA 179

Query: 236 WFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNN 295
               + N P                +   F +G+++RY     + R E+ G+  +   + 
Sbjct: 180 LLKRLMNDPAS-VVTRAPTQANAFNLAPTFLQGVMARYAGT-RLGRQELDGEIIEDRPDA 237

Query: 296 FIPHNYIEEAMSREAIDDLYAPLIMGCDI 324
                 +E     EA       +++  D 
Sbjct: 238 LWSRALLERCRVSEAPPLQ--RIVVAVDP 264


>gi|240137990|ref|YP_002962462.1| hypothetical protein MexAM1_META1p1321 [Methylobacterium extorquens
           AM1]
 gi|240007959|gb|ACS39185.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 421

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/290 (15%), Positives = 83/290 (28%), Gaps = 35/290 (12%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKC-AISAGRGIGKTTLNAWMMLWLISTR------PGMS 109
             +EA  +H   +     P  +   A+  GRG GKT   A  +  L          P   
Sbjct: 10  RLLEADWLHLARHDQLPPPGNWTTWAVIGGRGSGKTRTGAEWVRGLAQGDPVFTPEPVER 69

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I  +  +   +++ +    S  L++                 G    + + S     +  
Sbjct: 70  IALVGETFADVRDVMIEGPSGLLALPRL--------------GGAPPVWQPSRR---RVM 112

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGT--PDIINKSILGFFTELNPNRFWIMT 227
                       +           AV++DE +     +     I          R  +  
Sbjct: 113 FGNGAVALAFSAEEPDSLRGPQFGAVWSDEVAKWREAETTYDMIQFGLRLGTHPRGLVT- 171

Query: 228 SNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQ 287
             T R       +   P              + +   F E ++ RY     + R E+ G+
Sbjct: 172 -TTPRPVPLIQRLLADPRT-VVTRSRTADNAQNLAPSFLEEVVGRYAGT-RLGRQELDGE 228

Query: 288 FPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDI---AGEGGDKTVV 334
             +   +     + IE A   EA    +  + +  D    +G G D   +
Sbjct: 229 LIEDRPDALWTRDSIERARVFEAPPLQH--IAVAIDPPASSGVGADACGI 276


>gi|254418881|ref|ZP_05032605.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196185058|gb|EDX80034.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 356

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/258 (11%), Positives = 64/258 (24%), Gaps = 29/258 (11%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           +  GRG GKT   +  +  L      +++  +  +   ++  +    S   ++       
Sbjct: 1   MLGGRGSGKTFAGSVWIDTLARKSK-VNLALVGPALHDVREVMVEGASGIKALAEPGDRP 59

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
             ++                                    +           A + DE  
Sbjct: 60  RWEAGRRRL------------------LWKNGSAAYAFSAEDPDSLRGPQFHAAWADEFC 101

Query: 202 GT--PDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVE 259
               P+ +  ++          R     + T R       +                  +
Sbjct: 102 VWRKPEAVLSNLRFGLRLGAAPRL--AVTTTPRPIPALRRLMAEAGTR-VDRAATALNAK 158

Query: 260 GIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLI 319
            +  GF   +   YG    +A  E+ GQ  +           ++ A            +I
Sbjct: 159 NLSPGFLAHLSDVYGGT-RLAAQELEGQVVEG-EGALFGVEDLKRARGS--RPAELDRVI 214

Query: 320 MGCD-IAGEGGDKTVVVF 336
           +  D  A   GD   +V 
Sbjct: 215 VAVDPPASAHGDACGIVV 232


>gi|237745263|ref|ZP_04575744.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229432492|gb|EEO42704.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 425

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/268 (14%), Positives = 79/268 (29%), Gaps = 23/268 (8%)

Query: 79  KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHR 138
           K     GRG  K++  A M+   +   P ++I+CI      LK +++ ++   +  L   
Sbjct: 35  KIVCKGGRGSAKSSNIALMLTLDLIRNP-INIVCIRKVGETLKKSVYEQIKWAIKQLGVE 93

Query: 139 HWFEMQSLSLHPSGWYAELLEQSMGIDS----KHYTITCRTYSEERPDTFVGPHNTHGMA 194
            +FE +   L             MG+D     K    +    +E   +      N   + 
Sbjct: 94  DYFEYKLSPLEIRYTERGNKFIFMGVDDPQKSKSIVDSSFPITEYWFEELAEFKNEDEVE 153

Query: 195 VFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNI---PLEDWKRY 251
           +  D              G   +    + +   +  +  + W    +       ++   +
Sbjct: 154 MVLD----------SIYRGKLKDNLRYKGFFSYNPPKMKHNWVNKKYEYTFKEDDEIFVH 203

Query: 252 QIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311
                    I   F +   +    +    +   LG+      N  +P + +E        
Sbjct: 204 HSTYLDNPFISDDFVKRAEAVKLNNPMKYKHTYLGEPI---GNGIVPFDNLEIRTISNEE 260

Query: 312 DDLYAPLIMGCDIAGEGGDKTVVVFRRG 339
                    G D  G G D      R G
Sbjct: 261 IKGLDRFRNGVD-WGYGVDPMAF-VRWG 286


>gi|159044464|ref|YP_001533258.1| hypothetical protein Dshi_1915 [Dinoroseobacter shibae DFL 12]
 gi|157912224|gb|ABV93657.1| hypothetical protein Dshi_1915 [Dinoroseobacter shibae DFL 12]
          Length = 260

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 81/269 (30%), Gaps = 53/269 (19%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
           P  WQ+E                     + A+  GR  GKT++ A   +  +   P    
Sbjct: 31  PDPWQVEAFTTRAT--------------EVALRVGRQSGKTSVLAARAVEELHV-PESLT 75

