RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781187|ref|YP_003065600.1| putative phage terminase,
large subunit [Candidatus Liberibacter asiaticus str. psy62]
         (367 letters)



>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative
           initiation, ATP-binding, DNA- binding, hydrolase,
           nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB:
           3ezk_A*
          Length = 592

 Score = 44.0 bits (103), Expect = 5e-05
 Identities = 22/170 (12%), Positives = 51/170 (30%), Gaps = 19/170 (11%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
            +  R +GKTT+ A  +   +      ++  +A+  +     L     +           
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD----RTKQA--IELLP 236

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
           +     +      +  L+    I                PD   G        ++ ++ +
Sbjct: 237 DFLQPGIVEWNKGSIELDNGSSIG----------AYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY 251
             P+  +  +       +  R  I+ + T      FYDI+   +E    +
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGF 333


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 43.0 bits (101), Expect = 1e-04
 Identities = 57/342 (16%), Positives = 98/342 (28%), Gaps = 154/342 (45%)

Query: 98  MLWL--ISTRPG----------MSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEM-- 143
           + WL   S  P             +I +     QL     A            H+  +  
Sbjct: 216 LEWLENPSNTPDKDYLLSIPISCPLIGV----IQL-----A------------HY--VVT 252

Query: 144 -QSLSLHPSGWYAELLEQ-------SMGI---------DS-KHYT------------ITC 173
            + L   P     EL          S G+         DS + +             I  
Sbjct: 253 AKLLGFTP----GELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGV 308

Query: 174 RTYSEERPDTFVGPHNTHGMAVFNDEASGTP-----DIINKSILGFFTELN---P--NRF 223
           R Y E  P+T + P      ++ N+E   +P     ++  + +  +  + N   P   + 
Sbjct: 309 RCY-EAYPNTSLPPSILED-SLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQV 366

Query: 224 WIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIE 283
            I   N  +         N+              V G          S YGL+  + + +
Sbjct: 367 EISLVNGAK---------NL-------------VVSGP-------PQSLYGLNLTLRKAK 397

Query: 284 I---LGQ----FPQQE---VNNFIP-----HN-YIEEAMSREAI-DDLYAPLIMGCDIAG 326
               L Q    F +++    N F+P     H+  +  A   + I  DL        +++ 
Sbjct: 398 APSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPA--SDLINKDLVKN-----NVSF 450

Query: 327 EGGDKTVVVFR-------R---GNIIEHIF--------DWSA 350
              D  + V+        R   G+I E I          W  
Sbjct: 451 NAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWET 492



 Score = 29.5 bits (66), Expect = 1.2
 Identities = 39/172 (22%), Positives = 66/172 (38%), Gaps = 52/172 (30%)

Query: 104  TRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAEL--LEQS 161
            T+P ++++  A  E  LK       SK   ++P    F   SL     G YA L  L   
Sbjct: 1732 TQPALTLMEKAAFE-DLK-------SK--GLIPADATFAGHSL-----GEYAALASLADV 1776

Query: 162  MGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPN 221
            M I+S    +  R  + +             +AV  DE       + +S  G    +NP 
Sbjct: 1777 MSIESLVEVVFYRGMTMQ-------------VAVPRDE-------LGRSNYGMIA-INPG 1815

Query: 222  RF----------WIMTSNTRRLNGWFYDIFNIPLEDWKRYQI--DTRTVEGI 261
            R           +++    +R  GW  +I N  +E+ ++Y    D R ++ +
Sbjct: 1816 RVAASFSQEALQYVVERVGKR-TGWLVEIVNYNVEN-QQYVAAGDLRALDTV 1865


>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB,
           transcription factor, DNA-binding, DNA-directed RNA
           polymerase; 4.30A {Saccharomyces cerevisiae}
          Length = 197

 Score = 30.7 bits (69), Expect = 0.52
 Identities = 14/66 (21%), Positives = 22/66 (33%), Gaps = 23/66 (34%)

Query: 306 MSREAID--------DLYAPLIMGCDIAGEGGDKTVVVFRRGNII---------EHIFD- 347
           M+RE+ID        +L   L   C        K V  F  G+++         + + D 
Sbjct: 2   MTRESIDKRAGRRGPNLNIVLT--CPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDT 59

Query: 348 ---WSA 350
              W  
Sbjct: 60  RSEWRT 65


>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur
           protein, non-mevalonate pathway, terpene biosynt
           isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}
          Length = 366

