BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781190|ref|YP_003065603.1| hypothetical protein
CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62]
         (233 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040867|gb|ACT57663.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 233

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 233/233 (100%), Positives = 233/233 (100%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP
Sbjct: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
           KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE
Sbjct: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE
Sbjct: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
Sbjct: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233


>gi|317120690|gb|ADV02513.1| phage associated primase [Liberibacter phage SC1]
 gi|317120834|gb|ADV02655.1| phage associated primase [Candidatus Liberibacter asiaticus]
          Length = 790

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 132/228 (57%), Positives = 167/228 (73%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML 65
           +D     GFG +CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ PK L+ 
Sbjct: 46  IDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIP 105

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
           FRM +  +KK+K+ E  QGHL+ L  GQ FVAYNIHPKT++ YTW+  PH  KVE+ PLL
Sbjct: 106 FRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLL 165

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
           + ++VEY F+FF  IT P  K+K     SK W ++NNR+YTN EI AFLSCFGEEFYNGS
Sbjct: 166 SEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGS 225

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           HDEWIPVVMA+H+ETRGS++GKEI R W K G TYDE++FN KWD+FD
Sbjct: 226 HDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273


>gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040902|gb|ACT57698.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 789

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 132/228 (57%), Positives = 167/228 (73%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML 65
           +D     GFG +CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ PK L+ 
Sbjct: 46  IDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIP 105

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
           FRM +  +KK+K+ E  QGHL+ L  GQ FVAYNIHPKT++ YTW+  PH  KVE+ PLL
Sbjct: 106 FRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLL 165

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
           + ++VEY F+FF  IT P  K+K     SK W ++NNR+YTN EI AFLSCFGEEFYNGS
Sbjct: 166 SEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGS 225

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           HDEWIPVVMA+H+ETRGS++GKEI R W K G TYDE++FN KWD+FD
Sbjct: 226 HDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273


>gi|317120732|gb|ADV02554.1| phage associated primase/P4 family phage/plasmid primase
           [Liberibacter phage SC2]
 gi|317120793|gb|ADV02614.1| phage associated primase [Candidatus Liberibacter asiaticus]
          Length = 790

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 124/230 (53%), Positives = 162/230 (70%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
            ++D     GFG++CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ PK L
Sbjct: 44  EEIDKLPACGFGLVCGVGEQPLYAFDIDSKDEKTTNNFKDTFEILHGTPIVRIGQKPKIL 103

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
           + FRM +  +KK+K+ E  QGHL+ L YGQ FVAYNIHP T+  YTW+  PH  K E+LP
Sbjct: 104 IPFRMDKDGVKKKKTPESPQGHLDILGYGQYFVAYNIHPITKEEYTWTTPPHRFKAEDLP 163

Query: 124 LLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYN 183
           LL+ ++VE F + F   TTP  K K   K  K+ K++NNR YTN EI AFLSCF E+FYN
Sbjct: 164 LLSKEDVECFSKAFQDFTTPLVKAKKSIKPVKLGKNNNNRYYTNREITAFLSCFNEDFYN 223

Query: 184 GSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           GSHD+WIPV+MA+H+ETRGS +G++I R W K G TYDE +FN KWD+FD
Sbjct: 224 GSHDDWIPVIMAVHHETRGSDKGQDIARRWSKQGSTYDEANFNYKWDTFD 273


>gi|41179390|ref|NP_958698.1| Bbp29 [Bordetella phage BPP-1]
 gi|45569522|ref|NP_996591.1| primase [Bordetella phage BMP-1]
 gi|45580773|ref|NP_996639.1| primase [Bordetella phage BIP-1]
 gi|40950129|gb|AAR97695.1| Bbp29 [Bordetella phage BPP-1]
          Length = 854

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 106/250 (42%), Gaps = 24/250 (9%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A D+  Y  +G G+LCG G  PV A DVD  D ++  RF    Q   G    RVG APK 
Sbjct: 41  AADLTRYPEHGVGVLCGQGAQPVVAIDVDTTDAELAARFVAWCQEHLGATCERVGNAPKI 100

Query: 63  LMLFRMQETNLKKQKSEE-----KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
           L+ +R +     K            +  LE L  GQQFVAY++HP T R Y W+     L
Sbjct: 101 LLAYRAESEGWGKATGAWFEDLAGDRHRLEVLGKGQQFVAYHVHPDTGRPYEWTDFFGGL 160

Query: 118 K---VEELPLLTPDEVEYFFEFFDTITT-----PRDKEKSYRKLSKIWKSHNNRRY---- 165
                 +LP++T  +VE   + F+ +            KS   L+   +      Y    
Sbjct: 161 DAMRASDLPVITEAQVEEALQVFEAMAEECGLARVTGSKSRTGLTSAPEDDPLMAYEPPV 220

Query: 166 --TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY-DE 222
                E R  ++    E     +D W+ V M++H+E  GS E   +  EW      Y   
Sbjct: 221 GIDLAEARRLVAYVDNE----DYDTWLKVGMSLHHEFDGSGEALALWDEWSATASNYASS 276

Query: 223 KSFNAKWDSF 232
           +    +WDSF
Sbjct: 277 EDVARRWDSF 286


>gi|91214217|ref|NP_919008.2| DR0530-like primase [Burkholderia phage BcepNazgul]
 gi|88604910|gb|AAQ63375.2| DR0530-like primase [Burkholderia phage BcepNazgul]
          Length = 843

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 98/243 (40%), Gaps = 28/243 (11%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
            G G L           D+D+ DE       N      G    RVG+AP+ L+LFR  E 
Sbjct: 73  AGVGFLT----KNTPGVDIDISDEGFAKHMENFVHENFGMAPVRVGRAPRRLLLFRCTEP 128

Query: 72  NLKKQKS----EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE--ELPLL 125
             K   S    E      +E LA GQQFVA++IHP T+R Y W      L +E  ELP+L
Sbjct: 129 FSKVNSSVYLDEWGEAQKVEILANGQQFVAFHIHPDTKRPYEWLYKQSPLDIEASELPVL 188

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI---------------EI 170
              + +   + F+     R      R  +   +S +                      E+
Sbjct: 189 RRVDAQAIVDEFEKQAKLRGWTLKKRSRTAPERSESGGEIDYDDPFAADVAKTDIGEDEL 248

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
            A L    +      ++ W+ V MA+ ++  G   G E+  EW +    YD K  +AKW 
Sbjct: 249 HAKLLLVPD---ADDYETWVNVGMALFHQYDGHERGLELWHEWSETADNYDAKELDAKWK 305

Query: 231 SFD 233
           SFD
Sbjct: 306 SFD 308


>gi|307149700|ref|YP_003891008.1| primase 2 [Cyanothece sp. PCC 7822]
 gi|306986766|gb|ADN18643.1| Primase 2 [Cyanothece sp. PCC 7822]
          Length = 1199

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 68/246 (27%), Gaps = 24/246 (9%)

Query: 2   VATDVDHYVYNGFGILCG------IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +  ++      GFG++ G        T+ + A D+D           +            
Sbjct: 61  IKGEIKKIQLQGFGVITGTSLTREHETYTLMAVDLDGASATNKMLELSGSNPLPPTVAFT 120

Query: 56  VGQAPKTLMLFRMQETNLKKQKSE---------EKIQGHLEFLAYGQQFVAYNIHPKTQR 106
             +  +   LF + E      +++         +     +E      Q V       T  
Sbjct: 121 STRPGRCQYLFLVPEKLKNLIRTKKIKTGVVGDDGKPEQIELRYSNLQSVLPPSVHPTTG 180

Query: 107 AYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT 166
            Y W       ++ E+ L     +E  F       +           +    +   +   
Sbjct: 181 QYHWVEGCAIDEI-EIALAPDWILEQMFI----DKSSPSSPALNLSYTTHTYNRGKQWSD 235

Query: 167 NIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFN 226
                ++L+       +  +D+W+ V MA+H               W +    Y      
Sbjct: 236 IDFAISYLNALSPFRAD-DYDDWVAVGMALHSV---DDSLLTEWDNWSRSSSKYKPGDCE 291

Query: 227 AKWDSF 232
            KW SF
Sbjct: 292 KKWKSF 297


>gi|218442267|ref|YP_002380595.1| primase [Cyanothece sp. PCC 7424]
 gi|218175408|gb|ACK74138.1| Primase 2 [Cyanothece sp. PCC 7424]
          Length = 1287

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 38/247 (15%), Positives = 72/247 (29%), Gaps = 24/247 (9%)

Query: 2   VATDVDHYVYNGFGILCG------IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +  ++      GFG++ G       GT+ + A D+D           +  +         
Sbjct: 79  IKGEIKKIQPQGFGVITGNSLTTQQGTYTLMAVDLDGASATDKMLELSRSKPLPPTVAFT 138

Query: 56  VGQAPKTLMLFRMQETNLKKQKSE---------EKIQGHLEFLAYGQQFVAYNI-HPKTQ 105
                +   LF + E      +++         +     +E      Q V     HP T 
Sbjct: 139 STLPGRCQYLFLVPEKFKNLIRTKKIKTGVVGDDGKPEQIELRYSNLQSVLPPSVHPDTG 198

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRY 165
           + Y W       ++ E+ L     +E      D               +    + N +  
Sbjct: 199 Q-YHWLEGCAIDEL-EIALAPDWILEQML--IDKSPLLPLSPPPRLSSTAQKNNSNKQWS 254

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
                 ++L+       +  +D+W+ V MA+H               W +    Y     
Sbjct: 255 DIDFAISYLNALSSFRAD-DYDDWLAVGMALHSV---DDSLLSEWDNWSRTSNKYKPGDC 310

Query: 226 NAKWDSF 232
             KW SF
Sbjct: 311 EKKWKSF 317


>gi|67925585|ref|ZP_00518913.1| hypothetical protein CwatDRAFT_0747 [Crocosphaera watsonii WH 8501]
 gi|67852574|gb|EAM48005.1| hypothetical protein CwatDRAFT_0747 [Crocosphaera watsonii WH 8501]
          Length = 288

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 71/223 (31%), Gaps = 15/223 (6%)

Query: 13  GFGILCGIGTHP-VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQ-E 70
           G GILCG  +   ++A D D +      R                G+  +   L+++   
Sbjct: 63  GIGILCGHNSKEFLFAIDCDGI---SAHRSLQRLGQLPPTVSFTSGRPGRCQYLYKLPSH 119

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
             +K  K        LE      Q V           Y W  +P  ++V   P      +
Sbjct: 120 KQIKSCKVTTAPGEVLEIRGSHHQSVLPPSPHPITGQYRWVNSPADVEVAIAPQWLVQWI 179

Query: 131 EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWI 190
           +         T    K K+ RK      S  +   T+ E    L      +Y   +D WI
Sbjct: 180 DL-------QTYKPSKPKNNRKPFHQNVSKLDTPSTSEEAAVALLDLIPSYYADDYDSWI 232

Query: 191 PVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
            V MA+   +       E    W +  + +       KW +F+
Sbjct: 233 KVGMALKSISP---VLLEAWDRWSRQSKKWKPGECAYKWRTFN 272


>gi|144898907|emb|CAM75771.1| primase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 757

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/226 (24%), Positives = 99/226 (43%), Gaps = 16/226 (7%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAPKTLMLFR 67
           +     G+ CG     +   D+DVLD  +  R     +   G  P+ R+G+APK L+++R
Sbjct: 65  WPDAAIGLACGT----LVGIDIDVLDPDIAHRLERLARDMLGDTPLLRIGKAPKRLLVYR 120

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW-SIAPHALKVEELPLLT 126
                   +++       LE LA+G+QFVA+ IHP T + Y W   +P  + +++LP++T
Sbjct: 121 ADVPFSGPKRAP------LEILAHGRQFVAFAIHPDTGQPYVWPEDSPLTVALDDLPVVT 174

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSH 186
            D V  + E    +     +  +    +    S + +R T   +R+ L+       +  +
Sbjct: 175 EDSVRAWLEAAIALLPTELRPATLESPAASMPSTSPQRGTLAAVRSALAHIPN--ADLDY 232

Query: 187 DEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           D W+ + MA+        EG  +   W  +       +    W SF
Sbjct: 233 DSWVRIGMAVKGAI--GEEGASLFAAWSAMSAKDVPATTANAWASF 276


>gi|32455419|ref|NP_862725.1| hypothetical protein pUH24_08 [Synechococcus elongatus PCC 7942]
 gi|97589|pir||S20531 hypothetical protein F - Synechococcus sp. (strain PCC 7942)
           plasmid pUH24
 gi|247792|gb|AAB21875.1| repA [Synechococcus elongatus PCC 7942]
          Length = 876

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 60/225 (26%), Gaps = 19/225 (8%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
            G G+L G  +  + A D D                         G+  +   L+++ + 
Sbjct: 67  TGIGLLTGPASGGLIAVDFDGPTAHEALPEGLTLTELPPTVAYTSGKPGRHQRLYQVPQE 126

Query: 72  NLKKQ---KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPD 128
                   K        LE      Q V    HP+T   Y W       ++ E+    P+
Sbjct: 127 RWAAIATQKLHSPDGDLLELRWNKLQSVIVGQHPETGA-YRWVEGCAPWEI-EVAEAPPE 184

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
            ++              K            S           R  L+      Y   ++ 
Sbjct: 185 LLDAMERQDRQTAPKSYKP---------IVSAPASDDEVAIARTMLAHV-PASYADDYES 234

Query: 189 WIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS-FNAKWDSF 232
           W+ V MA+      S    +    W      +D       KW SF
Sbjct: 235 WVAVGMALQSV---SDALLDDWIAWSAQSSKFDGNRKLERKWASF 276


>gi|83309457|ref|YP_419721.1| hypothetical protein amb0358 [Magnetospirillum magneticum AMB-1]
 gi|82944298|dbj|BAE49162.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 757

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 99/226 (43%), Gaps = 16/226 (7%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAPKTLMLFR 67
           +     G+ CG     +   D+DVLD  +  R     +   G  P+ R+G+APK L+++R
Sbjct: 65  WPDAAIGLACGT----LVGIDIDVLDPDIAHRLERLARDMLGDTPLLRIGKAPKRLLVYR 120

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW-SIAPHALKVEELPLLT 126
                   +++       LE LA G+QFVA+ IHP T ++Y W   +P  + +++LP++T
Sbjct: 121 ADVPFSGPKRAP------LEILAQGRQFVAFAIHPDTGQSYVWPEDSPLTVALDDLPVVT 174

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSH 186
            + V  + +    +     +  +    S    S + +R T   +R+ L+       +  +
Sbjct: 175 EESVRQWLDAAIALLPDDLRPATLVSPSVSMPSTSPQRGTLAAVRSALAHIPN--ADLEY 232

Query: 187 DEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           D W+ + MA+        +G  +   W  +       +    W SF
Sbjct: 233 DSWVRIGMAMKGAI--GEDGASLFAAWSAMSAKDVPAATAKAWASF 276


>gi|67923658|ref|ZP_00517127.1| hypothetical protein CwatDRAFT_2551 [Crocosphaera watsonii WH 8501]
 gi|67854499|gb|EAM49789.1| hypothetical protein CwatDRAFT_2551 [Crocosphaera watsonii WH 8501]
          Length = 956

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 40/274 (14%), Positives = 72/274 (26%), Gaps = 57/274 (20%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
           + G G+  G  +  V A D D  D                 P    G+  +  +L+R+  
Sbjct: 96  WTGIGLRLGTVSGGVLAIDADG-DLAEAKLQELSGGDLPLTPCWTSGKPGRRQLLYRISP 154

Query: 71  TNLKKQKSEE---KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL----- 122
              +K K+ +       HLEF   G Q V           Y W ++P             
Sbjct: 155 EYWEKIKTVKIDCGQGQHLEFRWDGCQSVLPPSKHPETGQYHWLVSPEESAQRNAQNQEL 214

Query: 123 ----------PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN----------- 161
                      +     +E+  +    + +     K     +   ++             
Sbjct: 215 TEKNGEDVATAIAPDWLIEFLLQQNQPVYSDSPSLKLPCTENSSSENAPHKPVNELQGGQ 274

Query: 162 -----------------------NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHY 198
                                   +       R++L        +  +D+W+ V MA+  
Sbjct: 275 THSDESQPIYPPVYSSKGTYSPSQKWTDEDWARSYLEALASWRAD-DYDQWVQVGMALQS 333

Query: 199 ETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            + G          W +    Y       KW SF
Sbjct: 334 VSDG---LLWDWEHWSRQSSKYKPGGCERKWRSF 364


>gi|291336798|gb|ADD96333.1| primase 2 [uncultured organism MedDCM-OCT-S08-C700]
          Length = 364

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 63/241 (26%), Gaps = 35/241 (14%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF---QSCCGKPISRVGQAP 60
            ++      G G+ CG  +  +   D D                  S     +   G+  
Sbjct: 41  KELVAKRSTGIGVCCGTPSGGLLFLDHDG--PSAAKILGEWGFSLSSLPPSWMVTSGRVG 98

Query: 61  KTLMLFRMQETNLKKQKSE---------EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
           +  +++++ E    K K+          +     +E    G Q +    HP T   Y W 
Sbjct: 99  RFQIIYKVPEKYWSKIKTRKYQTGVKDEDGSVEQIELRWDGTQSIVSGSHPMTDG-YRWM 157

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
            A     +  +       ++   E     T                           + R
Sbjct: 158 DARSPRDLS-IAEAPLAIIKKMMELNKKKTP----------------QIQTLNSDTDKAR 200

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
           + L        +  +D W+ + MA H    G            +    Y       KW S
Sbjct: 201 SLLQSINPSRLD-DYDIWLKIGMAAHSV--GDDSLLSDWENLSQKNSKYKSGECEKKWSS 257

Query: 232 F 232
           F
Sbjct: 258 F 258


>gi|172035639|ref|YP_001802140.1| hypothetical protein cce_0723 [Cyanothece sp. ATCC 51142]
 gi|171697093|gb|ACB50074.1| hypothetical protein cce_0723 [Cyanothece sp. ATCC 51142]
          Length = 732

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 46/248 (18%), Positives = 78/248 (31%), Gaps = 29/248 (11%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF-----QSCCGKPISRVGQA 59
           ++  Y  N  G+  G  +  V A D D   E               ++         G+ 
Sbjct: 65  ELCDYDVNAVGLALGKHSVNVVAIDHDG--ESCDKLIEELTGLSLKEALPSTVAFSSGRT 122

