BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] (252 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] gi|254040866|gb|ACT57662.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 524 bits (1351), Expect = e-147, Method: Composition-based stats. Identities = 252/252 (100%), Positives = 252/252 (100%) Query: 1 MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVI 60 MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVI Sbjct: 1 MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVI 60 Query: 61 FVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY 120 FVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY Sbjct: 61 FVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY 120 Query: 121 EVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKY 180 EVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKY Sbjct: 121 EVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKY 180 Query: 181 RPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMS 240 RPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMS Sbjct: 181 RPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMS 240 Query: 241 IARKAFNRRSQR 252 IARKAFNRRSQR Sbjct: 241 IARKAFNRRSQR 252 >gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] gi|254039881|gb|ACT56677.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] Length = 180 Score = 46.9 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 36/64 (56%) Query: 57 LWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQ 116 L V + ++ L+I +EE + +NDIKYE +Q I K KE E L + +E ACL Sbjct: 91 LVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEH 150 Query: 117 YDRY 120 +RY Sbjct: 151 PNRY 154 >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] gi|254039880|gb|ACT56676.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 45.0 bits (105), Expect = 0.008, Method: Composition-based stats. Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Query: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-----VDPLTPRDISFTQYEKHACALVNWL 231 D KYRPS E +R P +L+K E +S + +P+ + Y H C L+ L Sbjct: 3 DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61 Query: 232 EKGKFNEMSIARKAFNRR 249 + F+ + I RK++N R Sbjct: 62 KNKDFDGVEIERKSYNLR 79 >gi|195953062|ref|YP_002121352.1| hypothetical protein HY04AAS1_0687 [Hydrogenobaculum sp. Y04AAS1] gi|195932674|gb|ACG57374.1| hypothetical protein HY04AAS1_0687 [Hydrogenobaculum sp. Y04AAS1] Length = 992 Score = 40.0 bits (92), Expect = 0.34, Method: Composition-based stats. Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 9/90 (10%) Query: 129 PMYGVIVPDFIHDLL-DIPEEKRRLN--TSYLTYVDRGLLDVRSSETPVVYDNKYRPSAE 185 P Y V+VPDF+ +L +I EEK L+ SYL +++ LD + + V+ D + Sbjct: 22 PDYPVLVPDFLAKVLFEIVEEKELLSIRKSYLKHLNLSYLDKKPKKVLVLAD------LD 75 Query: 186 AMRTICPTKLMKIFEDTISLYVDPLTPRDI 215 A ++C ++K E + V P + +DI Sbjct: 76 AFSSVCLMPILKAIEKESQVDVYPFSNKDI 105 >gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] gi|254040801|gb|ACT57597.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 35.4 bits (80), Expect = 7.4, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Query: 178 NKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLT-PRDISF-----TQYEKHACALVNWL 231 N+YRP + +R P K++K E + YVDPL P +I Y H CAL+ L Sbjct: 14 NQYRPLRKEVRNAFP-KILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLL 72 Query: 232 E 232 E Sbjct: 73 E 73 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.323 0.138 0.404 Lambda K H 0.267 0.0451 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,967,409,464 Number of Sequences: 14124377 Number of extensions: 143633793 Number of successful extensions: 264983 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 264979 Number of HSP's gapped (non-prelim): 9 length of query: 252 length of database: 4,842,793,630 effective HSP length: 136 effective length of query: 116 effective length of database: 2,921,878,358 effective search space: 338937889528 effective search space used: 338937889528 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 80 (35.3 bits)