 Score = 30.0 bits (67), Expect = 0.97
 Identities = 18/85 (21%), Positives = 29/85 (34%), Gaps = 20/85 (23%)

Query: 296 FIPHNYIEEAMS-REAIDDLYAPL---IMGC-----------DIAGEGGDKTVVVFRRGN 340
            I  +  +     +E +  +  PL   +MGC           DI    G     +F+ G 
Sbjct: 279 RIEVDLPKVVKEVQEKLSGVKTPLKVAVMGCVVNAIGEAREADIGLACGRGFAWLFKHGK 338

Query: 341 II-----EHIFDWSAKLIQETNQEG 360
            I       + D   K IQ   ++G
Sbjct: 339 PIKKVDESEMVDELLKEIQNMEKDG 363


>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic
           region; yeast protein, ATP binding protein; 2.25A
           {Saccharomyces cerevisiae} SCOP: c.37.1.6
          Length = 290

 Score = 29.3 bits (65), Expect = 1.2
 Identities = 10/54 (18%), Positives = 17/54 (31%)

Query: 60  EAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICI 113
           E +D +        N        S  +G GK+  +  +   L+    G   I  
Sbjct: 14  EFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGY 67


>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center
           for structural genomics of infectious diseases, CSGI;
           1.80A {Vibrio cholerae}
          Length = 441

 Score = 29.2 bits (65), Expect = 1.5
 Identities = 16/156 (10%), Positives = 39/156 (25%)

Query: 51  PHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSI 110
                L  ++   + CH     +    F  A      +  +     + +  +    G+ +
Sbjct: 208 RLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLGV 267

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYT 170
           +       Q      A + +          FE        +G     +E     + K++ 
Sbjct: 268 VYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHKNFA 327

Query: 171 ITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDI 206
           I     ++                      + T D+
Sbjct: 328 IIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDL 363


>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural
           genomics/proteomics initiative, RSGI, protein binding;
           NMR {Homo sapiens} SCOP: b.34.9.3
          Length = 127

 Score = 28.4 bits (63), Expect = 2.7
 Identities = 7/45 (15%), Positives = 10/45 (22%)

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGW 153
               I +    +   L            +  W       L P GW
Sbjct: 27  FQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGW 71


>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl
           lysine, chromatin regulator, developmental protein,
           metal-binding; HET: MLY; 2.00A {Drosophila melanogaster}
           PDB: 2r57_A* 2r5a_A* 2r5m_A*
          Length = 265

 Score = 28.0 bits (62), Expect = 3.3
 Identities = 9/45 (20%), Positives = 17/45 (37%), Gaps = 2/45 (4%)

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGW 153
            +IC A  +    + +      W       +W   +S  + P+GW
Sbjct: 159 QLICCATVDAIKDDQIHVTFDGWRG--AFDYWCNYRSRDIFPAGW 201


>1zx5_A Mannosephosphate isomerase, putative; structural genomics, PSI,
           protein structure initiative, midwest center for
           structural genomics, MCSG; HET: LFR; 2.30A
           {Archaeoglobus fulgidus} SCOP: b.82.1.3
          Length = 300

 Score = 28.1 bits (62), Expect = 3.4
 Identities = 14/144 (9%), Positives = 31/144 (21%), Gaps = 20/144 (13%)

Query: 99  LWLISTRP-GMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF---------EMQSLSL 148
            W  S      S + +   +  +         + L     +                  +
Sbjct: 39  SWEFSAHTSRPSTVLVKGQQLSMIELFSKHRDELLGRAAEKFSKFPILVRLIDAASPTQV 98

Query: 149 --HPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDI 206
             HPS   AE L +          +        +   + G      +    ++       
Sbjct: 99  HVHPSDKAAESLGE------AEGGVESAWLVFNKGKAYAGFKEDVKIEELEEKLKEEDFD 152

Query: 207 INKSILGFFTELNPNRFWIMTSNT 230
                L    E  P   +++    
Sbjct: 153 FKT--LLNTFETTPYDTFVIRPGI 174


>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin
           regulator, metal-binding, nucleus, polymorphism,
           transcription; HET: MLZ; 2.10A {Homo sapiens} PDB:
           3dbb_A* 3cey_A
          Length = 456