Query: 60  PKTLMLFRMQETNLKKQ---------KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA-YT 109
            +   L+ + E  L +          K E+     LEF   G   +    HPKTQ   Y 
Sbjct: 123 GRYQKLYSVSEDILNQLTNKQIKTGEKDEDGKSEQLEFRVNG-YSIIMGFHPKTQSYSYH 181

Query: 110 WSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
           W       ++ ++  L    +  +     T    + K  S         S         +
Sbjct: 182 WLDGCSPQEI-DITPLPEWWLNIWLNSEKTNKKEKKKSLSKINDIPNDLSSI-----ISK 235

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGS----AEGKEIVREWCKLGRTYDEKSF 225
            +  LS       +  +D+W  V MA+H+E            ++   W +    + +   
Sbjct: 236 CQNLLSQLKPFRCDN-YDDWNRVGMALHHEAGDDPILSELLLDLWTNWSQNSNKFKDGEC 294

Query: 226 NAKWDSFD 233
             KW SFD
Sbjct: 295 ATKWQSFD 302


>gi|291335727|gb|ADD95331.1| hypothetical protein cce_0723 [uncultured phage MedDCM-OCT-S05-C22]
          Length = 651

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 69/240 (28%), Gaps = 27/240 (11%)

Query: 2   VATDVDHYVY-NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           VA  ++        G+  GI  + +   DVD     +         S  G PI    +A 
Sbjct: 51  VALAINRNSDLKAVGVFTGIRGNGIVILDVD---RNLSKYLKAWGSSLDGAPIITSTKAN 107

Query: 61  KTLMLFRMQETNLKKQKS---EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
               LFR+ E      K     ++  G  E L  G+Q V +  +P   +           
Sbjct: 108 AAKYLFRVPEELWADVKGHGLRKEDGGDYEILW-GRQGVVFGAYPG-GKVSKPGQYLLDG 165

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            + ++P      +               K+       K     +  +    +I       
Sbjct: 166 DLADIPTAPDWLLAEM------------KQPPRTINKKELDFTDRTQDEVQQIIFECLSV 213

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY-----DEKSFNAKWDSF 232
                 G+ D W+ + MAIH        G  +   W      Y     D       W SF
Sbjct: 214 ISPQGKGTRDHWVKIGMAIHSALPT-DMGLHLWASWSCQDPDYASEWEDSNPCEEVWYSF 272


>gi|307149770|ref|YP_003890813.1| Primase 2 [Cyanothece sp. PCC 7822]
 gi|306986570|gb|ADN18448.1| Primase 2 [Cyanothece sp. PCC 7822]
          Length = 302

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 73/230 (31%), Gaps = 16/230 (6%)

Query: 7   DHYVYN--GFGILCGIGTHP-VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
             Y     G GIL G  +   + A DVD    Q                    G+  +  
Sbjct: 67  QRYPIRPPGIGILLGHNSKEFLVALDVDGYSAQSF--IQELLPRLPPTIAFTSGRPGRCQ 124

Query: 64  MLFRMQETNLKKQ-KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
            LF++   +  K  K        LE  A GQQ V           Y W       ++ E+
Sbjct: 125 YLFKLPPGHSIKPFKRITGPGEALEIRATGQQSVLPPSPHPVTGQYFWLGGCRPDEM-EV 183

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
            ++    ++         +  R K+      + + +   + R T IE            +
Sbjct: 184 AIIPEQIIDL------AQSPKRTKKIQPITKAPLIREVRHDRATTIEAAKSALSLIHANF 237

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
              +D WI + M++H+    S    +    W +L   Y       KW SF
Sbjct: 238 ADDYDSWIRIGMSLHFI---SFSLLDDWDRWSQLSAKYQPGECYYKWASF 284


>gi|307149891|ref|YP_003890934.1| Primase 2 [Cyanothece sp. PCC 7822]
 gi|306986691|gb|ADN18569.1| Primase 2 [Cyanothece sp. PCC 7822]
          Length = 302

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 73/222 (32%), Gaps = 14/222 (6%)

Query: 13  GFGILCGIGTHP-VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
           G GIL G  +   + A DVD                         G+  +   LF++   
Sbjct: 75  GVGILLGQNSKEFLIALDVDGY--SARAYLQELIPHLPRTVAFTSGRPGRCQYLFKLPPG 132

Query: 72  NLKKQ-KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
           +  K  K        LE  A GQQ V           Y W       ++ E+ ++    +
Sbjct: 133 HSIKPFKRITGPGEALEIRATGQQSVLPPSPHPVTGQYFWLGGCRPDEI-EVAIIPEQII 191

Query: 131 EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWI 190
           +              K +   K   I +  ++R  T    ++ LS     F +  +D WI
Sbjct: 192 D-----LAQSPKRTKKIQPITKAPLIREVRHDRATTIEAAKSALSLIHPNFAD-DYDSWI 245

Query: 191 PVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            + M++H+    S    +    W +L   Y       KW SF
Sbjct: 246 RIGMSLHFI---SFSLLDDWDRWSQLSAKYQPGECYYKWASF 284


>gi|218442562|ref|YP_002380883.1| primase [Cyanothece sp. PCC 7424]
 gi|218175333|gb|ACK74064.1| Primase 2 [Cyanothece sp. PCC 7424]
          Length = 305

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 65/222 (29%), Gaps = 14/222 (6%)

Query: 13  GFGILCGIGTHP-VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
           G GIL G      + A DVD      +   +    S         G+  +   LF++   
Sbjct: 75  GIGILLGHNKREFLIALDVDGD--SAIAYLHRLIPSLPRTVAFTSGRLGRCQYLFKLPSN 132

Query: 72  NLKKQ-KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
              K  K        LE  + GQQ V           Y W    +  +V  + L  P+ +
Sbjct: 133 QSIKPFKVITGPGEALEIRSTGQQSVLPPSPHPLTGQYYWVGGCNPNEV-NVALAPPELI 191

Query: 131 EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWI 190
                              +    +          +     + L+C     Y   +D WI
Sbjct: 192 TLSQSHSSKKKIQATDNNPFVSPVRG-----KLTTSIEAALSALACIHPS-YADEYDSWI 245

Query: 191 PVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            + M++H  +            W +    Y     + KW SF
Sbjct: 246 RIGMSLHSISY---SLLHDWDSWSQSSAKYKPGECHYKWASF 284


>gi|117926195|ref|YP_866812.1| hypothetical protein Mmc1_2915 [Magnetococcus sp. MC-1]
 gi|117609951|gb|ABK45406.1| conserved hypothetical protein [Magnetococcus sp. MC-1]
          Length = 765

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 85/236 (36%), Gaps = 22/236 (9%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP-ISRVGQAPKTLM 64
              +   G G+  G         D+DV DE V  +         G+    R+G+APK L+
Sbjct: 60  WKQWPGAGIGVPGGQVAG----IDIDVADESVSLQLEQLAMRLFGETKAVRIGRAPKRLL 115

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP-HALKVEELP 123
           ++R        +K        LE L  GQQFVAY IHP T   Y W       LK+E+LP
Sbjct: 116 VYRTDTPFKGIKKHP------LEVLCLGQQFVAYAIHPDTGHPYQWINQELTDLKIEDLP 169

Query: 124 LLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTN-------IEIRAFLSC 176
           ++T  +  +F E    +     +            S++              E  A    
Sbjct: 170 VITEQQAHHFIEQGLALLPVEMRPARLEARGDSCNSYSAISTVISHSQAGTYEAVADAMR 229

Query: 177 FGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           F     +  +D+W+ + MAI         G+ +  EW         +     W  F
Sbjct: 230 FISN-ADLPYDDWMRIGMAIKGAL--GDAGEVLFAEWSASSAKNIAQETFKAWSGF 282


>gi|269975282|gb|ACZ55506.1| primase [Staphylococcus phage SA1]
          Length = 554

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 93/246 (37%), Gaps = 21/246 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +    + Y  NG GIL         A D+DV DE  V    +      G+   R+G+ PK
Sbjct: 50  IQRWAERYTKNGIGILT----KYTPAVDIDVYDEDAVAHMADWVLENVGRAPCRIGREPK 105

Query: 62  TLMLFRMQETNLKKQKSEE----KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA- 116
            L LFR +    K +          +  +E LA GQQFVAY IHP T R Y W    +  
Sbjct: 106 KLFLFRTESPFSKVKSGVWEDDFGQRHAVEILADGQQFVAYGIHPDTNRDYYWLDDENPL 165

Query: 117 -----LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
                  +EE+ L T  E+   F+ +         ++       I  +          IR
Sbjct: 166 NNAADFDLEEISLDTAREIAAEFDRYAKEQGWTMVKRPMNGYEAIGTADEEDWAATAGIR 225

Query: 172 AF-------LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
            +            +      ++ +I V+ A+    R   E K I REW      +D+  
Sbjct: 226 KWDGTYEDLRDLVMKYPNPEDYENYIKVLAALQISCRDQDEAKSIAREWAMQAHNFDDGD 285

Query: 225 FNAKWD 230
           F  KWD
Sbjct: 286 FEYKWD 291


>gi|254463719|ref|ZP_05077130.1| Primase C terminal 2 family [Rhodobacterales bacterium Y4I]
 gi|206684627|gb|EDZ45109.1| Primase C terminal 2 family [Rhodobacterales bacterium Y4I]
          Length = 890

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/249 (25%), Positives = 102/249 (40%), Gaps = 31/249 (12%)

Query: 4   TDVDHYVYN-----GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVG 57
           T++  +          G++CG     +   D+DVLD     R         G  P+SR+G
Sbjct: 79  TEITRWTKAQRNCTNTGLVCG----DLIGVDIDVLDRDHAHRLTFIATEMLGMSPLSRIG 134

Query: 58  QAPKTLMLFRMQETNLKKQKSE----EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW-SI 112
           +APK L+ FR      K Q SE    +     +E LA GQQFV + IHP T+  Y W   
Sbjct: 135 RAPKILLAFRTDAPFDKVQTSEFHMLDGTVARVEVLATGQQFVGFGIHPDTKAPYHWPEC 194

Query: 113 APHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKS---------YRKLSKIWKSHNNR 163
           +P  + + ELP+++ D    F    +        + +          RK + + +     
Sbjct: 195 SPLDVSLHELPVVSQDRCAAFISAAEGYFRKVGGQTTSDRREIDREGRKAAGLKQKEAPS 254

Query: 164 RYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK 223
           R    E  A +S          +D+WI V +A++      ++G+++   W       D  
Sbjct: 255 RELIEEAVAHISN-----DELPYDDWIKVGLALYAAL--GSDGRDLWETWSAEASKNDPA 307

Query: 224 SFNAKWDSF 232
               KWDSF
Sbjct: 308 YSAEKWDSF 316


>gi|291335967|gb|ADD95559.1| hypothetical protein [uncultured phage MedDCM-OCT-S09-C37]
          Length = 288

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 67/237 (28%), Gaps = 24/237 (10%)

Query: 2   VATDVDHYVY-NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           VA  +         GI  GI  + +   DVD     +        +S  G P+    +  
Sbjct: 56  VALAMQRNSDLKAVGIFTGIRGNGIVFLDVD---RNLKRCMKQWGESLAGAPMVTSTKQN 112

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYG-QQFVAYNIHPKTQRAYTWSIAPHALKV 119
               LFR+ E   K+ K     +   E L    +Q V +  +P                +
Sbjct: 113 AAKFLFRVPEKLWKEVKGRGLGKQDYEILWNSKKQGVIFGAYPG-GDNSEPGEYKFEGDL 171

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
             +P+     +               +E     + +     +       +I         
Sbjct: 172 NSIPVAPDWLLAEM------------REPPKTIIKRDLDFSDRSDDEIFQIVKDCLDVIP 219

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK-----SFNAKWDS 231
               GS D W+ + MAI+        G  +   W      ++E+          W S
Sbjct: 220 NKGKGSRDHWVKIGMAINSALPT-EAGMMLWSSWSSDDPDFEEEWKEDNPCEHIWHS 275


>gi|217979240|ref|YP_002363387.1| hypothetical protein Msil_3116 [Methylocella silvestris BL2]
 gi|217504616|gb|ACK52025.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 841

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 87/237 (36%), Gaps = 13/237 (5%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
           +   +   G G++ G+ +  V A D+D LD  +  R     +   G    RVG+APK L 
Sbjct: 100 EWASW-GAGVGLMTGLVSS-VLAVDIDTLDHGLSARAAELMREMLGPARPRVGRAPKALF 157

Query: 65  LFRMQET-NLKKQK--SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           L+R  +     K K    E  +  +E     +Q V    HPKT + Y+W         +E
Sbjct: 158 LYRCAQPVPFLKVKFDGPEGKRELVELSTDRRQIVMRGTHPKTGKPYSWPEGLPPF--KE 215

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE--IRAFLSCFGE 179
           L  +TP++VE FF     +    +                 +   + E   RA  S    
Sbjct: 216 LTEVTPEQVEAFFLELSHVMPNAEFRGRKLSAGSGSGGDQTKFTGSAEAVARAVRSLPNT 275

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSA-EGKEIVREWCKL---GRTYDEKSFNAKWDSF 232
           E    + D W+ ++ AI           + + +EW +        D      +W   
Sbjct: 276 EALYPTRDSWLDMLYAIKAALPDDPGAAEALAQEWSEKYDGPDGNDPDYVAQEWRKM 332


>gi|315121955|ref|YP_004062444.1| P4 family phage/plasmid primase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495357|gb|ADR51956.1| P4 family phage/plasmid primase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 686

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 97/164 (59%), Positives = 119/164 (72%)

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
           +  +KK+++ +  QGHL+ L  GQ FVAYNIHPKT+  YTW+  P A K EELPLL+ ++
Sbjct: 3   KAGIKKKQTPKSQQGHLDILGGGQYFVAYNIHPKTKEEYTWTTPPDAFKAEELPLLSEED 62

Query: 130 VEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEW 189
           VE+ FEFF   TTP  K K   K  K   +  NRRYTN EI AFLSCFGEEF NG+HDEW
Sbjct: 63  VEHLFEFFKESTTPVVKAKKEIKSPKEGNTKGNRRYTNREITAFLSCFGEEFTNGTHDEW 122

Query: 190 IPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           IPVVMAIH+ET+GS EGKE+ R W K G +YDE++FN KW +FD
Sbjct: 123 IPVVMAIHHETQGSHEGKELARRWSKRGSSYDEENFNYKWSTFD 166


>gi|307317147|ref|ZP_07596588.1| Primase 2 [Sinorhizobium meliloti AK83]
 gi|306897235|gb|EFN27980.1| Primase 2 [Sinorhizobium meliloti AK83]
          Length = 806

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/244 (16%), Positives = 81/244 (33%), Gaps = 33/244 (13%)

Query: 12  NGFGILCGIGTH----PVYAFDVDVLDEQVVDRFNNEFQSCCGK----PISRVGQAPKTL 63
           N  G+  G  +      ++  D+D+ D ++ D    +           P    G   ++ 
Sbjct: 49  NNVGVRLGKWSKIGNDYLHVIDLDIRDPKLADEARQKLTELFPVWKTYPTVISGSGGESR 108

Query: 64  MLFRMQETNLKKQK------------SEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTW 110
             + + +     +K             +   +  ++    G+Q       HP T + Y W
Sbjct: 109 HFYILSDKPFSPKKLAHSREKIQTADGKWHWRWEIDLFGTGKQVAMPPSIHPDTGKPYRW 168

Query: 111 --SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI 168
                   L +   P++  D +    +            +  + L               
Sbjct: 169 QTPFDFDDLDLGLGPMVGSDVLAKMLDMDADDERAAADPERSKPLGLSLD---------- 218

Query: 169 EIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
           EIR  L     +++    D W+ V M++H+ET GS  G ++  ++ K    +D+      
Sbjct: 219 EIREVLDDLPRDYWRDDRDGWLTVGMSLHHETGGSDHGYKLWLDFSKDSEKFDKSDQKRV 278

Query: 229 WDSF 232
           W SF
Sbjct: 279 WKSF 282


>gi|315122923|ref|YP_004063412.1| P4 family phage/plasmid primase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496325|gb|ADR52924.1| P4 family phage/plasmid primase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 356

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/164 (59%), Positives = 119/164 (72%)

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
           +  +KK+++ +  QGHL+ L  GQ FVAYNIHPKT+  YTW+  P A K EELPLL+ ++
Sbjct: 3   KAGIKKKQTPKSQQGHLDILGGGQYFVAYNIHPKTKEEYTWTTPPDAFKAEELPLLSEED 62

Query: 130 VEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEW 189
           VE+ FEFF   TTP  K K   K  K   +  NRRYTN EI AFLSCFGEEF NG+HDEW
Sbjct: 63  VEHLFEFFKESTTPVVKAKKEIKSPKEGNTKGNRRYTNREITAFLSCFGEEFTNGTHDEW 122

Query: 190 IPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           IPVVMAIH+ET+GS EGKE+ R W K G +YDE++FN KW +FD
Sbjct: 123 IPVVMAIHHETQGSHEGKELARRWSKRGSSYDEENFNYKWSTFD 166


>gi|75812724|ref|YP_320341.1| hypothetical protein Ava_C0063 [Anabaena variabilis ATCC 29413]
 gi|75705480|gb|ABA25152.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 332

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 64/256 (25%), Gaps = 38/256 (14%)

Query: 12  NGFGILCG--IGTHPVYAFDVDV-----------------------LDEQVVDRFNNEFQ 46
            G  ++CG       + A D D                          E       +   
Sbjct: 65  TGIALVCGFNHPQGYLVAIDCDGETSWRQIIQINEHSEPEELNHLTPTETRDTPMESLCD 124

Query: 47  S----CCGKPISRVGQAPKTLMLFRMQETNLKKQKSEE---KIQGHLEFLAYGQQFVAYN 99
                         G+  ++  L+ +  +     KS +       HLEF       +   
Sbjct: 125 RAQQYLPPTIAFTSGRKYRSQRLYLIPNSKACDVKSRKIKTGKDEHLEFRGKNLASILPP 184

Query: 100 IHPKTQRAYTWSIAPHALK--VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
                 R Y W       +  +E  P     ++    E       P++K      + +  
Sbjct: 185 SFHPEGRNYRWLPGCSPSERQIEIAPDWVIAQMLVKQEKTRKFNLPKEKYNRRYGVDRYA 244

Query: 158 KSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG 217
               +           L       +   +  WI V MA+   +       +    W +L 
Sbjct: 245 HLIPSIETNIQTALVLLEVIHP-RFADDYHSWIQVGMALKSVSP---ILFKAWDTWSQLS 300

Query: 218 RTYDEKSFNAKWDSFD 233
             Y       KW SF+
Sbjct: 301 PKYKPGECAYKWQSFN 316


>gi|17158691|ref|NP_478202.1| hypothetical protein alr7555 [Nostoc sp. PCC 7120]
 gi|17134640|dbj|BAB77198.1| alr7555 [Nostoc sp. PCC 7120]
          Length = 332

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/255 (13%), Positives = 64/255 (25%), Gaps = 38/255 (14%)

Query: 12  NGFGILCG--IGTHPVYAFDVDVLD----------------------EQVVDRFNNEFQS 47
            G  ++CG       + A D D                          +  D        
Sbjct: 65  TGVALVCGFNHPQGYLVAIDCDGETSWRHIIQINEHLEPKELNQLTPAETRDTPMESLHD 124

Query: 48  -----CCGKPISRVGQAPKTLMLFRMQETNL---KKQKSEEKIQGHLEFLAYGQQFVAYN 99
                         G+  ++  L+ + ++     K +K +     HLEF       +   
Sbjct: 125 RAQKYLPPTIAFTSGRKYRSQRLYLIPKSKAWEVKSRKIKTGKDEHLEFRGKNLASILPP 184

Query: 100 IHPKTQRAYTWSIAPHALK--VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
                 R Y W       +  +E  P     ++    E        ++K      + +  
Sbjct: 185 SFHPEGRNYRWLPGCSPSERQIEIAPDWVIAQMLAKQEKTRKFNLLKEKYNRRYGVDRYA 244

Query: 158 KSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG 217
               +           L       +   +  WI V MA+   +       +    W +L 
Sbjct: 245 HLIPSIESNIQTALVLLEVIHP-RFADDYHSWIQVGMALKSVSP---ILFKAWDTWSQLS 300

Query: 218 RTYDEKSFNAKWDSF 232
             Y       KW SF
Sbjct: 301 PKYKPGECAYKWQSF 315


>gi|260893044|ref|YP_003239141.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
 gi|260865185|gb|ACX52291.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
          Length = 283

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/228 (13%), Positives = 61/228 (26%), Gaps = 15/228 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +A     + +   G+  G  +   +  DVD  + +       +      + + ++  +  
Sbjct: 60  IAAWWRRWPWANIGVATGSIS-GFFVLDVDGPEGEDSLYELVKRHGELPETVEQITGSGG 118

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +LFRM E      K    +   L+    G   VA      + R Y W  +    +V E
Sbjct: 119 RHLLFRMPEGRAIGNKVR--LAPGLDVRGEGGYVVAAPSLHASGRRYEWEFSSRPGEV-E 175

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNN-----------RRYTNIEI 170
           +       +E       +   P ++ +            NN           +R      
Sbjct: 176 VAEAPGWLLELLAGPAGSQGRPVEEWRQLISGGVEEGQRNNSIAALAGHLLRKRVDPYVA 235

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR 218
              L  + +        +   V        +           W   G 
Sbjct: 236 LDLLLAWNQVKCRPPLPDEEVVRTVDSIAKKELERRLGKWWRWSTSGA 283


>gi|325109860|ref|YP_004270928.1| Bifunctional DNA primase/polymerase [Planctomyces brasiliensis DSM
           5305]
 gi|324970128|gb|ADY60906.1| Bifunctional DNA primase/polymerase [Planctomyces brasiliensis DSM
           5305]
          Length = 660

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 64/235 (27%), Gaps = 31/235 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE---QVVDRFNNEFQSCCGKPISRVGQ 58
           +            GI        +   D+D  D       DR     ++           
Sbjct: 56  IEQWWTQTPDANIGIAT----DGLVVVDIDGADHPWLTDPDRMAELAKNAMAVTPR---- 107

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
                + F   +  +    S  K+   ++  A G   VA        + Y WS +     
Sbjct: 108 -GGRHLYFAQGDEEIG--CSVSKLADKVDIRANGGYVVAPPS-TVNGKEYRWSNSFELGG 163

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG 178
             EL  +              +  P++ ++         +          E    LS   
Sbjct: 164 RSELSAVPE-------SISGPLRRPKNDQQQPV-----QQDGIFSIAEKAEALTILSRLP 211

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
            E  + + D+W+ V MA+H  +    +       W KL   +        W  FD
Sbjct: 212 LECCD-NRDDWLRVGMALHSVSP---QLLPDWVIWSKLSAKFQPGVCERSWRGFD 262


>gi|257455559|ref|ZP_05620789.1| bifunctional DNA primase/polymerase domain protein [Enhydrobacter
           aerosaccus SK60]
 gi|257447025|gb|EEV22038.1| bifunctional DNA primase/polymerase domain protein [Enhydrobacter
           aerosaccus SK60]
          Length = 768

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 74/235 (31%), Gaps = 29/235 (12%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP---ISRVG 57
           M+      Y      I        + A D+D       D      +S  GK    + ++ 
Sbjct: 63  MITQWWGKYPQANIAIFL--AGSGLCAVDIDPR--NGGDYTIEVLESEHGKIDSDVLQLT 118

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                  +F +        K    +   ++F + G   +A      + ++Y W ++   L
Sbjct: 119 GGGGEHRVFLLPS---GDVKLPGTLGKGVDFKSNG-YIIAEPSSHISGQSYVWEMSSDPL 174

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
               +P   PD +  F      I       ++    + +  +     Y  +E   F+   
Sbjct: 175 -AGAVPSPLPDWIRSF-----NINAAHASNETGTLHNGMSDNQY---YDVLEALQFI--- 222

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
                +   D W+ V MA+     G     ++  +W +    +D+      W SF
Sbjct: 223 ----GSDDRDTWLNVGMALQAS--GDKRAYQMWCDWSQASSKFDQNDQYRVWRSF 271


>gi|260893832|ref|YP_003239929.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
 gi|260865973|gb|ACX53079.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
          Length = 283

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/228 (13%), Positives = 59/228 (25%), Gaps = 15/228 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +A     + +   GI  G  +   +  DVD  + +              + + ++  +  
Sbjct: 60  IAAWWRRWPWANIGIATGKAS-GFFVLDVDGPEGEDSLYELVRRHGELPETVEQITGSGG 118

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +LFRM E      K    +   L+    G   VA        R Y W  +    +V+ 
Sbjct: 119 RHLLFRMPEGRAIGNKVR--LAPGLDVRGEGGYIVAAPSIHAGGRRYEWEFSSRPGEVQ- 175

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNN-----------RRYTNIEI 170
           +       +E      + +  P +  +            NN           +R      
Sbjct: 176 IAEAPGWLLELLAGPAEGLGRPVEVWRQLVSEGVEEGQRNNSIAALAGHLLRKRVDPYVA 235

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR 218
              L  + +        +   V        +           W   G 
Sbjct: 236 LDLLLAWNQVKCRPPLPDEEVVRTVDSIAKKELERRLGKWWRWSTSGA 283


>gi|254431281|ref|ZP_05044984.1| Primase C terminal 2 family [Cyanobium sp. PCC 7001]
 gi|197625734|gb|EDY38293.1| Primase C terminal 2 family [Cyanobium sp. PCC 7001]
          Length = 901

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/236 (14%), Positives = 65/236 (27%), Gaps = 31/236 (13%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLD--EQVVDRFNNEFQSCCGKPISRVGQAP 60
           A ++D      +G+  G  +  V   D+D     E       +  +          G+  
Sbjct: 61  AAELDLMPPA-WGLKSGPAS-GVVVLDLDAEGWRESFQAVTGHTVEDLPATLSWTSGKPG 118

Query: 61  KTLMLFRMQETNLKKQKSE-----EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
           ++   F +        ++      +  +   E      Q V    HP+T R Y W     
Sbjct: 119 RSGRAFTVPPEWWPALRNRRPWSNDDGETLWELRWDRHQAVIIGTHPETGR-YRWRPGGD 177

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
              V  L +     +E                    +     +               L+
Sbjct: 178 PKDVG-LAVAPDWLLEPL----------------AVQELPDTEPITPTAEDTERAVQMLA 220

Query: 176 CFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
                  + S+ +W+   MA+H           +  EW +    +DE     KW S
Sbjct: 221 HIDP-AAHTSYGDWLRAGMALHDTDPD---LLSVWVEWSRQMPNFDEAECLEKWSS 272


>gi|312113986|ref|YP_004011582.1| Primase 2 [Rhodomicrobium vannielii ATCC 17100]
 gi|311219115|gb|ADP70483.1| Primase 2 [Rhodomicrobium vannielii ATCC 17100]
          Length = 782

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 83/247 (33%), Gaps = 45/247 (18%)

Query: 13  GFGILCGIGTH----PVYAFDVDVLDEQVVDRFNNEFQSCCGK------PISRVGQAPKT 62
             GI  G  +      ++A D+D+   +      +              P  + G    +
Sbjct: 50  NVGIRLGKPSKVEGLYLHAIDLDIRVPEAKSEALDRLDELISDGDLKELPCVQSGSGGAS 109

Query: 63  LMLFRMQETNLKKQK------------SEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYT 109
              + + E   + +K             +E  +  +E    G+Q V     HP T +AY 
Sbjct: 110 RHFYFLTEDAFRSKKLAHSKHKFTGDDGKEHWEWEIELFGTGKQVVLPPSIHPDTGKAYR 169

Query: 110 WSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
           W + P   +   +P ++ D ++      ++                 +++      T  E
Sbjct: 170 WVLQPDLKR--GIPRISADLIDELVGGDESTG--------------FYENSEPLNLTINE 213

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGS----AEGKEIVREWCKLGRTYDEKSF 225
            R +L    +  +    D W+ V MA+ +E         E  E+  EW + G  Y+    
Sbjct: 214 ARDYLDAIPD--WADDRDSWVRVGMALKHEFADDKALIKEAWELFDEWSRRGYGYNRAKN 271

Query: 226 NAKWDSF 232
            A+W  F
Sbjct: 272 LAQWRGF 278


>gi|218961148|ref|YP_001740923.1| hypothetical protein CLOAM0836 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729805|emb|CAO80717.1| hypothetical protein CLOAM0836 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 343

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 68/233 (29%), Gaps = 14/233 (6%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL-MLF 66
              +N   I+ G  +  +   D+D  D  +                  +  +      L 
Sbjct: 84  KQEHNAIAIITGEAS-QLMVIDIDKRDADIYALLAEYGLEIDN-YCYALTPSGGMHIYLN 141

Query: 67  RMQETNLKKQKSEEKIQG-----HLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
                  KK+   + +        ++  A G    A          Y W   P   +  +
Sbjct: 142 LSHSELWKKRYGRKTLTTTNKNIGIDIRAEGGLIFAPPSIVTNGGFYEWVNMPVNKEDTD 201

Query: 122 L-PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
             P      ++  F + +  T     +K+  K    +  + N +    +    +      
Sbjct: 202 YDPNKLIPIMDAIFGYNNNPTPLAPIQKTITKSYFPFTYYPNIQDNYDQAAQLIRKLNGT 261

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSF 232
               ++++WI + +A+  E      G  +   +         E+    KW+SF
Sbjct: 262 I--INYNDWIRMGIALKNEF--GKRGLSLWLLFADNSAYQDTEEYLIKKWNSF 310


>gi|153213459|ref|ZP_01948770.1| integrase [Vibrio cholerae 1587]
 gi|124115923|gb|EAY34743.1| integrase [Vibrio cholerae 1587]
          Length = 792

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 81/234 (34%), Gaps = 25/234 (10%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE--FQSCCGKPISR---VGQAPKT 62
            +     G+ CG     ++A DVDV D++    F      +   GK          +  T
Sbjct: 83  KFRGYNIGLACGKN-GGIFAIDVDVEDKKGNKGFLALDMLEQEFGKLPETQIQRTASGGT 141

Query: 63  LMLFRMQ---ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
             +F+     +T+  K       +G  E             +P   R   + +    +  
Sbjct: 142 HYIFQWTQGAKTSSGKIAKAIDTRGGDEHSCRSHIV----AYPSRVRNGGYEMVATTVAP 197

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
            E+P    + +             R  +K  R   +I       +YT  ++   L     
Sbjct: 198 AEIPSWVLEALA---------KPDRSSKKQSRGSEEITDDDIENKYTPRQLWKMLDFINP 248

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           +     +DEW+  + AIH +    A+G E+   W + G  Y+    + +W +FD
Sbjct: 249 DEL--EYDEWLMCLQAIHSQYP-DAKGFELADRWSQRGSRYEPNEVSIRWGAFD 299


>gi|39937604|ref|NP_949880.1| hypothetical protein RPA4546 [Rhodopseudomonas palustris CGA009]
 gi|39651463|emb|CAE29986.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 770

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/239 (23%), Positives = 92/239 (38%), Gaps = 17/239 (7%)

Query: 4   TDVDHYVY--NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
            D+  +     G GI+ G G   + A D D LD+    +         G    R+G+APK
Sbjct: 73  HDLARWQRMGAGVGIMTG-GPLNLIAVDADTLDQACAGKVMIAGMKHFGSTPVRIGRAPK 131

Query: 62  TLMLFRMQET------NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
            + L R+ E              E +    +E L+ G+QFVA+ IHP T++ Y W+    
Sbjct: 132 AVYLIRVTEPIQYCRVEFGPLNDEGRRVDRVELLSDGRQFVAHGIHPVTKKPYVWTTPL- 190

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
              V++LP++TP ++  F +    I           + +    S  + R    ++RA ++
Sbjct: 191 -CHVDKLPVVTPQQLAAFMDELRQILPNTG--PLVTEGATTEVSQASLRGDIEKVRAAVA 247

Query: 176 C-FGEEFYNGSHDEWIPVVMAIHYETRGSA-EGKEIVREWCKLGRT--YDEKSFNAKWD 230
                    G+ + +     AI         E  EI  +WC        D     A W 
Sbjct: 248 ATPNTSAAFGTREAYRDFGYAIKAALPDDEPEAFEIFADWCARWEDGENDPDIVAADWR 306


>gi|48696649|ref|YP_024428.1| integrase [Vibrio phage VP2]
 gi|40950047|gb|AAR97638.1| integrase [Vibrio phage VP2]
          Length = 762

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 82/233 (35%), Gaps = 25/233 (10%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE--FQSCCGKP--ISRVGQAPKTL 63
            +     GI CG     V+A D+DV D +    F+N    +   GK     +        
Sbjct: 73  RFRGFNLGIACGKR-GGVFAVDIDVEDSKGNRGFDNLAILEEKYGKLVAPIQETPTGGRH 131

Query: 64  MLFRMQE---TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
            LF+  +   ++  K       +G  E        VA+         YTWS+      + 
Sbjct: 132 YLFQWDKYAKSSSGKIAKAIDTRGGDEDSCKSH-IVAWPSVRDEGE-YTWSMPT----LG 185

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           ++P +     +     +             R   +I +     RYT  +I   L     +
Sbjct: 186 DVPEIPKWISDALGVPWTGNM--------NRGSEEIDEDDLETRYTPRQIWRMLEYIDPD 237

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
                +DEW+ V+ A+H +     +G E+   W + G  Y     + +W SFD
Sbjct: 238 EL--EYDEWLAVLQAVHSQYP-DDQGYELADRWSQRGARYKPDEVSIRWQSFD 287


>gi|48696691|ref|YP_024985.1| putative integrase [Vibrio phage VP5]
 gi|40806154|gb|AAR92072.1| putative integrase [Vibrio phage VP5]
          Length = 762

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 82/233 (35%), Gaps = 25/233 (10%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE--FQSCCGKP--ISRVGQAPKTL 63
            +     GI CG     V+A D+DV D +    F+N    +   GK     +        
Sbjct: 73  RFRGFNLGIACGKR-GGVFAVDIDVEDSKGNRGFDNLAILEEKYGKLVAPIQETPTGGRH 131

Query: 64  MLFRMQE---TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
            LF+  +   ++  K       +G  E        VA+         YTWS+      + 
Sbjct: 132 YLFQWDKYAKSSSGKIAKAIDTRGGDEDSCKSH-IVAWPSVRDEGE-YTWSMPT----LG 185

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           ++P +     +     +             R   +I +     RYT  +I   L     +
Sbjct: 186 DVPEIPKWISDALGVPWTGNM--------NRGSEEIDEDDLETRYTPRQIWRMLEYIDPD 237

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
                +DEW+ V+ A+H +     +G E+   W + G  Y     + +W SFD
Sbjct: 238 EL--EYDEWLAVLQAVHSQYP-DDQGYELADRWSQRGARYKPDEVSIRWQSFD 287


>gi|46202140|ref|ZP_00053695.2| COG1197: Transcription-repair coupling factor (superfamily II
           helicase) [Magnetospirillum magnetotacticum MS-1]
          Length = 1185

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
             G G+L         A D+DV   +  D  +   +   G    R+G  PK L ++   E
Sbjct: 62  KYGIGVL----ALATPAIDIDVRHPEAADEIDAAAERILGPAPVRIGAWPKRLRVYSGPE 117

Query: 71  T-----------NLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPHALK 118
                             ++     ++E L+ G  QFVA  IHP T + Y W        
Sbjct: 118 DMPYTSVGECAFPGDDTAAKGYKWHNVEVLSGGGKQFVAAAIHPGTGKPYQWPSGDLLAW 177

Query: 119 VEE-LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT-----NIEIRA 172
             + L  +T + VE F      I           + +           T        +  
Sbjct: 178 PHDRLTAITAEMVEAFLAEVRVILARHGAVSKGGRSAITSGGDRRTSVTGNNVGLSRVAE 237

Query: 173 FLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
            L+       +  + +W+    A+        +G ++ R+W +    YD       W  
Sbjct: 238 ALAHVPN---DADYHDWVRYAYALKGAF--GEDGFDLWRDWSERSDKYDADYTETTWAG 291


>gi|291569389|dbj|BAI91661.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 908

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/171 (14%), Positives = 48/171 (28%), Gaps = 15/171 (8%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
           ++      G+G+  G  +  + A D D                         G+  +   
Sbjct: 54  EISKGRAKGYGLRTGKVSGGIVAIDADG---HKAHELAESLGGLPPTVSFTSGKEGRAQY 110

Query: 65  LFRMQETNLKKQ---------KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
           L+ + +T   K          KS +  +  LE    G Q V           Y W  +P+
Sbjct: 111 LYLIPDTYWDKITTKKLPTGHKSSDGKEELLELRWDGCQSVLPPSKHPETGEYKWLKSPN 170

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT 166
            + + + PL     +    +            +S    + + K       T
Sbjct: 171 EIDIAQAPL---WVINKMLKETPQPMPLVVLPESIPLEACLTKDDRQLLKT 218


