RPSBLAST alignment of GI: 254781187 and protein with PDBid: 3cpe

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Length = 592
 Score = 44.0 bits (103), Expect = 5e-05
 Identities = 22/170 (12%), Positives = 51/170 (30%), Gaps = 19/170 (11%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
            +  R +GKTT+ A  +   +      ++  +A+  +     L     +           
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD----RTKQA--IELLP 236

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
           +     +      +  L+    I                PD   G        ++ ++ +
Sbjct: 237 DFLQPGIVEWNKGSIELDNGSSIG----------AYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY 251
             P+  +  +       +  R  I+ + T      FYDI+   +E    +
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGF 333