RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781188|ref|YP_003065601.1| hypothetical protein CLIBASIA_05475 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >gnl|CDD|35672 KOG0451, KOG0451, KOG0451, Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]. Length = 913 Score = 27.3 bits (60), Expect = 2.5 Identities = 14/41 (34%), Positives = 18/41 (43%) Query: 87 PAPTAEELANPVFYSKMRDRKQRMGTFLLEKLSNQKYGPRV 127 P P+ E NPV K R R+Q G S+ +G V Sbjct: 280 PNPSHLEAVNPVAMGKTRSRQQSRGEGDYSPDSSAPFGDHV 320 >gnl|CDD|144872 pfam01434, Peptidase_M41, Peptidase family M41. Length = 192 Score = 26.4 bits (59), Expect = 4.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Query: 64 LQEAYTEALQC------RLDLLAEELLEEPAPTAEEL 94 L+EAY A + LD LAE LLE+ AEE Sbjct: 153 LEEAYERAKEILTENRDELDALAEALLEKETLDAEEF 189 >gnl|CDD|145660 pfam02624, YcaO, YcaO-like family. Length = 332 Score = 26.2 bits (58), Expect = 6.3 Identities = 17/87 (19%), Positives = 27/87 (31%), Gaps = 9/87 (10%) Query: 67 AYTEALQCRLDLLAEELLEEPAPTAEELANPVFYSKMRDRKQRMGTFLLEKLSNQKYGPR 126 A TEA Q RL + E+P E++A ++ P Sbjct: 221 ALTEAAQSRLTAILGA-REDPTLDLEDVARLYNLPRLFRD--SSLLLESGAARFFSADPT 277 Query: 127 VSVE----SKHTI--DLRPAIERLREH 147 V + + DL + RL+ Sbjct: 278 VDFSDLPDATGDLEEDLAELVARLKAA 304 >gnl|CDD|37924 KOG2713, KOG2713, KOG2713, Mitochondrial tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 347 Score = 26.1 bits (57), Expect = 6.5 Identities = 28/118 (23%), Positives = 47/118 (39%), Gaps = 16/118 (13%) Query: 4 LVKKAKKAVRAKKGCIYYSPELFAGI-----LDQVANGKALGHVLRKVGMPKYSTFYRW- 57 +VKK KKA + Y P G+ + GK++ V+ + + F Sbjct: 232 IVKKIKKAQTDNTSGVTYDPANRPGVSNLLNIYAAVTGKSIEEVVEESANMSTADFKDNV 291 Query: 58 ----IKKDLKLQEAYTEALQCRLDLLAEELLEEPAPTAEELANPVFYSKMRDRKQRMG 111 I+ ++ + E + L +++LEE A A ELA + + KQ MG Sbjct: 292 AEAVIEHLAPIRTEFEELINEPEYL--DKVLEEGAEKARELA----AKNLEEIKQLMG 343 >gnl|CDD|144936 pfam01527, Transposase_8, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family. Length = 75 Score = 25.8 bits (57), Expect = 7.3 Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 15 KKGCIYYSPELFAGILDQVAN-GKALGHVLRKVGMPKYSTFYRWIKKDLKLQEA 67 K YS E A + + G ++ + R+ G+ +T Y+W KK Sbjct: 1 MKRRRRYSEEFKARAVKESLEPGASVSELAREHGVS-PATLYKWRKKYRGGLLV 53 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.375 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,214,928 Number of extensions: 113674 Number of successful extensions: 345 Number of sequences better than 10.0: 1 Number of HSP's gapped: 345 Number of HSP's successfully gapped: 19 Length of query: 185 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 97 Effective length of database: 4,362,145 Effective search space: 423128065 Effective search space used: 423128065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.9 bits)