>gi|158522714|ref|YP_001530584.1| bifunctional DNA primase/polymerase [Desulfococcus oleovorans Hxd3]
 gi|158511540|gb|ABW68507.1| Bifunctional DNA primase/polymerase [Desulfococcus oleovorans Hxd3]
          Length = 746

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
                 +     GI  G  +    A D+D+ D     +   +      K +++       
Sbjct: 67  KKWWSRWPDANIGIRTGKES--FIAIDIDLPDGPDNMKKLEKTYGNLPKTVNQKTGGGGY 124

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
            + F+       +   +  + G+++    G   VA        + Y W  +P ++++  +
Sbjct: 125 QLFFK---PPHTRIPCKTGLLGNIDIRGEGGYVVAPPSDHIKNKKYKWRHSPDSIEIAGM 181

Query: 123 PLLTPDEVEY--FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           P    D +E    +           + K    L++I  S         EI   L    + 
Sbjct: 182 PEWLTDLIEKGEKYCDLVHSLKKIPEGKRNDTLAEIAGSLRGEGRELDEIHGVLRKANKN 241

Query: 181 FYNGSHDE 188
               + ++
Sbjct: 242 RCTPALED 249


>gi|254453953|ref|ZP_05067390.1| Bifunctional DNA primase/polymerase, N-terminal domain family
           [Octadecabacter antarcticus 238]
 gi|198268359|gb|EDY92629.1| Bifunctional DNA primase/polymerase, N-terminal domain family
           [Octadecabacter antarcticus 238]
          Length = 516

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 27/234 (11%), Positives = 59/234 (25%), Gaps = 26/234 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV--DRFNNEFQSCCGKPISRVGQA 59
           V            G+ C      +   D D              +          R  + 
Sbjct: 63  VKKWWTETPTANIGLAC--AASGIVVVDPDTYKPTFAWDQFRVEKGIDVIKTLTQRSAR- 119

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                +F  Q       K    +   ++    G   +A +      + Y W    +   +
Sbjct: 120 GGWHYIFAAQAD----TKYPGSLAVEVDVKHKGYIMLAPSKF--EGKVYAW---HNDDDI 170

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
            + P                    R+      ++ ++  +  +      + R   +    
Sbjct: 171 ADAPDW-----------IKAKAPVRNVATIAPQVDELTIADVSGPMFVEQARIDKALDAI 219

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK-SFNAKWDSF 232
                 + +W+ V M + +ET G   G  +  +W +    Y        +W  F
Sbjct: 220 PAAELDYGDWVKVGMGLCHETMGEESGLALWDQWSRQDPRYKGGDDLAKRWAKF 273


>gi|284050056|ref|ZP_06380266.1| hypothetical protein AplaP_01145 [Arthrospira platensis str.
           Paraca]
          Length = 706

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 25/171 (14%), Positives = 48/171 (28%), Gaps = 15/171 (8%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
           ++      G+G+  G  +  + A D D                         G+  +   
Sbjct: 54  EISKGRAKGYGLRTGKVSGGIVAIDADG---HKAHELAESLGGLPPTVSFTSGKEGRAQY 110

Query: 65  LFRMQETNLKKQ---------KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
           L+ + +T   K          KS +  +  LE    G Q V           Y W  +P+
Sbjct: 111 LYLIPDTYWDKITTKKLPTGHKSSDGKEELLELRWDGCQSVLPPSKHPETGEYKWLKSPN 170

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT 166
            + + + PL     +    +            +S    + + K       T
Sbjct: 171 EIDIAQAPL---WVINKMLKETPQPMPLVVLPESIPLEACLTKDDRQLLKT 218


>gi|85703049|ref|ZP_01034153.1| hypothetical protein ROS217_19947 [Roseovarius sp. 217]
 gi|85671977|gb|EAQ26834.1| hypothetical protein ROS217_19947 [Roseovarius sp. 217]
          Length = 791

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 79/217 (36%), Gaps = 35/217 (16%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
            Y   G G+  G+    +   D+DVLD               G+ + RVG  PK L+++R
Sbjct: 77  RYASCGIGLRTGL----LVGIDIDVLDPDRAHDVQALAVRRFGETLVRVGCWPKRLLIYR 132

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE--ELPLL 125
            +    K +         +E L  GQQFVA+ IHP T R Y W +    L V   +LP++
Sbjct: 133 TEIPFAKMKSG------QVEILGQGQQFVAFGIHPGTGRPYAWPLGETPLDVALSDLPVI 186

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
              E+  F    +        +   R+       H  R    +                 
Sbjct: 187 DHTEIAAFLAEIEPTDHRSITDAGGRRRKAAGFGHPVRDAQGV-------------VTDG 233

Query: 186 HDEWIPVVMAIH--YETRGSAEGKE-------IVREW 213
            D W+ + +A H  ++   + +  +       + + +
Sbjct: 234 RDAWLSL-IAFHAVHDLLEAEDALDVDQLAAQVWQRF 269


>gi|85703019|ref|ZP_01034123.1| hypothetical protein ROS217_19797 [Roseovarius sp. 217]
 gi|85671947|gb|EAQ26804.1| hypothetical protein ROS217_19797 [Roseovarius sp. 217]
          Length = 1012

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 77/206 (37%), Gaps = 28/206 (13%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
            Y   G G+  G+    +   D+DVLD               G+ + RVG  PK L+++R
Sbjct: 77  RYASCGIGLRTGL----LVGIDIDVLDPDRAHDVQALAVRRFGETLVRVGCWPKRLLIYR 132

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE--ELPLL 125
            +    K +         +E L  GQQFVA+ IHP T R Y W +    L V   +LP++
Sbjct: 133 TEIPFAKMKSG------QVEILGQGQQFVAFGIHPGTGRPYAWPLGETPLDVALSDLPVI 186

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
              E+  F    +        +   R+       H  R    +                 
Sbjct: 187 DHTEIAAFLAEIEPTDHRSITDAGGRRRKAAGFGHPVRDAQGV-------------VTDG 233

Query: 186 HDEWIPVVMAIH--YETRGSAEGKEI 209
            D W+ + +A H  ++   + +  ++
Sbjct: 234 RDAWLSL-IAFHAVHDLLEAEDALDV 258


>gi|254517351|ref|ZP_05129408.1| Primase C terminal 2 family protein [gamma proteobacterium NOR5-3]
 gi|219674189|gb|EED30558.1| Primase C terminal 2 family protein [gamma proteobacterium NOR5-3]
          Length = 703

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 17/234 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +    + Y  +   +L       +   D D  D       +   +S    P   V  A  
Sbjct: 46  IRHHFNKYPNHELAVLL---NDELLVLDADTPDAVSA--LHQLLKSYEITPTLSVNSARG 100

Query: 62  TLMLFRMQETNLKK--QKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
             +  R       K    +++     ++    G+   A+   P T ++          +V
Sbjct: 101 CHVYLRRASGTYAKSDAPNKDANPAAIDIK-TGRAITAFP--PSTGKS---IDVDEIERV 154

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
            +LP +    ++  +            +++      +  S +   +    I   L+    
Sbjct: 155 SDLPEVDQVFIDAVYRHNGRDAPRPLSKQTPPATVLVPLSSSELEHKRTRIAELLAHIDP 214

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE-KSFNAKWDSF 232
              +  + +W+ + +AI+ E  G+  G ++  EW   G  Y    +   KW  F
Sbjct: 215 ---DTGYHDWLRIGIAIYVELEGAPVGFQLFDEWSAKGTKYPGTAALQDKWGKF 265


>gi|254504141|ref|ZP_05116292.1| hypothetical protein SADFL11_4180 [Labrenzia alexandrii DFL-11]
 gi|222440212|gb|EEE46891.1| hypothetical protein SADFL11_4180 [Labrenzia alexandrii DFL-11]
          Length = 1293

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 97/255 (38%), Gaps = 27/255 (10%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC-GKPISRVGQAPK 61
           A DV  + + G GI  G G H + A D+DV+D  +   F +  +  C   P  R+G++PK
Sbjct: 133 ALDVLQH-HGGAGITLG-GHHNIAAIDMDVMDPVLAAEFESVLELLCDKSPFERIGKSPK 190

Query: 62  TLMLFRMQETNLKKQKSEEKI---QGHLEFLAYGQQ-FVAYNIHPKTQRAYTWSIAP-HA 116
            L L+R ++        E      +  +E  A   Q  V Y +H  T+R YTW  A  + 
Sbjct: 191 KLWLYRTEKPIKSYASGEWFTDSGKNQVELRAQSNQFIVCYGVHKDTKRPYTWPNASLYD 250

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLS----------KIWKSHNNRRYT 166
             V ++PL++ D +    E FD +      +   +K +              SH     T
Sbjct: 251 CDVSDIPLISADALIDMLEVFDGMAARHGAKGIAKKQNRGAVPVGLAEANRNSHRLEDTT 310

Query: 167 NIE-IRAFL------SCFGEEFYNGSHDEWIPVVMAIHYETR-GSAEGKEIVREWCKLGR 218
            +E   AF+        F        +  W   + +I        A  + +  +      
Sbjct: 311 PLEDAVAFIVECAEGDFFDPPEELLGYHGWTNSIASIVNSVPHDRALAESLAHDISAALP 370

Query: 219 TYD-EKSFNAKWDSF 232
            Y+        +DS+
Sbjct: 371 GYEGPDDVQKTFDSY 385


>gi|62362410|ref|YP_224275.1| hypothetical protein LPPPVgp44 [Listonella phage phiHSIC]
 gi|58220032|gb|AAW67544.1| putative phage protein [Listonella phage phiHSIC]
          Length = 815

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 68/219 (31%), Gaps = 32/219 (14%)

Query: 19  GIGTHPVYAFDVDVLDEQVVDRFNNEFQSC-----CGKPISRVGQAPKTLMLFRMQETNL 73
           G         D+D  ++          +                      + F+  E   
Sbjct: 67  GALVGGYLVIDIDPRNDGDNSY-EQLCKDTNTDYEKESSFVVFTGGGGKHIYFKAPEG-- 123

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYF 133
            + KS+      ++F + G   V      K+   Y  SI      + E P    + +E  
Sbjct: 124 VQLKSKLGQYNGVDFKSSG-FVVGAGSLHKSGLLYE-SIKGAPSDISEPPKKLVELLE-- 179

Query: 134 FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV 193
                                    S    +    +I+  L C   +     +++W+ + 
Sbjct: 180 ---------------KKVNPKNSAFSLPEDKVDQQKIQDMLDCIDPDC---DYEDWLHIG 221

Query: 194 MAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           MAIH ET G  EG ++   W   G  Y++K  + KW SF
Sbjct: 222 MAIHDETCG--EGFDLWDAWSSNGSKYNQKEMDFKWHSF 258


>gi|254480931|ref|ZP_05094177.1| Primase C terminal 2 family protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038726|gb|EEB79387.1| Primase C terminal 2 family protein [marine gamma proteobacterium
           HTCC2148]
          Length = 657

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 67/234 (28%), Gaps = 18/234 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA     +      I+ G     +   D D  + +              K I R  +   
Sbjct: 63  VARYWRKHPKYDVAIVVGPR---IIMLDADTPEAEARLHEIEAAHDLTPKIIVRTSR--G 117

Query: 62  TLMLFRMQETNLKKQKSEEKI--QGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
               F + +  + K    +       ++  A     +     P T +++       A  +
Sbjct: 118 LHHYFGLADGVIAKADGLDSKSNPTGIDIRAGESLAIVP---PSTSKSFEL---CEANSL 171

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
           E+L ++  + V+                 +         +          I+  LS    
Sbjct: 172 EDLGVVGQNFVDAIVRNNGRKPASPPATSTPPASLPAPITTLTNAEE-ARIQNLLSHLEP 230

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK-SFNAKWDSF 232
           +        W  V MA+H+ T G   G ++  +W   G+ Y  +      W  F
Sbjct: 231 DLCYQD---WSHVGMAVHHATGGGQIGLDLFDQWSSGGKKYIGRHDIQNAWKYF 281


>gi|168703469|ref|ZP_02735746.1| hypothetical membrane protein [Gemmata obscuriglobus UQM 2246]
          Length = 901

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/240 (12%), Positives = 60/240 (25%), Gaps = 21/240 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVG--QA 59
           V T    +     G+  G  +  V A DVD              +   G  + R    + 
Sbjct: 71  VGTWWAAWPEANVGVALGPES-GVVAIDVDT------KAGEQLVKELAGDAVERTVLFRT 123

Query: 60  PKTL-MLFRMQETNLKKQKSEE---KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
            K   +L+ +         +          + F + G Q V       +   Y W     
Sbjct: 124 GKGHRLLYAVPADLPAPPVTRVVQLGGSEAVRFQSTGGQCVMPPSLHPSGSFYEWVEGRD 183

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
                  P+  PD +       ++        +      K +    +     +E   F  
Sbjct: 184 LAACPVAPM--PDWLIAEMCRPNSPEWTDQGAREAFLEGKDFNRDADWYRDVLEPAGFTP 241

Query: 176 CFGEEFYNGSHDEWIPVVMAI---HYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
                             +++   HY  R  +    +   +       D      K+ +F
Sbjct: 242 AGQANGVMRFTRPGKRAGISVTVGHYRARDGSPALYV---FSGSIPGLDAGRCYDKFGAF 298


>gi|150396564|ref|YP_001327031.1| hypothetical protein Smed_1346 [Sinorhizobium medicae WSM419]
 gi|150028079|gb|ABR60196.1| hypothetical protein Smed_1346 [Sinorhizobium medicae WSM419]
          Length = 793

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 83/231 (35%), Gaps = 25/231 (10%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGK--PISRVGQ 58
           +   +  +  +   G+L G     + A DVD  D  + D+      +  G      RVG+
Sbjct: 49  IDGYLRKHADHRNTGVLTG----DIVAVDVDAPDAAIADQLIARLMAIPGAKRAPYRVGK 104

Query: 59  APKTLMLFRMQETNLKKQKSE---EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSI-AP 114
           APK L +F+  E   K    E      +  +E L  GQQFVAY  H +T   Y WS   P
Sbjct: 105 APKCLFIFKATEPRRKASTGEYLIGGSKCQVEILGQGQQFVAYGNHAETGLPYVWSNGEP 164

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
            ++ + +LP +TPD V+ F    D I          +            R        F 
Sbjct: 165 LSIPLHDLPEITPDAVDAFLADADAILAKAGTPMKKKSE---------PRQQGRGADTFW 215

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
                   + + D W+P   ++    R    G    R   K      E+  
Sbjct: 216 QRVNSAALD-NTDRWVP---SLFSSARK-EAGTGAWRITSKELGRDLEEDL 261


>gi|92118040|ref|YP_577769.1| hypothetical protein Nham_2527 [Nitrobacter hamburgensis X14]
 gi|91800934|gb|ABE63309.1| hypothetical protein Nham_2527 [Nitrobacter hamburgensis X14]
          Length = 756

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 62/224 (27%), Gaps = 30/224 (13%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLD-EQVVDRFNNEFQSC-CGKPISRVGQAPKTLMLFRMQ 69
              G      ++     D+D        D      +          +       + FR  
Sbjct: 95  GNVGFR---MSNTDLVIDIDPRRFPDSDDVLARFLRDFDLPAHPFVLTGGGGYHLYFRKP 151

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPD 128
             ++   + E       EF   G   V+    HP T R Y +   P    + E P++   
Sbjct: 152 AEDI--VRYEHDNYPGFEFRTSGHYVVSAGSVHPDTGRLYRFDDDPLRCSLSEAPMMPDR 209

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
            ++                   RK +    S          +  +L       +     +
Sbjct: 210 LLDAI-----------------RKPNIEASSDEAGALDPETLAEWLVDVDPTEF-KDQRK 251

Query: 189 WIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE--KSFNAKWD 230
           W  ++MA H+ T G   G +    W      Y +  +    +WD
Sbjct: 252 WQDMMMACHHATNG--TGVDEFIVWSTSDPEYSDYSEVIRQRWD 293


>gi|168702949|ref|ZP_02735226.1| hypothetical membrane protein [Gemmata obscuriglobus UQM 2246]
          Length = 805

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 30/240 (12%), Positives = 60/240 (25%), Gaps = 21/240 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVG--QA 59
           V T    +     G+  G  +  V A DVD              +   G  + R    + 
Sbjct: 71  VGTWWAAWPEANVGVALGPES-GVVAIDVDT------KAGEQLVKELAGDAVERTALFRT 123

Query: 60  PKTL-MLFRMQETNLKKQKSEE---KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
            K   +L+ +         +          + F + G Q V       +   Y W     
Sbjct: 124 GKGHRLLYAVPADLPAPPATRAVKLGGSEAVRFQSTGSQCVMPPSLHPSGNFYEWVEGRD 183

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
                  P+  PD +       ++        +      K +    +     +E   F  
Sbjct: 184 PAACPVAPM--PDWLVAEMCRPNSPEWTDQGAREAFLEGKDFNRDADWYRDILEPAGFTP 241

Query: 176 CFGEEFYNGSHDEWIPVVMAI---HYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
                             +++   HY  R  +    +   +       D      K+ ++
Sbjct: 242 AGQANGVMRFTRPGKRSGISVTVGHYRARDGSPALYV---FSGSIPGLDAGRCYDKFGAY 298


>gi|86158263|ref|YP_465048.1| hypothetical protein Adeh_1839 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774774|gb|ABC81611.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 751

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 68/228 (29%), Gaps = 31/228 (13%)

Query: 10  VYNGFGILCGIGTHPVYAFDVD-VLDEQVVDR--FNNEFQSCCGKPISRV--GQAPKTLM 64
              G G +       V   D D  LD             +   G  + R   G+    L 
Sbjct: 67  PQAGVGFVF-QRKLGVVFIDFDHCLDTSGALLPWAAPLLEPFRGTYVERSLSGRGLHVLA 125

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L  +     K          H+E  +  +          T   Y  + A    K +EL  
Sbjct: 126 LGSVPHAFSKLVPPAAAGDEHIEVYSEKRYAAI------TGDTYDGAPAELLDKQKELDA 179

Query: 125 LTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG 184
           L                      K+    ++  +          +IR+ L        + 
Sbjct: 180 LLRAL----------------APKATVAATRSDEHVPLSAQEVDKIRSALDAIDP---DV 220

Query: 185 SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            HDEW+ V MA+H+   GSAEG  +  EW   G  Y       +W SF
Sbjct: 221 GHDEWLRVGMALHFGFEGSAEGLALWNEWSAGGGKYKNGEPADRWRSF 268


>gi|291335469|gb|ADD95081.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C348]
          Length = 231