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           +C+A +E Q K  +  E+ + L                  S       +  + I +    
Sbjct: 76  LCVAPAERQAK-IIAREIGRQLQ---------------RTSLVINRPTQTELEIANGARV 119

Query: 171 ITCRTYSEERPDTFVGPHN-THGMAVFNDEASGT-----PDIINKSILGFFTELNPNRFW 224
           I         P T            +  DE +        + +  S+L   TE       
Sbjct: 120 IA-------LPSTSDTIRGFPAVSCLIIDECAFLQGDGGGEDLISSVLPMLTEDGQ---V 169

Query: 225 IMTSNTRRLNGWFYDIF--NIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARI 282
             +S     N +F  +F    P +   R  +    +  + +   E +           R 
Sbjct: 170 FFSSTPAGKNNYFARLFLDAKPGDGIHRIVVRGTDIPRL-ADKVERMRRTLSATK--FRQ 226

Query: 283 EILGQFPQQEVNNFIPHNYIEEAMSREAI 311
           EIL +    +   +   + IE+A S+   
Sbjct: 227 EILVE-MLADGQAYFDLSIIEQATSKTEK 254


>gi|66396341|ref|YP_240671.1| ORF008 [Staphylococcus phage 88]
 gi|66396415|ref|YP_240743.1| ORF009 [Staphylococcus phage 92]
 gi|62636756|gb|AAX91867.1| ORF008 [Staphylococcus phage 88]
 gi|62636829|gb|AAX91940.1| ORF009 [Staphylococcus phage 92]
          Length = 421

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/277 (11%), Positives = 77/277 (27%), Gaps = 25/277 (9%)

Query: 70  VNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVS 129
               +  +       GRG GK++  + ++   +  R  M+ + I  ++  L  +++ ++ 
Sbjct: 20  KVTKDKEVLNVVAKGGRGSGKSSDISIIIT-QLIMRYPMNAVVIRKTDNTLATSVFEQIK 78

Query: 130 KWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHN 189
             +      H F+++   +             +    +   I  R          +    
Sbjct: 79  WAIEEQKVSHLFKVKVSPM------------EITYIPRGNRIIFRGAQNPERLKSLKDSR 126

Query: 190 THGMAVFNDE-ASGTPDIINKSILGFF----TELNPNRFWIMTSNTR-RLNGWFYDIFN- 242
                 + +E A    +    +I         +      +  + N   R   W    +  
Sbjct: 127 FPFSIAWIEELAEFKTEDEVTTITNSLLRGELDEGLFYKFFFSYNPPKRKQSWVNKKYES 186

Query: 243 -IPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNY 301
               ++   +         I   F +   S    +    R E +G+         +P N 
Sbjct: 187 SFQADNTYVHHSTYLNNPFISKQFIQEAESAKKRNEQRYRWEYMGEAIGSG---VVPFNN 243

Query: 302 IEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRR 338
           +      +   D +  +    D  G   D    V   
Sbjct: 244 LRIEEIPQRQYDTFDNIRNAVDF-GYATDPLAFVRWH 279


>gi|322617167|gb|EFY14073.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322617525|gb|EFY14424.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322624846|gb|EFY21675.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322630396|gb|EFY27166.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322634576|gb|EFY31309.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322639287|gb|EFY35979.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322641951|gb|EFY38570.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322646142|gb|EFY42657.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322651994|gb|EFY48357.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322656167|gb|EFY52464.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659319|gb|EFY55566.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322665779|gb|EFY61962.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322669983|gb|EFY66124.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322673970|gb|EFY70067.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322678727|gb|EFY74783.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322683477|gb|EFY79491.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322687552|gb|EFY83522.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323193612|gb|EFZ78817.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323198519|gb|EFZ83621.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203541|gb|EFZ88564.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323208431|gb|EFZ93370.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213567|gb|EFZ98357.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323218397|gb|EGA03107.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219724|gb|EGA04205.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224576|gb|EGA08856.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323232391|gb|EGA16494.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323235576|gb|EGA19660.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323241265|gb|EGA25301.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323245007|gb|EGA29009.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323250125|gb|EGA34019.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323253910|gb|EGA37735.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323258780|gb|EGA42436.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262838|gb|EGA46389.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264213|gb|EGA47720.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270910|gb|EGA54348.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 439

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/259 (12%), Positives = 66/259 (25%), Gaps = 26/259 (10%)

Query: 84  AGRGIGKTTLNAWMMLWLISTRPGMSI----ICIANSETQLKNTLWAEVSKWLSMLPHRH 139
            GRG  KT   A M           +I    +C       L+ +   EV + +       
Sbjct: 29  GGRGSAKTRTFALMTAVKAYQAAEANISGVILCAREYMNSLEESSMEEVKQAIR------ 82

Query: 140 WFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDE 199
                        W  +  +                +   R +          +  + DE
Sbjct: 83  ----------SVAWLDDYFDIGEKYIRTKNRKVSYVFCGLRHNLDSIKSKARILVAWVDE 132

Query: 200 ASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFN-IPLEDWKRYQIDTRTV 258
           A        K +     E      W+   N  +       +F   P +     +++    
Sbjct: 133 AESVSSTAWKKLRPTVREEGSE-IWVTW-NPEKDGSATDKLFRKNPPKSSIIVEMNYVDN 190

Query: 259 EGIDSGFHEGIISRYGL-DSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAP 317
               +   E         D         G + +      + + YI ++   + +      
Sbjct: 191 PWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYIVQSFE-DNLWRKSER 249

Query: 318 LIMGCDIAGEGGDKTVVVF 336
           L+ G D  G   D + ++ 
Sbjct: 250 LLFGADF-GFAKDPSTLIR 267


>gi|238912006|ref|ZP_04655843.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica su