RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] (367 letters) >gnl|CDD|146059 pfam03237, Terminase_6, Terminase-like family. This family represents a group of terminase proteins. Length = 380 Score = 42.0 bits (99), Expect = 2e-04 Identities = 44/267 (16%), Positives = 80/267 (29%), Gaps = 36/267 (13%) Query: 82 ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPH-RHW 140 I R GKT A L + I ++ S+ Q + + + L Sbjct: 2 ILGSRQSGKTFAFAREALRHALGNGPKNQIILSASKAQARLEFKKGIIEIAGDLLEITFE 61 Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200 + + + P+G ++ E T G ++ DEA Sbjct: 62 EKNGNPIILPNGAKL------------YF------LGLESETTAQGYRGASIAGIYFDEA 103 Query: 201 SGTP-DIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVE 259 + P ++ + R + W YD + L+D + VE Sbjct: 104 TWLPKFQESELVRRLRATKGKWRKTFFS-TPPSPGHWVYDFWTGWLDDKGKRTFIPADVE 162 Query: 260 G-------IDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAID 312 + + E + + Y D + AR ++G++ + F E + Sbjct: 163 VTIEDARALGPEYKEELRALYS-DEEFAR-LLMGEWVDTSGSIF---KRFELERCDVDEE 217 Query: 313 DLYA--PLIMGCDIA-GEGGDKTVVVF 336 +I G D A GGD +V Sbjct: 218 RPPEHREVIGGVDPAASRGGDYAALVV 244 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 27.9 bits (62), Expect = 4.7 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 79 KCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113 K AI+ G+GKTT+ A + +L G ++ I Sbjct: 1 KIAITGKGGVGKTTIAALLARYL--AEKGKPVLAI 33 >gnl|CDD|145816 pfam02863, Arg_repressor_C, Arginine repressor, C-terminal domain. Length = 70 Score = 27.8 bits (63), Expect = 5.1 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Query: 310 AIDDLYAPLIMGCDIAGEGGDKTV-VVFRRGNIIEHIFDW 348 ID L P I+G IA GD T+ V+ R E + + Sbjct: 31 LIDSLKLPEILGT-IA---GDDTILVICRSEEDAEELAEK 66 >gnl|CDD|31671 COG1482, ManA, Phosphomannose isomerase [Carbohydrate transport and metabolism]. Length = 312 Score = 27.5 bits (61), Expect = 6.4 Identities = 21/106 (19%), Positives = 36/106 (33%), Gaps = 18/106 (16%) Query: 99 LWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM--------QSLSL-- 148 LW + G S + + + + L A+ + L F + LS+ Sbjct: 36 LWAGAHPNGPSTVANGPGQGKSLSELIADPRELLGN-KSFDRFPLLFKILDANDPLSIQV 94 Query: 149 HPSGWYAELLEQSMGIDSKHYTITCRTY--SEERPDTFVGPHNTHG 192 HPS YAE E+ + + C Y + +P+ G Sbjct: 95 HPSDEYAEEGEEGILGKT-----ECWYYKDANHKPELIYGLTPAKS 135 >gnl|CDD|39697 KOG4497, KOG4497, KOG4497, Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]. Length = 447 Score = 27.3 bits (60), Expect = 6.5 Identities = 12/46 (26%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 116 SETQLKNTLWAEVSKWLSMLPH-RHWFEMQSLSLHPSGWYAELLEQ 160 SE L+ T+W+ ++ +LPH + ++ + HP G + +L + Sbjct: 110 SEFDLRITVWSLNTQKGYLLPHPKT--NVKGYAFHPDGQFCAILSR 153 >gnl|CDD|112181 pfam03354, Terminase_1, Phage Terminase. The majority of the members of this family are bacteriophage proteins, several of which are thought to be terminase large subunit proteins. There are also a number of bacterial proteins of unknown function. Length = 473 Score = 27.4 bits (61), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 82 ISAGRGIGKTTLNAWMMLW--LISTRPGMSIICIANSETQ 119 +S GR GK+ L A +L+ L+ + I+ A + Q Sbjct: 27 VSVGRKNGKSYLMAIRVLYELLLGGKSNQEILVAATTFKQ 66 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.440 Gapped Lambda K H 0.267 0.0795 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,817,766 Number of extensions: 260753 Number of successful extensions: 576 Number of sequences better than 10.0: 1 Number of HSP's gapped: 575 Number of HSP's successfully gapped: 13 Length of query: 367 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 272 Effective length of database: 4,210,882 Effective search space: 1145359904 Effective search space used: 1145359904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.0 bits)