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/162 (16%), Positives = 48/162 (29%), Gaps = 17/162 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTH---PVYAFDVDVLDEQVVDRFNNEFQS-----CCGKPI 53
           +A +++  V    G+L G   +        D+D +   V  +                  
Sbjct: 52  IAREIEEGVCKAVGLLGGPVYNEPYGFVWVDIDGI--TVYKKIEELAGEPVAKALPPTLT 109

Query: 54  SRVGQAPKTLMLFRMQETNLKK------QKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
              G+  +   L+R+ +    K          E  +  LE L    Q V   +HPKT   
Sbjct: 110 ICSGREGRERKLYRVPKQLWDKFIRNKYCWHAEGNREKLEVLWKRHQGVLMGMHPKTDGY 169

Query: 108 YTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKS 149
           YT         V  +P +    +        +    + K   
Sbjct: 170 YTKENEDFTF-VSNIPDIPAWLLTEIAIKIKSKVLLKKKPPG 210


>gi|27383370|ref|NP_774899.1| hypothetical protein bll8259 [Bradyrhizobium japonicum USDA 110]
 gi|27356545|dbj|BAC53524.1| bll8259 [Bradyrhizobium japonicum USDA 110]
          Length = 223

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 59/160 (36%), Gaps = 11/160 (6%)

Query: 8   HYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGK--PISRVGQAPKTLM 64
           +Y      G+LCG     +   DVD  D +  D          G      R+G+APKTL 
Sbjct: 51  NYPDATNTGLLCG----ELVGLDVDTPDAETADAIRAMVMELPGSDRAPYRMGKAPKTLF 106

Query: 65  LFRMQETNLKKQKSEE---KIQGHLEFLAYGQQFVAYNIHPKTQRAYTW-SIAPHALKVE 120
            FR  E   K+          +  +E      QFVA+  HP T R Y W + +P    + 
Sbjct: 107 AFRATEPREKRATGAYLINGAKCQVEAFGERTQFVAFGTHPDTGRPYEWFNGSPAETPLA 166

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
           ELP +TP+ ++      +     R         +      
Sbjct: 167 ELPEITPEAIDELLARAEAYFAERGTLIKPASKASDRGPV 206


>gi|323139650|ref|ZP_08074692.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
 gi|322395082|gb|EFX97641.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
          Length = 265

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/194 (10%), Positives = 46/194 (23%), Gaps = 15/194 (7%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVL-DEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
             + +     GI+ G  ++ +   DVD      +  +            +  V       
Sbjct: 54  WFERWPDANIGIVTGEVSN-LIVLDVDPKHGGDIALKQLERRYRPLPPTVEAVTGGGGRH 112

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
             F          ++   +   ++    G   VA      + R Y W+      ++   P
Sbjct: 113 FYFTHPG---FLTRNRAGLAQGVDLRGDGGYIVAPPSVHPSGRPYQWASGHGPDEIALAP 169

Query: 124 LLTPDEVEYFFEFFD-------TITTPRDKEKSYRKLSKIWKSHNNRRYTNI--EIRAFL 174
            L    +                        +  R  S    + +   +          L
Sbjct: 170 -LPRWLLTTIHGARAGRSLNDWRQLVQEGVAEGQRNSSIASLTGHLLWHNVNPGVALELL 228

Query: 175 SCFGEEFYNGSHDE 188
             + +       D+
Sbjct: 229 LAWNKARCRPPLDD 242


>gi|291336073|gb|ADD95660.1| hypothetical protein [uncultured phage MedDCM-OCT-S11-C349]
          Length = 633

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 49/175 (28%), Gaps = 23/175 (13%)

Query: 66  FRMQETNLKKQKS---EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
           FR+ E      K     ++  G  E L  G+Q V Y  +P   +            + ++
Sbjct: 2   FRVPEELWADVKGHGLRKEDGGDYEILW-GRQGVVYGAYPG-GKVSKPGQYRLQGDLTDI 59

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
           P      +               ++       K     +  +    +I         +  
Sbjct: 60  PTAPDWLLAEM------------RQPPRSINKKELDFTDRTQDEIAQIIFECLTVISQQG 107

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY-----DEKSFNAKWDSF 232
            G+ D W+ + MAIH        G  +   W      Y     +       W SF
Sbjct: 108 KGTRDHWVKIGMAIHSALPT-DMGLHLWASWSCEDPDYASEWENSNPCEEVWYSF 161


>gi|225575522|ref|ZP_03784132.1| hypothetical protein RUMHYD_03614 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037272|gb|EEG47518.1| hypothetical protein RUMHYD_03614 [Blautia hydrogenotrophica DSM
           10507]
          Length = 616

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 37/126 (29%), Gaps = 9/126 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE---QVVDRFNNEFQSC--CGKPISRV 56
           + T  +    +  GI  G  +  +   D+D+ +E      +      +      +    +
Sbjct: 52  IETWWNINPQHNIGIATGSRSGGLVVIDLDIDEEKGKNGYETLKEWQKEHGDLPETWISI 111

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                    +R         K++  +   ++    G   VA          Y W   P  
Sbjct: 112 TGNGGYHYFYRDTAA----NKNKVALYDGVDIRGEGGYIVAPPSIHPNGHTYEWEQEPGE 167

Query: 117 LKVEEL 122
            ++ ++
Sbjct: 168 YEIAQV 173


>gi|170751546|ref|YP_001757806.1| bifunctional DNA primase/polymerase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658068|gb|ACB27123.1| Bifunctional DNA primase/polymerase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 289

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 43/192 (22%), Gaps = 8/192 (4%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVL-DEQVVDRFNNEFQSCCGKPISRVGQA 59
           +V            G+  G         DVD                    +    +   
Sbjct: 66  IVRAWFTSAPQANIGMATGT----TVVLDVDPRHGGDASLEALEAEHGPLPETTRALTGG 121

Query: 60  PKTLMLFRMQETNLKKQK--SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
               +LFR       +     +  +   L+    G   VA +    + R Y WS+  H  
Sbjct: 122 GGQHILFRAPADVEIRNSAGDQGGLAPGLDIRGAGGYIVAPSSRHASGRYYAWSVDHHPD 181

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            V     +    V+      +        E        +     N   + +         
Sbjct: 182 DVPPA-EMPDWLVQALSRTGEGAAARDPSEWRNLVAEGVVDGGRNVAVSKLTGHLLRRYV 240

Query: 178 GEEFYNGSHDEW 189
             E  +     W
Sbjct: 241 DPEVAHELVQAW 252


>gi|260892768|ref|YP_003238865.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
 gi|260864909|gb|ACX52015.1| Bifunctional DNA primase/polymerase [Ammonifex degensii KC4]
          Length = 599

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 27/225 (12%), Positives = 50/225 (22%), Gaps = 18/225 (8%)

Query: 7   DHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLF 66
           + +     G++ G  +  V   D+D  D     R           P+ R G+       F
Sbjct: 69  EKWSSANLGLVTGRVS-GVVVVDLDGEDGVRAVRER---GGLPPTPVVRTGK--GWHYYF 122

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
              E       +   +   ++    G   V       T R Y W+      +V   P   
Sbjct: 123 AYPE---VVVPTRAGVLPGVDVRGDGGLAVLPPSLHPTGRRYEWARGRSPWEVPLAPC-P 178

Query: 127 PDE--VEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR-AFLSCFGEEFYN 183
                +                ++       +       R      R A         + 
Sbjct: 179 EWLLGLVRGRGEGGDDGGVAGADRPRLDPLAVLAGVEEGRRDMTLFRYACRLRAQGLSWE 238

Query: 184 GSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
            +    +    A           K +   W      Y   +    
Sbjct: 239 EARALVLTAAAACRPPFPEREALKCLRSAW-----KYPPGTVRRV 278


>gi|254497903|ref|ZP_05110668.1| putative truncated Phage / plasmid primase P4 [Legionella
           drancourtii LLAP12]
 gi|254352901|gb|EET11671.1| putative truncated Phage / plasmid primase P4 [Legionella
           drancourtii LLAP12]
          Length = 301

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 36/132 (27%), Gaps = 11/132 (8%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
            +  + +   GI+ G  ++ +   DVD  +     R  +            V  A     
Sbjct: 79  WLQKWPWANVGIVTGNISN-LLILDVDGGEGINSLRGLDL-----PVSPIVVT-ARGHHY 131

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
            F           +   +  +++    G    A     +T   Y WS         +LP 
Sbjct: 132 YFNCPSILSNVSTTRSGLLSNVDTRGRGGYITAPPSIHETGHQYYWSEPLDG----DLPD 187

Query: 125 LTPDEVEYFFEF 136
                ++     
Sbjct: 188 APEWLIQRLLPP 199


>gi|37626216|gb|AAQ96591.1| putative integrase [Vibrio phage VP16C]
          Length = 791

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/246 (12%), Positives = 64/246 (26%), Gaps = 41/246 (16%)

Query: 4   TDVDH--YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG--KPISRVGQA 59
            +++   +  +  G+        V   D+D       +                 +  Q+
Sbjct: 38  AELNALPWPSDIVGV---PIPSGVVVLDLDTYKGITREYVEAGAGFAIPWDAAHIQTTQS 94

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQ-----GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP 114
                 FR     +K   + +  +       L+  + G+ ++A      T   Y      
Sbjct: 95  GGQHYAFRAPNWPVKNISNAKHNETGVQFEGLDVRSAGKGYIA------TGEPYYTPTHL 148

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
                   P + P   E    + + +                 +           IR  L
Sbjct: 149 GGALAMAFPQMLPPLPEGLRPWLEAVAHE------------SSERVEVTDEDAKTIREAL 196

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG--------RTYDEKSFN 226
                     + +EW+ V +++        +G  +  EW              Y  +   
Sbjct: 197 RHIDP---GETREEWVKVGLSLKSGFGDDPQGLSLFDEWSSGALWRDGDEPANYVPEHIE 253

Query: 227 AKWDSF 232
            +WDSF
Sbjct: 254 TQWDSF 259


>gi|238063625|ref|ZP_04608334.1| bifunctional DNA primase/polymerase [Micromonospora sp. ATCC 39149]
 gi|237885436|gb|EEP74264.1| bifunctional DNA primase/polymerase [Micromonospora sp. ATCC 39149]
          Length = 291

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 43/173 (24%), Gaps = 9/173 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA  +D        +  G  +      DVD              +    +    V  +  
Sbjct: 64  VAAIIDAVPRGQLALRTGAAS-GTVVVDVDPRHGGHHSMAALITEGLLPRTRYAVTGSNG 122

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +R   T           +  ++  A G   V     H +T R Y W+   H     
Sbjct: 123 LHLYYRHPGT--SVISRPMPGRYGIDIKADGGYVVLPPSRHQRTGRPYRWADGEH----- 175

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
           +L  + P  ++          +   +         I             + A 
Sbjct: 176 DLTEMAPALLDACQAAPTRTVSDTTRSTRTPGGGAISSPDALLASILATVAAA 228


>gi|307592387|ref|YP_003899978.1| primase 2 [Cyanothece sp. PCC 7822]
 gi|306986032|gb|ADN17912.1| Primase 2 [Cyanothece sp. PCC 7822]
          Length = 1087

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/154 (12%), Positives = 42/154 (27%), Gaps = 16/154 (10%)

Query: 2   VATDVDHYVYNGFGILCGIG------THPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +  ++      GFG++ G+       ++ + A D D      +       +         
Sbjct: 64  IKGEIKKLQLGGFGVITGLPVTVEGISYYLMALDQDGESAIAIIDQLGNGKGVPPTVAFT 123

Query: 56  VGQAPKTLMLFRMQ---------ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQR 106
            G+  +   LF +          +     Q  ++     LEF     Q V          
Sbjct: 124 SGRPGRCQYLFLVPSFYKDLIRTKKLKTAQTGDDDKPEQLEFRFANMQSVLPPSIHPVTG 183

Query: 107 AYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTI 140
            Y W       +V  + +  P  +         +
Sbjct: 184 VYHWIEGAALGEVP-IAIAPPWVISQMLINMSRL 216



 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 30/86 (34%), Gaps = 4/86 (4%)

Query: 147 EKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           + + +K       H+N         ++L+       +  +D+W+ V MA+H         
Sbjct: 324 QSTPQKRLTNNNGHHNFWSNVDWALSYLNALSPFRAD-DYDDWLTVGMALHSV---DDSL 379

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDSF 232
            +    W +    Y       KW SF
Sbjct: 380 LKEWDNWSRSSSKYKPGECEKKWKSF 405


>gi|291335538|gb|ADD95149.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C491]
 gi|291335654|gb|ADD95261.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C846]
          Length = 185

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 45/146 (30%), Gaps = 9/146 (6%)

Query: 2   VATDVDHYVY-NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           VA  V         G+  GI  + +   DVD     +    N    S    PI    +  
Sbjct: 26  VALAVKRNPDLQAVGVFTGIRGNGIVILDVD---RNLSKYLNAWGSSLDNAPIITSTKTN 82

Query: 61  KTLMLFRMQETNLKKQKS---EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
               LFR+ E      K     ++  G  E L  G+Q V Y  +P   +           
Sbjct: 83  AAKYLFRVPEELWADVKGHGLRKEDGGDYEILW-GRQGVVYGAYPG-GKVSKPGQYRLQG 140

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTP 143
            + ++P      +    +   +I   
Sbjct: 141 DLTDIPTAPDWLLAEMRQPPRSINKK 166


>gi|85709926|ref|ZP_01040991.1| primase, putative [Erythrobacter sp. NAP1]
 gi|85688636|gb|EAQ28640.1| primase, putative [Erythrobacter sp. NAP1]
          Length = 774

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 68/229 (29%), Gaps = 36/229 (15%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLD-------EQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
              G+            D D  +          V+          G P  R G       
Sbjct: 70  GNVGVRLRDTD---LVIDWDPRNDSGQWSMGDYVEFILRNGLDPTGWPTVRTGSGGLHHY 126

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L   +  +L+  +  E     +EF   G+Q VA      T   Y W      + +   P 
Sbjct: 127 L--TKLADLRIVERPEGYPS-IEFKTVGRQVVAPGSIHPTGELYRWE--GEPVGMFGAPD 181

Query: 125 LTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG 184
                +E                 + R             Y+  E+ + L     E +  
Sbjct: 182 APDRLLE----------------SARRHSKPSTVPSRCGVYSPEELASMLDALDPEDFEE 225

Query: 185 SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE--KSFNAKWDS 231
             D W+ ++MA H+ T G   G+E   EW      Y +  +   ++WDS
Sbjct: 226 HAD-WLEIMMACHHATAGD--GREEFIEWSTSDPAYADHAEEIASRWDS 271


>gi|310828796|ref|YP_003961153.1| hypothetical protein ELI_3221 [Eubacterium limosum KIST612]
 gi|308740530|gb|ADO38190.1| hypothetical protein ELI_3221 [Eubacterium limosum KIST612]
          Length = 893

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 23/199 (11%), Positives = 51/199 (25%), Gaps = 22/199 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL-----DEQVVDRFNNEFQSCCGKPISRV 56
           +      +      +  G     +   D+DV      D     R          +    +
Sbjct: 44  INRWWSKWPDANIAMATGH---GMVVLDIDVDADRGVDGYDSLRLWESEFEALPETWMVL 100

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                    F+  +      ++   +   ++    G   +         RAY W      
Sbjct: 101 TGGGGIHYYFKTDKE----IRNRTGVLPGVDVRGDGGYVIVPPSIHPNGRAYEWEAVSFD 156

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK-------SHNNRRYTNIE 169
            KV   P+  P+++        T   P+ +        +          S   +  T+ E
Sbjct: 157 YKV---PVPLPEDLYALMVNNSTRDHPKFELPERIPEGERNDTLFRYAASLQGKGRTDFE 213

Query: 170 IRAFLSCFGEEFYNGSHDE 188
           I A +    ++  +     
Sbjct: 214 IMAIVQAANDQCCDVPLKP 232


>gi|328543326|ref|YP_004303435.1| Gp33 [polymorphum gilvum SL003B-26A1]
 gi|326413072|gb|ADZ70135.1| Gp33 [Polymorphum gilvum SL003B-26A1]
          Length = 779

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 75/227 (33%), Gaps = 29/227 (12%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLD-EQVVDRFNNEFQSC-CGKPISRVGQAPKTLMLFRMQ 69
              G+            DVD  +  +  D      +          V       + FR  
Sbjct: 94  RNVGVRLRDVD---LVLDVDPRNFAENDDPLTRLVRDFDLRDAPFVVTGGGGKHLYFRKP 150

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPD 128
                   +E      +EF + G+Q VA    HP+T R Y        +++ E P  +  
Sbjct: 151 AE--VAVVNELDAYRGVEFKSLGRQVVAAGSVHPETGRLYALDDDVLRMELSEAPEASEK 208

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
            +                     KLS     + +   T  ++   LS      YNG HDE
Sbjct: 209 LLRAI-----------------EKLSVGASENRSGEITAEQLARLLSKLDVMAYNGRHDE 251

Query: 189 WIPVVMAIHYETRGSAEGKEIVREWCKLGRTY--DEKSFNAKWDSFD 233
           W+ V+MA H+ T G  EG +    W      Y  DE     +W+S D
Sbjct: 252 WLKVMMASHHGTAG--EGVDEFVAWSTSDPDYAGDEARIRERWNSLD 296


>gi|312876298|ref|ZP_07736284.1| Bifunctional DNA primase/polymerase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796944|gb|EFR13287.1| Bifunctional DNA primase/polymerase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 277

 Score = 98.3 bits (243), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 43/146 (29%), Gaps = 4/146 (2%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V       ++   G+  G  +   +  DVD    +   R      S     + ++  +  
Sbjct: 63  VKEWWTKKLWANIGVATGKIS-GFFVIDVDGEIGKEELRSLELEHSKLPDTVEQLTGSGG 121

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +LF+          ++      ++  + G   V      K+   Y W    H  +V E
Sbjct: 122 KHILFKYPSD--VVIPNKVGFIPKVDIRSDGGYIVVAPSIHKSGNQYMWEALSHPFEV-E 178

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKE 147
           +       ++   E       P +  
Sbjct: 179 IAEPPNWLIDLIAEKPTGGKRPPEYW 204


>gi|281419521|ref|ZP_06250534.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
 gi|281406812|gb|EFB37077.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
          Length = 719

