>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62]
MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR