RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781188|ref|YP_003065601.1| hypothetical protein CLIBASIA_05475 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Score = 28.7 bits (63), Expect = 0.32 Identities = 7/89 (7%), Positives = 22/89 (24%), Gaps = 14/89 (15%) Query: 18 CIYYSPELFAGILDQVANGKALGHVLRKVGMPKYSTFYRWIKKDL-------------KL 64 + +D+V +G + + T + + + Sbjct: 790 SNKLGSDFLIHFIDEVQDG-LFQQIWGNFIITTLPTIGNLLDRKIALIGVLNMVINGQFF 848 Query: 65 QEAYTEALQCRLDLLAEELLEEPAPTAEE 93 Q Y + ++ + E + + Sbjct: 849 QSKYPTLISSTMNSIIETASSQSIANLKN 877 >d1r9da_ c.7.1.1 (A:) Glycerol dehydratase DhaB1 {Clostridium butyricum [TaxId: 1492]} Length = 786 Score = 26.3 bits (58), Expect = 1.8 Identities = 9/29 (31%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Query: 131 SKHTIDLRPAIERLREHYKHLKP-IDSER 158 SK I L+ + KP ++SER Sbjct: 2 SKGFSTQTERINILKAQILNAKPCVESER 30 >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Score = 25.2 bits (54), Expect = 3.5 Identities = 11/50 (22%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Query: 48 MPKYSTFYRWIKKDLKLQEAYTEALQC---RLDLLAEELLEEPAPTAEEL 94 P + + L + ++AL LA++L +P PT L Sbjct: 97 HPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRAL 146 >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Score = 24.8 bits (52), Expect = 4.4 Identities = 9/46 (19%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Query: 132 KHTIDLRPAIERLREHYKHLKPIDSERIPHKSTEKPLEIVESSIAE 177 H R + + R + K DS +P E I + + Sbjct: 196 AHASTTRLYLRKGRGETRICKIYDSPCLPEA--EAMFAINADGVGD 239 >d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 193 Score = 24.6 bits (53), Expect = 5.9 Identities = 8/34 (23%), Positives = 16/34 (47%) Query: 133 HTIDLRPAIERLREHYKHLKPIDSERIPHKSTEK 166 + +D+R ER+R K L + +I + + Sbjct: 40 YVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQ 73 >d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Score = 24.1 bits (51), Expect = 8.3 Identities = 11/71 (15%), Positives = 26/71 (36%), Gaps = 13/71 (18%) Query: 85 EEPAPTAEELANPVFYSKMRDRKQRMGTFLLEKLSNQKYGPRVSV---ESKHTID----- 136 E+P T +L+ ++R R ++ F L + R+ + Sbjct: 384 EDPGYTLYDLSE-----RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLED 438 Query: 137 LRPAIERLREH 147 + +++ L +H Sbjct: 439 YKASLKYLSDH 449 >d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 395 Score = 23.7 bits (51), Expect = 9.5 Identities = 15/86 (17%), Positives = 28/86 (32%), Gaps = 8/86 (9%) Query: 21 YSPELFAGILDQVANGKALGHVLRKVGMPKYSTFYRWIKKDLKLQEAYTEALQCRLDLLA 80 + + +L+ K+G ++ ++ L+ A D L Sbjct: 291 LGADDYRDLLNAALGWDFTTEDYLKIGERIWN-----AERLFNLKAGLDPARD---DTLP 342 Query: 81 EELLEEPAPTAEELANPVFYSKMRDR 106 + LEEP P + V +M R Sbjct: 343 KRFLEEPMPEGPNKGHTVRLKEMLPR 368 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.133 0.375 Gapped Lambda K H 0.267 0.0470 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 691,018 Number of extensions: 32896 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's gapped: 98 Number of HSP's successfully gapped: 15 Length of query: 185 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 105 Effective length of database: 1,309,196 Effective search space: 137465580 Effective search space used: 137465580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.7 bits)