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 54/194 (27%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +        Y   GI  G  +  +   DVD   ++ +              ++ V  +  
Sbjct: 62  IRKWWTKTPYANIGIPTGEKSGWLV-LDVDDGGDETISALEAT-HGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  E      K++      L+  + G   V       +   Y W          +
Sbjct: 120 RHYIFKYPEGRSIPNKTK--FAPGLDTRSTGGLIVVAPSIHVSGNRYEWIKDHSPFDRTL 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      +   R  T   I A L
Sbjct: 178 AEAPEWLLKLMERVEVLLTPFEGSSIAAEIKEGSRNSTLTSLAGTMRVRGMTEESIYAAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|147677729|ref|YP_001211944.1| hypothetical protein PTH_1394 [Pelotomaculum thermopropionicum SI]
 gi|146273826|dbj|BAF59575.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 645

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/223 (11%), Positives = 52/223 (23%), Gaps = 23/223 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V      Y    + ++ G  +  V   D+D  + +   R     +      + R G+   
Sbjct: 63  VTQWRGKYPGCNWAVVTGKVS-EVVVLDMDGPEGEASLR----GKHIPPTWMVRTGK--G 115

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             + F+         +    I   ++    G   VA      + + Y W        + E
Sbjct: 116 RHIYFQWPGFP---VECRTGILPGVDIRGDGGYVVAPGSVHVSGKKYGWVDGLSPADMPE 172

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR-AFLSCFGEE 180
                   VE           P     S     ++       +      R A        
Sbjct: 173 PAEAPAWLVELL-------KRPGGNSSSKIDPVRVLAGVPEGQRDVTLFRYACRLRTQGL 225

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK 223
               +    +                 ++ + W      Y E 
Sbjct: 226 TREEALRLVLEAARNCTPPFPEREARLKVEQAW-----KYPEG 263


>gi|222528751|ref|YP_002572633.1| Bifunctional DNA primase/polymerase [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222455598|gb|ACM59860.1| Bifunctional DNA primase/polymerase [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 287

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 43/144 (29%), Gaps = 4/144 (2%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V        +   GI  G  +   +  DVD    +   R            + ++  +  
Sbjct: 70  VKEWWLKKPWANIGIATGKIS-GFFVLDVDGEIGKEELRALEVEYDKLPDTVEQLTGSGG 128

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +LF+  E      +++      ++    G   V      K+   Y W    H L+V E
Sbjct: 129 KHILFKYPEN--IVIQNKVGFIPKVDIRGDGGYIVVAPSIHKSGNQYMWEAFSHPLEV-E 185

Query: 122 LPLLTPDEVEYFFEFFDTITTPRD 145
           +       ++   E   T    R 
Sbjct: 186 IAEPPKWLIDMIAEKPSTPDGKRP 209


>gi|148555111|ref|YP_001262693.1| P4 family phage/plasmid primase [Sphingomonas wittichii RW1]
 gi|148500301|gb|ABQ68555.1| phage/plasmid primase, P4 family [Sphingomonas wittichii RW1]
          Length = 955

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 51/196 (26%), Gaps = 27/196 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV------------LDEQVVDRFNNEFQSCC 49
           +      +     G+L G+  + ++  D D             +D    +      +   
Sbjct: 84  IRGWWRKWPKAMIGLLTGV--NGLFVVDFDPGIETDPKTGEPIMDPVTGEPIEYTLEGLK 141

Query: 50  GKPISRVGQA------------PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVA 97
                ++G                  + FR  +      ++   +   ++    G   +A
Sbjct: 142 AVLCFQIGGPLPASLAVRTAGKGGVHVYFRQPDEGAD-IRNRNNLPHRIDVRGTGGYVIA 200

Query: 98  YNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
                 T R Y W      ++  E P    D +        +     +   S R    + 
Sbjct: 201 PPSVMDTGREYRWLHGDADVEPVEAPAALVDILRKPKGSAPSENVGANAPASSRPTVAVD 260

Query: 158 KSHNNRRYTNIEIRAF 173
           +  +        +R +
Sbjct: 261 RPTSEADAEEQALRRY 276


>gi|302873740|ref|YP_003842373.1| Bifunctional DNA primase/polymerase [Clostridium cellulovorans
           743B]
 gi|307690022|ref|ZP_07632468.1| Bifunctional DNA primase/polymerase [Clostridium cellulovorans
           743B]
 gi|302576597|gb|ADL50609.1| Bifunctional DNA primase/polymerase [Clostridium cellulovorans
           743B]
          Length = 893

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 54/190 (28%), Gaps = 12/190 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +  +   Y     G   G      +  DVD+      +      +        R G +  
Sbjct: 61  IIAEFKKYPKANIGFATG---DNYFVLDVDIGHG-GYESLKEYGE-LKKTLSVRTG-SGG 114

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           +   + M +       +   +   ++  + G   VA     K+ + Y W        V E
Sbjct: 115 SHHYYLMPDG--VTVPNRVGVLNGVDIRSNGGLVVAPGSVHKSGKHYEWLEHCSIDDV-E 171

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKL---SKIWKSHNNRRYTNIEIRAFLSCFG 178
           +       ++  F    ++    +  +   +    + I  S   +  +   I A L    
Sbjct: 172 ITTPDKWLIDLIFSKKSSVKEVPESIEEGSRNAVMASIAGSLRRKGLSFEAILAALLVEN 231

Query: 179 EEFYNGSHDE 188
               N   ++
Sbjct: 232 NNRCNPPLND 241


>gi|125974487|ref|YP_001038397.1| P4 family phage/plasmid primase [Clostridium thermocellum ATCC
           27405]
 gi|125714712|gb|ABN53204.1| phage / plasmid primase, P4 family [Clostridium thermocellum ATCC
           27405]
          Length = 717

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 49/194 (25%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V  +  
Sbjct: 60  IKKWWTKTPNANIGIPTGEKSGWLV-LDVD-DGGNETLSALEATHGKLPDTVTAVTGSGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   VA      +   Y W           
Sbjct: 118 RHYVFKYPQGRSIPNKTK--FVPGLDTRSTGGLIVAAPSIHVSGNRYEWIKDHSPFDRTP 175

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   +  +  R  +      +   R  T   I A L
Sbjct: 176 AEAPEWLLKLMEREEVLLTPFEGSSITAEIMEGSRNSTLTSLAGTMRARGMTEEGIYAAL 235

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 236 LAENNARCNPPLDE 249


>gi|281419011|ref|ZP_06250029.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
 gi|281407468|gb|EFB37728.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
          Length = 719

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 50/194 (25%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V  +  
Sbjct: 62  IKKWWTKTPNANIGIPTGEKSGWLV-LDVD-DGGNETLSALEATHGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   VA      +   Y W  A        
Sbjct: 120 RHYVFKYPQGRSIPNKTK--FVPGLDTRSTGGLIVAAPSIHVSGNRYEWIKAHSPFDRTP 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   +  +  R  +      +   R  T   I A L
Sbjct: 178 AEAPEWLLKLMEREEVLLTPFEGSSITAEIMEGSRNSTLTSLAGTMRARGMTEEGIYAAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|147678840|ref|YP_001213055.1| hypothetical protein PTH_2505 [Pelotomaculum thermopropionicum SI]
 gi|146274937|dbj|BAF60686.1| hypothetical membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 433

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 18/137 (13%), Positives = 33/137 (24%), Gaps = 8/137 (5%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
               +     G++ G  +  +   D+D            +       P    G   K   
Sbjct: 61  WFARWPDANLGVVTGQVS-GLVVVDLDGP---AAVEAVRDRGGLPPTPTVITG---KGYH 113

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
            + +      K  +       L+  A G   VA      + R Y W+       +   P 
Sbjct: 114 YYLVHPGQPTKNAAALGGIKGLDVRADGGYVVAPPSVHSSGRVYRWAKGRSPDDLPLAPC 173

Query: 125 LTPDEVEYFFEFFDTIT 141
                +E          
Sbjct: 174 -PAWFLEMLANRGRAQA 189


>gi|284031274|ref|YP_003381205.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
 gi|283810567|gb|ADB32406.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
          Length = 307

 Score = 95.2 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 18/171 (10%), Positives = 43/171 (25%), Gaps = 4/171 (2%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA  V+        +  G+ +  +   DVD              +    + +     +  
Sbjct: 69  VAAIVNAVPGGQLAVRTGMVS-GLLVVDVDPAHGGWESLSELVARQLVPRTLWVRTGSDG 127

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +R    ++  +      +  ++  A G   V     H +T+R Y W          
Sbjct: 128 AHLYYRHPGLHMPSRPMP--NRPGIDVKADGGYVVLPPSIHHRTRRPYAWGTGSDLADPA 185

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
            +  + P  +          +T                   +     +   
Sbjct: 186 AVVEMPPPLIAACLPATPAESTHAPSAPLSGPQRDTGGGGISHPDKLLTAH 236


>gi|229583958|ref|YP_002842459.1| Bifunctional DNA primase/polymerase [Sulfolobus islandicus M.16.27]
 gi|228019007|gb|ACP54414.1| Bifunctional DNA primase/polymerase [Sulfolobus islandicus M.16.27]
          Length = 865

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 27/234 (11%), Positives = 72/234 (30%), Gaps = 23/234 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFN-------NEFQSCCGKPIS 54
           +    ++   N   I+CG  +  +   D D  D ++ ++F           +      + 
Sbjct: 46  IKKWFENN-ENNIAIICGKVSGNLVVIDFD--DAEIYEKFLKEVEKDSELAEIINNTWLV 102

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP 114
           + G+     +  R+      K          ++    G   VA      + + Y +    
Sbjct: 103 KTGK--GYHIYLRIDIDKPVKI----GKLQKIDVKGEGGYVVAPPSIHPSGKTYEFVRFS 156

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
                 E+ ++T ++ +      + +T       +  +  +I         T + I   L
Sbjct: 157 KTTG-HEIRVITEEQYKKILTILENVT-ESTITDTAIEKGEIRHDKKLSENTILRIIDIL 214

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
           S   +E        ++     ++         K+++     L   + ++  N +
Sbjct: 215 SPVYKEGVRHDIVMYLS-GW-LYKAGIELESAKKLILL---LCDKFKDEECNDR 263


>gi|281419301|ref|ZP_06250316.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281406921|gb|EFB37184.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
          Length = 268

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 53/194 (27%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +    + + +      +  G+   
Sbjct: 62  IKKWWTKTPNANIGIPTGEKSGWLV-LDVDDGGDETLSALESTYGNLPDTVTAVTGR-GG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  E      K++       +  + G   V       +   Y W           
Sbjct: 120 RHYIFKYPEGRSIPNKTK--FASGFDIRSNGGLIVVSPSVHISGNRYEWIKDHSLFDRNP 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      +   R  T   I A L
Sbjct: 178 AEAPEWLLKLMERVEVLLTPFEGSSIAAEIKEGSRNSTLTSLAGTMRVRGMTEESIYAAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|153810985|ref|ZP_01963653.1| hypothetical protein RUMOBE_01376 [Ruminococcus obeum ATCC 29174]
 gi|149832873|gb|EDM87956.1| hypothetical protein RUMOBE_01376 [Ruminococcus obeum ATCC 29174]
          Length = 196

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 15/135 (11%), Positives = 36/135 (26%), Gaps = 9/135 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEF--QSCCGKPISRV 56
           +    D       GI  G  +  +   D+DV         D   +         +    +
Sbjct: 41  IERWWDKNPQYNIGIATGNKSSGLVVIDLDVDKNKGIDGYDVLRDWQNKHGKLPETWQSI 100

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                    ++    +  +      +   ++    G   VA          Y W   P  
Sbjct: 101 TGRGGYHYFYKDAIVHSNRV----GLYEGVDIRGEGGYIVAPPSVHPNGNIYEWEQGPEE 156

Query: 117 LKVEELPLLTPDEVE 131
            ++ ++  +  D ++
Sbjct: 157 YEIAQVDNIVNDFLK 171


>gi|281419305|ref|ZP_06250320.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
 gi|281406925|gb|EFB37188.1| phage/plasmid primase, P4 family [Clostridium thermocellum JW20]
          Length = 719

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 53/194 (27%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +              ++ V  +  
Sbjct: 62  IRKWWTKTPNANIGIPTGEKSGWLV-LDVDDGGDETISALEAT-HGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W           
Sbjct: 120 WHYVFKYPKGRSIPNKTK--FASGLDTRSTGGLIVVAPSIHVSGNQYQWLEGHSPFDRTP 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      S   R  T   I A L
Sbjct: 178 AEAPAWLLKLMERVEVLLTPFEGSSIIAEIKEGSRNSTLTSLAGSMRARGMTEESIYAAL 237

Query: 175 SCFGEEFYNGSHDE 188
               +   N   DE
Sbjct: 238 LAENKARCNPPLDE 251


>gi|220915108|ref|YP_002490414.1| hypothetical protein Mnod_7757 [Methylobacterium nodulans ORS 2060]
 gi|219952962|gb|ACL63348.1| hypothetical protein Mnod_7757 [Methylobacterium nodulans ORS 2060]
          Length = 885

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 72/265 (27%), Gaps = 41/265 (15%)

Query: 3   ATDVDHYVYNGF-------GILCGIGTH-----PVYAFDVDVLDEQVVDRFNNEFQSCCG 50
           A DV+ +  +G        G   G          V A D DV         N   +    
Sbjct: 56  AADVERWQRSGLPGQRPNMGFNLGPQPGLPEGEHVVAVDADVFTPAAATAVNEILERRLP 115

Query: 51  KPISRVGQAPKTLMLF------------RMQETNLKKQKSEEKIQGH--LEFLAYGQQFV 96
               R+G   K    F            R Q        + +  + H  +E L  GQQ V
Sbjct: 116 GAPHRLGNPAKVGTRFVRTKTADGSEPVRRQGRRFIFDGAPDTKENHNRVELLGQGQQSV 175

Query: 97  AYNIHPKTQRAYTWSIAPHALKV--EELPLLTPDEVEYFFEFFDTITTPRDKE----KSY 150
            +  HP     YTW      +++  E LPL+  DE+       D        +     ++
Sbjct: 176 VHGAHP-CGALYTWPDGISIVELHPEALPLIPIDELNAIIAECDAAMEAVGGKVVSGATF 234

Query: 151 RKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYN-GSHDEWI---PVVMAIHYETRGS--- 203
            +  +     +       +    LS  G    +     +W+       A+     G    
Sbjct: 235 SRSGRNGGGADLTPLVEADAEVLLSGLGSVRNDLSDRGDWVMFTKAFAALCVPALGEGRV 294

Query: 204 -AEGKEIVREWCKLGRTYDEKSFNA 227
                     W     T D      
Sbjct: 295 VDALLGFTDRWEAAPETGDPDEILR 319


>gi|254559012|ref|YP_003066107.1| hypothetical protein METDI0390 [Methylobacterium extorquens DM4]
 gi|254266290|emb|CAX22051.1| hypothetical protein METDI0390 [Methylobacterium extorquens DM4]
          Length = 1433

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 62/173 (35%), Gaps = 17/173 (9%)

Query: 5   DVDHY-VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAPKT 62
               +   +    + G  +   +A D+DV D ++ +          G  P SRVG+ P+ 
Sbjct: 177 WWSRFCPSHNVACILGAASGGTWALDIDVSDAELSNAIVKLADDHLGYTPFSRVGRVPRI 236

Query: 63  LMLFRMQE-------------TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYT 109
           ++++R                 +    +  E   G +E L +G+    + +H  T + + 
Sbjct: 237 VLVYRQAPVSEVGADQVIRVSPHRFAARPGEDSPGQIEVLGHGKPVTFFGLHHGTGKYFI 296

Query: 110 WSIA-PHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN 161
           W    PH L  E  PL+T  + + F +       P  K   +      W    
Sbjct: 297 WVDRSPHVLGPEHAPLVTRQQYDAFLD-AVHALHPFAKPAVHEAPDAAWTFDP 348


>gi|326792799|ref|YP_004310620.1| Bifunctional DNA primase/polymerase [Clostridium lentocellum DSM
           5427]
 gi|326543563|gb|ADZ85422.1| Bifunctional DNA primase/polymerase [Clostridium lentocellum DSM
           5427]
          Length = 416

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 43/163 (26%), Gaps = 5/163 (3%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV-LDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           +      Y     GI  G  +  +   DVD                      ++ +  + 
Sbjct: 62  ITKWWSKYPDANIGIPTGERSGWLV-LDVDTKYQGDESLELLQMLYEDLPPTVTALTGSG 120

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
              ++F+  +       ++   +  L+  + G   VA      +   Y+W         E
Sbjct: 121 GRHLIFKYPKG--VHIPNKVSFKQGLDTRSNGGLIVATPSLHVSGNTYSWLEGHSPFDSE 178

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNR 163
            +       +E   E           +      + +++   N 
Sbjct: 179 PV-EAPEWLLEVMCEGDQIQKREVVYQALETSTATVFEGSRNN 220


>gi|304407256|ref|ZP_07388909.1| phage/plasmid primase, P4 family [Paenibacillus curdlanolyticus
           YK9]
 gi|304343697|gb|EFM09538.1| phage/plasmid primase, P4 family [Paenibacillus curdlanolyticus
           YK9]
          Length = 808

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/224 (10%), Positives = 50/224 (22%), Gaps = 17/224 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +      Y     G++ G  +  + A DVD       +             +S       
Sbjct: 63  INHWFKKYPTANIGLVLGSPS-GIVAIDVDGDKGT--ELLQQMSGGDLPDTVSFST-PNG 118

Query: 62  TLMLFRMQET---NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
              L+R          K+            +  G   V       + + Y W   P  ++
Sbjct: 119 LRYLYRAPAGITLKKHKRSDPSLPHNECALMGEGNLTVLPPSIHHSGKTYEWIKHPKDVE 178

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL-SCF 177
           + E P      +        +         S                   +   F     
Sbjct: 179 IAEAPS----WMVSLMTPSLSAAHSMQNRTSLVLPKASVDPDLLLADFAAKCSQFSADWI 234

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
            ++    + D W   +  +       A        + +    ++
Sbjct: 235 QQQGSGIAEDAWFDWIRTLTNAGAPDAAL-----AFSQASPKHN 273


>gi|254454539|ref|ZP_05067976.1| Bifunctional DNA primase/polymerase, N-terminal domain family
           [Octadecabacter antarcticus 238]
 gi|198268945|gb|EDY93215.1| Bifunctional DNA primase/polymerase, N-terminal domain family
           [Octadecabacter antarcticus 238]
          Length = 219

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 70/219 (31%), Gaps = 22/219 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           +    D +     G+  G  +  V   D+D   D+      ++            V    
Sbjct: 21  IDRWWDKHPDALPGLPTGAAS-GVAVLDIDRKDDKDGFTALSDAGLDRFTDGRYVVDTPS 79