 Score = 27.6 bits (61), Expect = 4.3
 Identities = 11/45 (24%), Positives = 20/45 (44%), Gaps = 2/45 (4%)

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGW 153
            +IC+A  +  +   L      W S   +  W + +S  ++P GW
Sbjct: 382 RLICVATVKRVVHRLLSIHFDGWDS--EYDQWVDCESPDIYPVGW 424


>2ck3_A ATP synthase alpha chain heart isoform; ATP phosphorylase, ATP
           phosphorylase (H+ transporting), F1FO ATP synthase,
           F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A
           {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB:
           1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A*
           1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2w6j_A 2w6e_A
           2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* 1efr_A* ...
          Length = 510

 Score = 27.4 bits (61), Expect = 5.2
 Identities = 5/22 (22%), Positives = 10/22 (45%)

Query: 79  KCAISAGRGIGKTTLNAWMMLW 100
           +  I   R  GKT++    ++ 
Sbjct: 164 RELIIGDRQTGKTSIAIDTIIN 185


>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium,
           metal-binding, thiamine pyrophosphate, transferase; HET:
           T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6
           c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A*
          Length = 669

 Score = 27.2 bits (59), Expect = 5.6
 Identities = 22/195 (11%), Positives = 55/195 (28%), Gaps = 4/195 (2%)

Query: 57  EFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANS 116
           + + A       ++ +     F        GI     +    L L           I+  
Sbjct: 131 KTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLIAFYDDNGISID 190

Query: 117 ETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTY 176
                        ++ +      W  ++ +  H +      +E++  +  K   + C+T 
Sbjct: 191 GHVEGWFTDDTAMRFEAY----GWHVIRDIDGHDAASIKRAVEEARAVTDKPSLLMCKTI 246

Query: 177 SEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGW 236
                    G H++HG  + + E + T + +      F         W      +     
Sbjct: 247 IGFGSPNKAGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAGQAKESA 306

Query: 237 FYDIFNIPLEDWKRY 251
           + + F    + + + 
Sbjct: 307 WNEKFAAYAKAYPQE 321


>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for
           structural genomics, riken spring-8 center, riken
           genomic sciences center; 1.99A {Aquifex aeolicus VF5}
          Length = 420

 Score = 27.2 bits (59), Expect = 6.0
 Identities = 20/157 (12%), Positives = 50/157 (31%)

Query: 50  QPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMS 109
             +  +LE +E V +HCH      + + ++ A+     + ++       +  +    G+ 
Sbjct: 187 YEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQKGFDIKYLDIGGGLG 246

Query: 110 IICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHY 169
           I      +      L   +   L  +  +   E     +  +G     ++      SKH+
Sbjct: 247 IKYKPEDKEPAPQDLADLLKDLLENVKAKIILEPGRSIMGNAGILITQVQFLKDKGSKHF 306

Query: 170 TITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDI 206
            I     ++    +    ++        +      DI
Sbjct: 307 IIVDAGMNDLIRPSIYNAYHHIIPVETKERKKVVADI 343


>1nn5_A Similar to deoxythymidylate kinase (thymidylate kinase); P-loop,
           D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens}
           SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A*
           1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A*
           1e2f_A* 1nn3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A*
           1e9f_A*
          Length = 215

 Score = 27.1 bits (59), Expect = 6.5
 Identities = 12/97 (12%), Positives = 31/97 (31%)

Query: 81  AISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHW 140
            +      GK+T +  ++  L +      ++      T++   L + + K   +  H   
Sbjct: 13  VLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVH 72

Query: 141 FEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYS 177
               +          E L Q + +    Y  +   ++
Sbjct: 73  LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFT 109


>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia
           coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E*
           1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*
          Length = 334

 Score = 26.9 bits (58), Expect = 6.7
 Identities = 16/145 (11%), Positives = 36/145 (24%), Gaps = 1/145 (0%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
           I A  G+G   L   +  +L+  +P     C      QL           L+    ++  
Sbjct: 29  IQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTL 88

Query: 142 EM-QSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEA 200
            +     +         L  +  +      +     +     T   P       +   E 
Sbjct: 89  GVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREP 148

