RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] (367 letters) >gnl|CDD|180989 PRK07471, PRK07471, DNA polymerase III subunit delta'; Validated. Length = 365 Score = 28.8 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 82 ISAGRGIGKTTLNAWMML-WLISTRPGMS 109 I +GIGK TL A+ M +L++T P Sbjct: 46 IGGPQGIGKATL-AYRMARFLLATPPPGG 73 >gnl|CDD|130381 TIGR01314, gntK_FGGY, gluconate kinase, FGGY type. Gluconate is derived from glucose in two steps. This model describes one form of gluconate kinase, belonging to the FGGY family of carbohydrate kinases. Gluconate kinase phosphoryates gluconate for entry into the Entner-Douderoff pathway. Length = 505 Score = 28.7 bits (64), Expect = 2.5 Identities = 18/73 (24%), Positives = 28/73 (38%), Gaps = 14/73 (19%) Query: 237 FYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNF 296 F +F Y+ID T G+ + + LD D +E+ G Q + Sbjct: 160 FQRLFG-------TYKIDYSTASAT------GMFNLFELDWDKEALELTGIKESQ-LPKL 205 Query: 297 IPHNYIEEAMSRE 309 +P IEE + E Sbjct: 206 VPTTEIEENLPHE 218 >gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family. This family of ATPases demonstrates extensive homology with ATP synthase F1, beta subunit. It is a mixture of members with two different protein functions. The first group is exemplified by Salmonella typhimurium FliI protein. It is needed for flagellar assembly, its ATPase activity is required for flagellation, and it may be involved in a specialized protein export pathway that proceeds without signal peptide cleavage. The second group of proteins function in the export of virulence proteins; exemplified by Yersinia sp. YscN protein an ATPase involved in the type III secretory pathway for the antihost Yops proteins. Length = 440 Score = 28.1 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Query: 268 GIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAI 311 G+I+R ++DV I ++G+ +EV FI H+ EE + R + Sbjct: 181 GMIARNT-EADVNVIALIGE-RGREVREFIEHDLGEEGLKRSVV 222 >gnl|CDD|150543 pfam09883, DUF2110, Uncharacterized protein conserved in archaea (DUF2110). This domain, found in various hypothetical archaeal proteins, has no known function. Length = 226 Score = 27.7 bits (62), Expect = 4.3 Identities = 12/42 (28%), Positives = 16/42 (38%) Query: 245 LEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286 L +W R D V ++R G D+ IE LG Sbjct: 153 LYEWTRGPTDRLNVNSATRSEVRAALNRAGHGRDIVTIERLG 194 >gnl|CDD|182491 PRK10481, PRK10481, hypothetical protein; Provisional. Length = 224 Score = 27.6 bits (62), Expect = 4.7 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 20/66 (30%) Query: 280 ARIEIL--GQFPQQEV----NNFIPHNYIEEA-----MSREAIDDLYAPLIMGCDIAGEG 328 A + IL GQ P+ +V ++ + I A +SRE I YAP E Sbjct: 3 ASLAILTIGQSPRSDVLPLLTEYLDEDEITHAGLLDGLSREEIMAAYAP---------EA 53 Query: 329 GDKTVV 334 G+ +V Sbjct: 54 GEDVLV 59 >gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed. Length = 1176 Score = 27.6 bits (62), Expect = 4.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 81 AISAGRGIGKTTLNAWMMLWL 101 AI A G+GKTT M L+L Sbjct: 99 AIIAPTGVGKTTFGLVMSLYL 119 >gnl|CDD|162365 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model. Length = 586 Score = 27.4 bits (61), Expect = 6.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 80 CAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIA 114 I+ G G GKTT A ++L L+ P + IA Sbjct: 163 SLITGGPGTGKTTTVARLLLALVKQSPKQGKLRIA 197 >gnl|CDD|184912 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional. Length = 620 Score = 26.8 bits (60), Expect = 7.8 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Query: 115 NSETQLKNT----LWAEVSKWLSMLP 136 SE QLKN+ LW EV+ L +LP Sbjct: 337 GSEYQLKNSTQPRLWLEVT-LLGLLP 361 >gnl|CDD|131121 TIGR02066, dsrB, sulfite reductase, dissimilatory-type beta subunit. This model describes the beta subunit of sulfite reductase. Length = 341 Score = 27.1 bits (60), Expect = 8.4 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 322 CDIAGEGGDKTVVVFRRGNIIEHIFDWSAK---LIQETNQEGCPVG 364 CDIA + D + R N +E + +K LI E + G PVG Sbjct: 50 CDIADKYSDGYLRWTIRNN-VEFLVSDESKIQPLIDELEEVGFPVG 94 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.440 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,191,727 Number of extensions: 396726 Number of successful extensions: 710 Number of sequences better than 10.0: 1 Number of HSP's gapped: 710 Number of HSP's successfully gapped: 14 Length of query: 367 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 272 Effective length of database: 3,941,713 Effective search space: 1072145936 Effective search space used: 1072145936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.3 bits)