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
               ++         + S  KI   ++ LA G   +A      TQ  Y  S     + V+
Sbjct: 80  GGQHIYFAHID--GLRCSTSKIAEGVDVLADGGYVIAPGAE-TTQGTYPTSSNSEDMTVK 136

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
             P      V                    +  +K   S   + +  ++          +
Sbjct: 137 PFPKTLRKLV-----------------GQRKATTKPKSSEPAQAWKIVKAALKSIPNNGK 179

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
             + S D W+ ++ A+H+E+ GSA+G+++   W    + 
Sbjct: 180 GADVSRDWWVKMLAALHHESSGSAKGRKLAHTWSGTCQR 218


>gi|37626154|gb|AAQ96530.1| putative integrase [Vibrio phage VP16T]
          Length = 791

 Score = 92.5 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 63/239 (26%), Gaps = 39/239 (16%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG--KPISRVGQAPKTLMLF 66
           +  +  G+        V   D+D       +             +   +  Q+      F
Sbjct: 45  WPSDIVGV---PIPQGVVVLDLDTYKGITREYVEAGAGFAIPWDEAHIQDTQSGGQHYAF 101

Query: 67  RMQETNLKKQKSEEKIQ-----GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           R  +  +K   + +  Q       L+  + G+ ++A      T   Y    A        
Sbjct: 102 RAPDWPVKNISNAKHNQTGEKFEGLDVRSAGKGYIA------TGEPYYRPTAKGGAVAMA 155

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
            P + P   E    + + +     +                       +R  LS      
Sbjct: 156 FPQMLPPLPEGLRPWLEAVEHDSAER------------VEITDQEAQTVREALSYIDP-- 201

Query: 182 YNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG--------RTYDEKSFNAKWDSF 232
                +EW+ V +A+        +G  +  EW              Y  +    +W SF
Sbjct: 202 -GDKREEWVKVGLALKSGFGDDPQGLSLFDEWSSGALWQDGDMPANYVPEHIETQWHSF 259


>gi|125975346|ref|YP_001039256.1| P4 family phage/plasmid primase [Clostridium thermocellum ATCC
           27405]
 gi|125715571|gb|ABN54063.1| phage / plasmid primase, P4 family [Clostridium thermocellum ATCC
           27405]
          Length = 717

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 53/194 (27%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +              ++ V  +  
Sbjct: 60  IRKWWTKTPNANIGIPTGEKSDWLV-LDVDDGGDETISALEAT-YGKLPDTVTAVTGSGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W           
Sbjct: 118 WHYVFKYPKGRSIPNKTK--FASGLDTRSTGGLIVVAPSIHVSGNQYQWLEGHSPFDRTP 175

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      S   R  T   I A L
Sbjct: 176 AEAPAWLLKLMERVEVLLTPFEGSSIIAEIKEGSRNSTLTSLAGSMRARGMTEESIYAAL 235

Query: 175 SCFGEEFYNGSHDE 188
               +   N   DE
Sbjct: 236 LAENKARCNPPLDE 249


>gi|332976117|gb|EGK12985.1| N- superfamily bifunctional DNA primase/polymerase [Desmospora sp.
           8437]
          Length = 798

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 18/154 (11%), Positives = 45/154 (29%), Gaps = 8/154 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC--CGKPISRVGQA 59
           +    +   +   G+  G   + ++A DVD    +  +      Q           +   
Sbjct: 67  IQKMWEKNSWANVGVPMGKV-NGLFAIDVDG--PEGQETLQKWIQEHGELPATWQVLTGG 123

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
               + +R+ +        ++ I  +++    G Q VA     ++   Y W+       +
Sbjct: 124 GGMQLWYRVPKGMEIPNSVKK-IGINVDIRGTGGQSVAPGSLHQSGNRYRWAPTRGPEDL 182

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKL 153
           +  P   P+ +                 K   + 
Sbjct: 183 K--PSAPPEWLVEKIREVIADQQQAKLSKIQTEE 214


>gi|281419611|ref|ZP_06250619.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281406743|gb|EFB37013.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
          Length = 268

 Score = 91.4 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 55/194 (28%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +    +         ++ V  +  
Sbjct: 62  IRKWWTKTPNANIGIPTGAKSDWLV-LDVDDGGDETISALEST-HGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W          +
Sbjct: 120 WHYVFKYPKGRSIPNKTK--FAPGLDTRSTGGLIVVAPSIHVSGNQYQWLEGHSPFDRTL 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      +   R  T   I A L
Sbjct: 178 AEAPAWLLKLMERVEVLLTPFEGSSIAAEIKEGSRNSTLTSLAGTMRARGMTEESIYAAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N + DE
Sbjct: 238 LAENNARCNPTLDE 251


>gi|227828130|ref|YP_002829910.1| Bifunctional DNA primase/polymerase [Sulfolobus islandicus M.14.25]
 gi|227459926|gb|ACP38612.1| Bifunctional DNA primase/polymerase [Sulfolobus islandicus M.14.25]
          Length = 855

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/232 (10%), Positives = 76/232 (32%), Gaps = 23/232 (9%)

Query: 5   DVDHY---VYNGFGILCGIGTHPVYAFDVDVLD-----EQVVDRFNNEFQSCCGKPISRV 56
           +++ +     N   I+CG  +  +   D D  +      + V++ N   +S     +   
Sbjct: 45  EIEKWFKDTDNNIAIVCGKVSGNLVVIDFDDTEIYEKFLKEVEKDNELSESVNNTWLVET 104

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
           G+     +  R+      +          ++    G   VA      + + Y +      
Sbjct: 105 GK--GYHIYLRVDNDKPVRT----AKLPKIDIKGEGGYVVAPPSIHPSGKRYEFVRFSKT 158

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
               E+ +++ ++ +      + IT  + +E+      +  K         ++I   ++ 
Sbjct: 159 TG-HEIRVISEEQYQKLLALLERITGVKVEEE---VSGENRKFRELTSEKVLKIADIIAP 214

Query: 177 FGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
             +E    +   ++     ++         K++  E+  +   + +   N +
Sbjct: 215 IYKEGQRHNVIMYLS-GW-LYKANVSYESAKKL-VEF--ICDKFGDNECNDR 261


>gi|125974481|ref|YP_001038391.1| hypothetical protein Cthe_1980 [Clostridium thermocellum ATCC
           27405]
 gi|125714706|gb|ABN53198.1| hypothetical protein Cthe_1980 [Clostridium thermocellum ATCC
           27405]
          Length = 266

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 47/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V     
Sbjct: 60  IKKWWTKTPNANIGIPTGAKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGGGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++  +   L+  + G   V       +   Y W           
Sbjct: 118 LHYIFKYSQGRSIPNKTKFAL--GLDTRSTGGLIVVAPSIHVSGNRYEWIKDHSPFDRTP 175

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +     ++  R  +      +   R  T   I   L
Sbjct: 176 AEAPAWLLKLMEREEVLLTPFEGRSIVAGIKEGSRNSTLTSLAGTMRARGMTEEGIYTAL 235

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 236 LAENNARCNPPLDE 249


>gi|281419017|ref|ZP_06250034.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281419526|ref|ZP_06250539.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281406817|gb|EFB37082.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281407166|gb|EFB37427.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|316941629|gb|ADU75663.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum DSM
           1313]
          Length = 268

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 46/194 (23%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V  +  
Sbjct: 62  IKKWWTKTPNANIGIPTGEKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F   +      K++      L+  + G           +   Y W           
Sbjct: 120 RHYVFIYPKGRSIPNKTK--FAPGLDTRSTGGLIAVAPSIHVSGNRYEWIKDHSPFDRTP 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      S   R  T   I   L
Sbjct: 178 AEAPAWLLKLMEKEEVLLTPFEGSSIIAEIKEGSRNSTLTSLAGSMRARGMTEEGIYTAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|284028383|ref|YP_003378314.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
 gi|283807676|gb|ADB29515.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
          Length = 290

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 38/174 (21%), Gaps = 10/174 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA  V         +  G     +   DVD                   + +     +  
Sbjct: 62  VAQIVAAVPDGQLAVRTGAVA-GLVVVDVDPAHGGNDSLAELVTHQLVPRTLWVRTGSGG 120

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +R     +  +      +  ++  A G   V     H +T   Y W          
Sbjct: 121 AHLYYRHPGREIASRPMPG--RAGIDVKADGGYVVLPPSMHHRTHLPYQW-----GSGPA 173

Query: 121 ELPLLTPDEVEYFFEFFDTI-TTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
           +   + P  +            T         +   I         T   +R  
Sbjct: 174 DPTEMPPALITACLPATPAESATRTAGPIRTTRAGGISNPEGLLTSTLNAVRNA 227


>gi|125975329|ref|YP_001039239.1| P4 family phage/plasmid primase [Clostridium thermocellum ATCC
           27405]
 gi|125715554|gb|ABN54046.1| phage / plasmid primase, P4 family [Clostridium thermocellum ATCC
           27405]
          Length = 717

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 48/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V  +  
Sbjct: 60  IKKWWTKTPNANIGIPTGEKSDWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGSGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F   +      K++      L+  + G           +   Y W       +   
Sbjct: 118 RHYVFIYPKGRSIPNKTK--FAPGLDMRSTGGLIAVAPSIHISGNRYEWLEGHSPFERIP 175

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      +   R  T   I A L
Sbjct: 176 AEAPAWLLKLMERVEVLLTPFEGSSIIAEIKEGNRNSTLTSLAGTMRARGMTEESIYAAL 235

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 236 LAENNARCNPPLDE 249


>gi|23012376|ref|ZP_00052477.1| hypothetical protein Magn03006897 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 543

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 61/172 (35%), Gaps = 11/172 (6%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAPKTLMLFR- 67
             +    + G  +    A DVDV D  +         S  G  P  RVG+ P+ ++++R 
Sbjct: 102 PSHNVAGILGPSSAHTCAIDVDVGDLDLSLAIVERADSILGYTPFRRVGRDPRIILIYRE 161

Query: 68  -----MQETNLKKQKSEEKIQGH---LEFLAYGQQFVAYNIHPKTQRAYTWSIA-PHALK 118
                 +   L +QK           +E LA G     + +H KT + + W    PH   
Sbjct: 162 AGAATAKSDALIRQKKLWLQGPEGHMIEILARGAPVTFFGLHHKTGKYFLWLDRSPHVAP 221

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
            EE   +T D+++ F +  + +   +                    +   E+
Sbjct: 222 PEEAREVTRDQIDEFLDAVNALRPLKAGTGRLAMAETWTYDAEAGLHVPAEL 273


>gi|281419573|ref|ZP_06250583.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281406762|gb|EFB37030.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
          Length = 268

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 47/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V     
Sbjct: 62  IKKWWTKTPNANIGIPTGAKSDWLV-LDVD-DGGDETLSALESTHGKLPDTVTAVTGRGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W           
Sbjct: 120 RHYIFKYPQGRSIPNKTK--FAPGLDTRSTGGLIVVAPSIHVSGNRYEWIKDYSPFDRTP 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      S   R  T   I   L
Sbjct: 178 AEAPAWLLKLMERVEVLLTPFEGSSIIAEIKEGSRNSTLTSLAGSMRARGMTEEGIYTAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARSNPPLDE 251


>gi|125974515|ref|YP_001038425.1| hypothetical protein Cthe_2020 [Clostridium thermocellum ATCC
           27405]
 gi|125714740|gb|ABN53232.1| hypothetical protein Cthe_2020 [Clostridium thermocellum ATCC
           27405]
          Length = 263

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 51/194 (26%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +              ++ V  +  
Sbjct: 57  IRKWWTKTPNANIGIPTGEKSDWLV-LDVDDGGDETISALEAT-HGKLPDTVTAVTGSGG 114

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W           
Sbjct: 115 WHYVFKYPKGRSIPNKTK--FASGLDTRSTGGLIVVAPSIHVSGNQYQWLEGHSPFDRTP 172

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      S   R  T   I   L
Sbjct: 173 AEAPAWLLKLMEREEVLLTPFEGSSIIAEIKEGSRNSTLTSLAGSMRARGMTEEGIYTAL 232

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 233 LAENNARCNPPLDE 246


>gi|125975306|ref|YP_001039216.1| hypothetical protein Cthe_2824 [Clostridium thermocellum ATCC
           27405]
 gi|125715531|gb|ABN54023.1| hypothetical protein Cthe_2824 [Clostridium thermocellum ATCC
           27405]
          Length = 263

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 53/194 (27%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +              ++ V  +  
Sbjct: 57  IRKWWTKTPNANIGIPTGEKSDWLV-LDVDDGGDETISALEAT-HGKLPDTVTAVTGSGG 114

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++      L+  + G   V       +   Y W          +
Sbjct: 115 WHYVFKYPKGRSIPNKTK--FASGLDTRSTGGLIVVAPSIHVSGNQYQWLEGHSPFDRTL 172

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +   + ++  R  +      +   R  T   I   L
Sbjct: 173 AEAPEWLLKLMEREEVLLTPFEGSSIIVEIKEGNRNSTLTSLAGTMRARGMTEEGIYTAL 232

Query: 175 SCFGEEFYNGSHDE 188
                   N + DE
Sbjct: 233 LAENNARCNPTLDE 246


>gi|240142182|ref|YP_002966692.1| hypothetical protein MexAM1_META2p0504 [Methylobacterium extorquens
           AM1]
 gi|240012126|gb|ACS43351.1| Hypothetical protein MexAM1_META2p0504 [Methylobacterium extorquens
           AM1]
          Length = 1438

 Score = 88.7 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 13/146 (8%)

Query: 4   TDVDHY-VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPI-SRVGQAPK 61
            +   +   +   ++ G G+   ++ D+DVLDE +        +   G     RVG APK
Sbjct: 95  EEWIRWCPAHNVALVLGRGSGDAFSVDIDVLDELLSYDIRRLAEDILGATPLRRVGNAPK 154

Query: 62  TLMLFRM--QETNLKKQKSE--------EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
             + FR    E   K Q++            +  L+ L Y +    Y  H +T R ++W 
Sbjct: 155 VALFFRWASPEEAHKLQRTAFKFRDATGRGREQGLDILNYAKSVTIYGRHHRTGRNFSWE 214

Query: 112 -IAPHALKVEELPLLTPDEVEYFFEF 136
              P   + E+LP +T ++V+ F + 
Sbjct: 215 ADTPLTTRPEDLPAVTAEDVQRFVDA 240


>gi|254417833|ref|ZP_05031557.1| Bifunctional DNA primase/polymerase, N-terminal family
           [Brevundimonas sp. BAL3]
 gi|196184010|gb|EDX78986.1| Bifunctional DNA primase/polymerase, N-terminal family
           [Brevundimonas sp. BAL3]
          Length = 590

 Score = 88.7 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 38/165 (23%), Gaps = 7/165 (4%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQ-- 69
              GI  G  +   +  D+D  D                    +     +  +LF     
Sbjct: 72  ANIGIATGQIS-GFWVLDIDGPDGAAALAALEAQHGPLPVTAEQSTGKGR-HILFAWPVA 129

Query: 70  --ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTP 127
               +   + S  KI   ++    G   VA      + R Y W+     + V   P    
Sbjct: 130 GEIGDRTVRNSASKIGPGIDVRGDGGYIVAAPSIHPSGRPYEWAPGRGPVDVGFAP-APA 188

Query: 128 DEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
             +E            +      R       +            A
Sbjct: 189 WLLELAAPPIVQSAPVQRVAIEGRATRYGEAALAGACRDVETAAA 233


>gi|227487379|ref|ZP_03917695.1| bifunctional DNA primase/polymerase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227092603|gb|EEI27915.1| bifunctional DNA primase/polymerase [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 300

 Score = 88.3 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 41/172 (23%), Gaps = 12/172 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA     + Y   GI            DVD  +  + D         C         +  
Sbjct: 87  VAEWWSKWPYANIGIR---VPEGCLVVDVDPRNGGLADYRRMFPHGSCPHTGRTFTGSGG 143

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + F +        ++  K    ++    G+  VA    HP T RAY W       K  
Sbjct: 144 LHLYFTLPYDG----ETRGKYGTGIDLQGRGKFLVAPPSIHPTTGRAYAWWPFVPPEKWA 199

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
            LP                +      E    K                E + 
Sbjct: 200 PLPS----WCYLDVYKPPRVAPREPLEIRRYKAQHAKNPGAGLIRAVAEAQQ 247


>gi|86750422|ref|YP_486918.1| hypothetical protein RPB_3311 [Rhodopseudomonas palustris HaA2]
 gi|86573450|gb|ABD08007.1| hypothetical protein RPB_3311 [Rhodopseudomonas palustris HaA2]
          Length = 1082

 Score = 87.9 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/156 (23%), Positives = 54/156 (34%), Gaps = 16/156 (10%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
                G GI CG   + + A D+D  D                  +++ G+    L +F 
Sbjct: 73  RDPECGIGIACGF--NNLVAVDIDRDD-----LIEPLLAVLPPMVVAKRGRKG--LTVFY 123

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYN-IHPKTQRAYTWSIAPH--ALKVEELPL 124
               +  K          L+F+A G Q V    IHP T + Y W+         VEELPL
Sbjct: 124 RGAEHWPKANYTGF----LDFIARGAQTVLPPTIHPDTGQPYAWTTERTLLDTPVEELPL 179

Query: 125 LTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
           LT D  +              +++  R      +S 
Sbjct: 180 LTADHRKAMEAVLAAHGWQPKEDRQARTAVTAARSS 215


>gi|281419623|ref|ZP_06250630.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281406730|gb|EFB37001.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
          Length = 268

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 47/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V     
Sbjct: 62  IKKWWTKTPNANIGIPTGAKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGGGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++       +  + G   V       +   Y W     +    +
Sbjct: 120 LHYIFKYPKGRSIPNKTK--FAPGFDNHSTGGLIVVAPSIHVSDNQYQWLKGHSSFDKTL 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +     ++  R  +      +   R  T   I   L
Sbjct: 178 AEAPEWLLKLMEREEVLLTPFEGRSIVAGIKEGSRNSTLTSLAGTMRARGMTEEGIYTAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|332160965|ref|YP_004297542.1| Replication protein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665195|gb|ADZ41839.1| Replication protein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330862121|emb|CBX72285.1| hypothetical protein YEW_AK02220 [Yersinia enterocolitica W22703]
          Length = 721

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 53/182 (29%), Gaps = 9/182 (4%)

Query: 5   DVDHY---VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV--GQA 59
           +++ +      G  +  G   + V A D D   E++            G    R     +
Sbjct: 76  EIEKWSREPDYGICMRTG---NGVIALDCDSESEEIQAIIQELTLELFGVIPPRRYRSNS 132