Query: 201 SGTPDIINKSILGFFTELNPNRFWI 225
                 +       +    P ++ +
Sbjct: 149 ERLLATLRSRCRLHYLAPPPEQYAV 173


>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller,
           transcription repressor, three malignant brain tumor
           repeats; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3
           b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 2rhi_A* 2rhx_A*
           2rjd_A 2rjc_A 2rje_A* 2rjf_A* 2pqw_A* 2rhu_A* 2rhy_A*
           2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A*
          Length = 331

 Score = 26.8 bits (59), Expect = 7.3
 Identities = 9/43 (20%), Positives = 17/43 (39%), Gaps = 2/43 (4%)

Query: 111 ICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGW 153
           I +A+ E    + +      W     +  W +     +HP+GW
Sbjct: 270 IRVASVEDVEDHRIKIHFDGWSH--GYDFWIDADHPDIHPAGW 310


>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, alternative
           splicing, chromatin regulator, DNA-binding,
           metal-binding, nucleus, repressor; HET: MLZ SUC; 2.80A
           {Drosophila melanogaster}
          Length = 447

 Score = 26.8 bits (59), Expect = 8.1
 Identities = 9/45 (20%), Positives = 18/45 (40%), Gaps = 2/45 (4%)

Query: 109 SIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGW 153
            ++C+A     +   L      W     +  W + +S  ++P GW
Sbjct: 392 RLVCVATVARVVGRLLKVHFDGWTD--EYDQWLDCESADIYPVGW 434


>1xhn_A CREG, cellular repressor of E1A-stimulated genes; beta-barrel,
           unknown function; HET: MSE; 1.95A {Homo sapiens} SCOP:
           b.45.1.1
          Length = 184

 Score = 26.8 bits (59), Expect = 8.9
 Identities = 7/40 (17%), Positives = 14/40 (35%), Gaps = 8/40 (20%)

Query: 214 FFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQI 253
           FF +LN    W        +  +F     +  E++    +
Sbjct: 152 FFAKLNITNIW--------VLDYFGGPKIVTPEEYYNVTV 183


>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein;
           enolase, Mg ION, PSI-2, NYSGXRC, structural genomics;
           2.90A {Rubrobacter xylanophilus dsm 9941}
          Length = 410

 Score = 26.5 bits (57), Expect = 9.0
 Identities = 25/148 (16%), Positives = 52/148 (35%), Gaps = 12/148 (8%)

Query: 136 PHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAV 195
             R + +M+  ++   G    ++    GI++  + +  +          +G      + +
Sbjct: 66  VERLYEKMRRWNIFTGGQAGAVITALSGIETALWDLAGKLQ-GVPVYRLLGGAFRRRVRL 124

Query: 196 FNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDT 255
           + D  +GT D     I G   E   N  +I  +  R      +D   + ++D        
Sbjct: 125 YADCNAGTVDAAAHHIEGGLFEEGSNEEYI--AVAREAVERGFDAIKLDVDDITGP---- 178

Query: 256 RTVEGIDSGFHEGIISRYGLDSDVARIE 283
                +   F  G IS    ++ VAR+ 
Sbjct: 179 -----LHRDFWNGAISPREHEAMVARVA 201


>3bvr_A NOTI restriction endonuclease; protein-DNA complex; HET: DNA; 2.50A
           {Nocardia otitidiscaviarum} PDB: 3bvq_A* 3c25_A*
          Length = 383

 Score = 26.6 bits (58), Expect = 9.5
 Identities = 13/88 (14%), Positives = 29/88 (32%), Gaps = 2/88 (2%)

Query: 273 YGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKT 332
               S  +R  + G  P + +  FI    + +   R+ I +     +       E     
Sbjct: 88  PLFMSAASRK-LFGYGPTEPLQ-FIAAPTLADQAVRDGIREWLDRGVHVVAYFQEKLGGE 145

Query: 333 VVVFRRGNIIEHIFDWSAKLIQETNQEG 360
           + + +  +  E  FDW+   ++      
Sbjct: 146 LSISKTDSSPEFSFDWTLAEVESIYPVP 173


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.322    0.137    0.440 

Gapped
Lambda     K      H
   0.267   0.0560    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 3,435,630
Number of extensions: 163040
Number of successful extensions: 633
Number of sequences better than 10.0: 1
Number of HSP's gapped: 632
Number of HSP's successfully gapped: 43
Length of query: 367
Length of database: 5,693,230
Length adjustment: 94
Effective length of query: 273
Effective length of database: 3,414,294
Effective search space: 932102262
Effective search space used: 932102262
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.1 bits)