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
            K L L  ++    K+    E   G +E LA G Q V    HP +     W        V
Sbjct: 133 NKCLYLLAVEGEYRKRIHRLEGNNGIIEMLADGNQAVVAGTHP-SGARILWDNGLPDEPV 191

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
              P           E    + +        R  S+   +  +     ++   +   FG 
Sbjct: 192 VITPEQLESLWSALAERLPVVNSTEAGTSRLRDRSQATPNATDETADFLDANGWTLDFGA 251

Query: 180 EF 181
             
Sbjct: 252 SG 253


>gi|170739472|ref|YP_001768127.1| bifunctional DNA primase/polymerase [Methylobacterium sp. 4-46]
 gi|168193746|gb|ACA15693.1| Bifunctional DNA primase/polymerase [Methylobacterium sp. 4-46]
          Length = 289

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/197 (11%), Positives = 38/197 (19%), Gaps = 8/197 (4%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV-DRFNNEFQSCCGKPISRVGQAP 60
           V    +       G+  G  T      DVD                      +       
Sbjct: 68  VRQWFEAVPGANIGMATGKVT----IIDVDPRHGGDATLAALEAEHGPLPHTVRARTGGG 123

Query: 61  KTLMLFRMQETNLKKQKSEEKIQ--GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
              + FR           +        L+    G   VA      +   Y WS   H L+
Sbjct: 124 GQHIFFRPPAGVTVGCYGDPNSPLGHGLDVRGAGGYIVAVGSDHISGGRYEWSAEHHPLR 183

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG 178
              +  L         +       P  + +            N                 
Sbjct: 184 GAPVAPLPEWMAARLAKPERKAARPVSEWRELVTEGVTEGGRNTAVAKLAGYLI-CRHVD 242

Query: 179 EEFYNGSHDEWIPVVMA 195
            E  +     W  +  +
Sbjct: 243 FEVVHQLLQCWNEMRFS 259


>gi|284033434|ref|YP_003383365.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
 gi|283812727|gb|ADB34566.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
          Length = 292

 Score = 87.2 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/144 (15%), Positives = 42/144 (29%), Gaps = 6/144 (4%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A  ++        +  G  +  +   DVD          +        +       +   
Sbjct: 63  AAIINAVPGGQLAVRTGAVS-GLAVIDVDPAHGGDASLSDLMTAGLVPRTRHVHTGSGGL 121

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEE 121
            + +R    +L  +      +  ++  A G   V     H +T R Y W  A +   V E
Sbjct: 122 HLYYRHPGQHLPSRPMP--NRPGIDVKADGGYVVLPPSIHHRTHRPYRWGTAGN--DVVE 177

Query: 122 LPLLTPDEVEYFFEFFDTITTPRD 145
           +P              ++ T PR 
Sbjct: 178 MPPALVTACLPAPTPAESHTHPRT 201


>gi|332983388|ref|YP_004464829.1| bifunctional DNA primase/polymerase [Mahella australiensis 50-1
           BON]
 gi|332701066|gb|AEE98007.1| Bifunctional DNA primase/polymerase [Mahella australiensis 50-1
           BON]
          Length = 271

 Score = 86.4 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 12/136 (8%), Positives = 36/136 (26%), Gaps = 11/136 (8%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE---QVVDRFNNEFQSCCGKPISRVG 57
           ++A   + +     G++C    + ++  DVD        +               +   G
Sbjct: 59  VIARWWEKWPNANIGLIC--RANGIFVLDVDARHGGIDSLYQLIAEYG-ELPYTVVCNSG 115

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                   F+           ++  +  L+  + G   +       + ++Y W  +    
Sbjct: 116 G-GGAHFYFKYPVN--IVITDKQGFKSGLDIRSNG-YILLPPSDHISGKSYMWRKSCTPF 171

Query: 118 KVEELPLLTPDEVEYF 133
               +       +   
Sbjct: 172 S-TPIAEAPQWLLNMI 186


>gi|170751665|ref|YP_001757925.1| hypothetical protein Mrad2831_5295 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658187|gb|ACB27242.1| hypothetical protein Mrad2831_5295 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 1349

 Score = 86.4 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 52/139 (37%), Gaps = 10/139 (7%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP-ISRVGQAPKTLMLFRMQ 69
                ++ G  +      D+DV D  +            G+    RVG+AP+ ++++R  
Sbjct: 136 RANVALIMGEVSGRALCLDIDVSDPTLAQAILALVDRHLGRTEFRRVGRAPRLVLIYRSD 195

Query: 70  ETNLKKQKS-------EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS--IAPHALKVE 120
            ++  + K+       +      +E LA  +    +  H KT   + W     P     E
Sbjct: 196 VSDPVRNKTYALDAKDDGGNDQAIEVLADRKPVTGFGAHHKTGAHFQWVGACRPDTHGPE 255

Query: 121 ELPLLTPDEVEYFFEFFDT 139
             P++T  +VE F    D 
Sbjct: 256 HAPVITQAQVEDFISAVDA 274


>gi|159036858|ref|YP_001536111.1| bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
 gi|157915693|gb|ABV97120.1| Bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
          Length = 290

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 36/127 (28%), Gaps = 8/127 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +   +D        +  G  +  V   DVD  +                +    +  +  
Sbjct: 64  ITAMIDTAPRGQLALRTGRASD-VVVLDVDPRNGGHRGLATLVADGLAPRTAYVITGSDG 122

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +R   T      ++      ++    G   V     H +T R Y W+       V+
Sbjct: 123 LHLFYRHPGTP---LAAKVPGVPGVDIKTDGGYVVLPPSIHQRTGRPYRWADRG---PVQ 176

Query: 121 ELPLLTP 127
           E+P    
Sbjct: 177 EMPPALA 183


>gi|107022006|ref|YP_620333.1| Phage-plasmid primase P4-like [Burkholderia cenocepacia AU 1054]
 gi|116688950|ref|YP_834573.1| P4 family phage/plasmid primase [Burkholderia cenocepacia HI2424]
 gi|105892195|gb|ABF75360.1| Phage-plasmid primase P4-like protein [Burkholderia cenocepacia AU
           1054]
 gi|116647039|gb|ABK07680.1| phage/plasmid primase, P4 family [Burkholderia cenocepacia HI2424]
          Length = 746

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 45/163 (27%), Gaps = 11/163 (6%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR---VGQAP 60
              + +  +      G  +  +   DVDV + +   +     Q   G   +    +  + 
Sbjct: 47  AWAEQFPSSNIAYATGAPSGRLIVIDVDVKNNKSGAKSLVALQKKHGPLPATRTVITPSG 106

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
              +LF   E    K + +   +  ++  A G    A          Y W          
Sbjct: 107 GIHLLFTYPEGM--KIQCKVGFRDGIDIRADGGYCGAPPS-TIEGNPYEWVDETVP---- 159

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNR 163
            +       +E F +   T    + ++ +        +S    
Sbjct: 160 -IAPAPAWLLEEFAKQGTTRRKRKSRKTAIVPAGNRNQSVMLH 201


>gi|284162709|ref|YP_003401332.1| Bifunctional DNA primase/polymerase [Archaeoglobus profundus DSM
           5631]
 gi|284012706|gb|ADB58659.1| Bifunctional DNA primase/polymerase [Archaeoglobus profundus DSM
           5631]
          Length = 1107

 Score = 85.6 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 59/192 (30%), Gaps = 30/192 (15%)

Query: 4   TDVDHYVYN------------GFGILCGIGTHPVYAFDVDVLD------EQVVDRFNNEF 45
            +++ +  +            G  I+ G  +  +   D D  +       ++ D+  + +
Sbjct: 52  EELEKWFKHPDFPALRKGNKLGLAIVTGEISGNLTVVDFDSREVMSEVLAELADKHPDLY 111

Query: 46  QSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
                  I   G+        +++  +  K  +   I+  ++  A G   VA      + 
Sbjct: 112 GKILDTWIVETGK--GFHYYLKVKNPDPNKFTNRIGIRPGVDIRANGGYVVAPPSPHPSG 169

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRY 165
           + Y +   P     EE+  LT +E +    F +            R   K  +       
Sbjct: 170 KVYRFVHKP-----EEIAELTWEEYQTLLSFLEGKKR-----TIPRVEVKDGEGRELEES 219

Query: 166 TNIEIRAFLSCF 177
             +EI   L   
Sbjct: 220 KIVEIVNILRPI 231


>gi|94266791|ref|ZP_01290456.1| RecA-family ATPase-like [delta proteobacterium MLMS-1]
 gi|93452534|gb|EAT03120.1| RecA-family ATPase-like [delta proteobacterium MLMS-1]
          Length = 700

 Score = 85.6 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 46/192 (23%), Gaps = 20/192 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           + T    +     G   G   + +   DVD                     + +  ++P+
Sbjct: 84  IKTWWRKHPRALIGFPTG---NGLMVLDVDPPHGPESLAALEAKHGPLPATLEQ--RSPR 138

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
              LF         + S  K+   L+  A G   +         +AY W+          
Sbjct: 139 GRHLFLASN--HDVKISANKLGPGLDIRAKGGYVIVSPSVNSEGKAYQWTNKAEPAP--- 193

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
                   ++      +  T      K+         +        +E   +        
Sbjct: 194 ---APEWLIDAI---SEATTRATPTPKTGDGRPGDDFNERGDIRPILERHGWTFF----R 243

Query: 182 YNGSHDEWIPVV 193
             G+ + W    
Sbjct: 244 TAGAFERWTRPG 255


>gi|125975335|ref|YP_001039245.1| prophage Lp4 protein 7, DNA replication [Clostridium thermocellum
           ATCC 27405]
 gi|125715560|gb|ABN54052.1| prophage Lp4 protein 7, DNA replication [Clostridium thermocellum
           ATCC 27405]
          Length = 266

 Score = 85.6 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 47/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V     
Sbjct: 60  IKKWWTKTPNANIGIPTGAKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGGGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++       +  + G   V       +   Y W     +    +
Sbjct: 118 LHYIFKYSQGRSIPNKTK--FAPGFDNHSTGGLIVVAPSIHVSDNQYQWLKGHSSFDKTL 175

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +     ++  R  +      +   R  T   I   L
Sbjct: 176 AEAPEWLLKLMEREEVLLTPFEGRSIVAGIKEGSRNSTLTSLAGTMRARGMTEEGIYTAL 235

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 236 LAENNARCNPPLDE 249


>gi|281419297|ref|ZP_06250313.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
 gi|281407163|gb|EFB37425.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum JW20]
          Length = 268

 Score = 85.6 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 47/194 (24%), Gaps = 11/194 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V     
Sbjct: 62  IKKWWTKTPNANIGIPTGAKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGGGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F+  +      K++       +  + G   V       +   Y W     +    +
Sbjct: 120 LHYIFKYSQGRSIPNKTK--FAPGFDNHSTGGLIVVAPSIHVSDNQYQWLKGHSSFDKTL 177

Query: 120 EELPLLTPDEVEY---FFEFFDTITTPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFL 174
            E P      +E        F+  +     ++  R  +      +   R  T   I   L
Sbjct: 178 AEAPEWLLKLMEREEVLLTPFEGRSIVAGIKEGSRNSTLTSLAGTMRARGMTEEGIYTAL 237

Query: 175 SCFGEEFYNGSHDE 188
                   N   DE
Sbjct: 238 LAENNARCNPPLDE 251


>gi|330467066|ref|YP_004404809.1| bifunctional DNA primase/polymerase [Verrucosispora maris
           AB-18-032]
 gi|328810037|gb|AEB44209.1| bifunctional DNA primase/polymerase [Verrucosispora maris
           AB-18-032]
          Length = 304

 Score = 85.2 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 47/194 (24%), Gaps = 7/194 (3%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A  V         +  G  +  V   DVD                        V  +   
Sbjct: 68  AAIVRAVPTGQLALRTGAAS-GVVVVDVDPAHGGRDSMNALIADGLLPPTAYVVTGSGGL 126

Query: 63  LMLFRMQETNLKKQKSE--EKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKV 119
            + +R     +   + +  + +   ++  A G   V     HP+T RAY W+       +
Sbjct: 127 HLYYRHPGQPVPCSQGKPGQGLGPGIDVKADGGYVVLPPSVHPRTGRAYRWAP---DRAM 183

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
           EE+P       +            R              S       +   R   +    
Sbjct: 184 EEMPPRWSPPADRPRRHHRWPRPCRPPPARRGASPSPTGSWPRTCKRSPTHRKAPAAPPS 243

Query: 180 EFYNGSHDEWIPVV 193
                +   W P  
Sbjct: 244 TARRAASRAWSPSG 257


>gi|295096871|emb|CBK85961.1| Predicted P-loop ATPase and inactivated derivatives [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 728

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 56/175 (32%), Gaps = 12/175 (6%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
                    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSKEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  ++    K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVEGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
            P++T D++E  ++            ++    +K+            E   +L  
Sbjct: 189 PPVITADQLETLWQRLAEQLPVSVTTEA--GSTKMRDRSTFTPGATDETAEYLDA 241


>gi|256006172|ref|ZP_05431087.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum DSM
           2360]
 gi|255989866|gb|EEU00033.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum DSM
           2360]
          Length = 222

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 30/133 (22%), Gaps = 6/133 (4%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD                     ++ V  +  
Sbjct: 62  IKKWWTKTPNANIGIPTGEKSGWLV-LDVD-DGGDETLSALEATHGKLPDTVTAVTGSGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--V 119
              +F   +      K++      L+  + G           +   Y W           
Sbjct: 120 RHYVFIYPKGRSIPNKTK--FAPGLDTRSTGGLIAVAPSIHVSGNRYEWIKDHSPFDRTP 177

Query: 120 EELPLLTPDEVEY 132
            E P      +E 
Sbjct: 178 AEAPAWLLKLMEK 190


>gi|191172659|ref|ZP_03034198.1| replication protein [Escherichia coli F11]
 gi|190907132|gb|EDV66732.1| replication protein [Escherichia coli F11]
          Length = 684

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 31  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 87

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 88  CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 142

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 143 PPAITGEQLETLWQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLD 202

Query: 176 CFGEEFY 182
               E Y
Sbjct: 203 GANGERY 209


>gi|269977396|ref|ZP_06184368.1| P4 family phage/plasmid primase [Mobiluncus mulieris 28-1]
 gi|269934312|gb|EEZ90874.1| P4 family phage/plasmid primase [Mobiluncus mulieris 28-1]
          Length = 283

 Score = 84.5 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 51/211 (24%), Gaps = 24/211 (11%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA- 59
           M+      Y     G+        +   DVD  +   ++    +            G+  
Sbjct: 59  MIRRWWKEYPNALIGLAL---PKTLLVLDVDPRNGGSLEALQEKIGRLPETLRVESGRGD 115

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
             T   FR     L  +   E     L+    G      ++HP+T   Y W         
Sbjct: 116 GGTHYYFRHPGIPLYGRNLPEG--VDLKEGGKGYVIAPPSLHPETGMPYKW--------- 164

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
             +P           +       P    +  R +              +E  A       
Sbjct: 165 --IPGALSSLTVGNVKRLAAKPAPSVASRPTRFIGYKNTDKWRGVLRVVETAA------- 215

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIV 210
           E        W    MA +   + + E   + 
Sbjct: 216 EGQRNRTLFWAACRMAENNADQNAWEALNLA 246


>gi|288932397|ref|YP_003436457.1| Bifunctional DNA primase/polymerase [Ferroglobus placidus DSM
           10642]
 gi|288894645|gb|ADC66182.1| Bifunctional DNA primase/polymerase [Ferroglobus placidus DSM
           10642]
          Length = 882

 Score = 84.5 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 58/174 (33%), Gaps = 14/174 (8%)

Query: 13  GFGILCGIGTHPVYAFDVDVLD------EQVVDRFNNEFQSCCGKPISRVGQAPKTLMLF 66
           G  I+ G  +  +   D D  +       ++ +  +N ++      +   G+        
Sbjct: 72  GIAIVTGSVSGNLAVIDFDNREVLSDFLAELYESDSNLYEKFINTWVVETGK--GFHYYL 129

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
           R+++ + K   +   I+  ++  A G   VA      + + Y +   P     E++  L+
Sbjct: 130 RVKDPDPKLFHNRIGIREGIDIRAEGGFVVAPPSPHPSGKQYRFVNKP-----EKIAELS 184

Query: 127 PDEVEYFFEFFDTI-TTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
            +E        +   T P +             S + R  +  EI   ++    
Sbjct: 185 WEEYLTLLRILERNETLPEEGLTEEISAKDSLTSKDERELSESEILEIVNLLKP 238


>gi|227496702|ref|ZP_03926977.1| bifunctional DNA primase/polymerase [Actinomyces urogenitalis DSM
           15434]
 gi|226833799|gb|EEH66182.1| bifunctional DNA primase/polymerase [Actinomyces urogenitalis DSM
           15434]
          Length = 290

 Score = 84.5 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 34/131 (25%), Gaps = 8/131 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR----VG 57
           VA   + +     G++           D+D  + +     +       G          G
Sbjct: 48  VAAWWEQWPTALIGLV---VPPGAVVVDIDPRNLEEGSNPSTVLDDLTGPLPDTLTSWSG 104

Query: 58  QA-PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
           +      + F        ++         ++    G      + HP T + Y W      
Sbjct: 105 RGDGGRHLWFAAPALPEGRRWRNPAPGVDVKSPGRGYVIAPPSPHPATGQPYRWQDTATG 164

Query: 117 LKVEELPLLTP 127
                LP L+ 
Sbjct: 165 YARLPLPALSA 175


>gi|324014360|gb|EGB83579.1| virulence-associated protein E [Escherichia coli MS 60-1]
          Length = 730

 Score = 84.5 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 189 PPAITGEQLETLWQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLD 248

Query: 176 CFGEEFY 182
               E Y
Sbjct: 249 GANGERY 255


>gi|295696541|ref|YP_003589779.1| Bifunctional DNA primase/polymerase [Bacillus tusciae DSM 2912]
 gi|295412143|gb|ADG06635.1| Bifunctional DNA primase/polymerase [Bacillus tusciae DSM 2912]
          Length = 269

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 49/174 (28%), Gaps = 11/174 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V      +    + I+ G  +  V   D+D    +             G P+ + G+   
Sbjct: 55  VMRWAQEHPGCNWAIVTGAVS-GVVVLDLD--SPEAAQEIKQRGVEDVG-PVVKTGK--G 108

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             + FR         ++  K+   ++    G    A      +   Y W+     L++E 
Sbjct: 109 WHLYFRHPG---HPVQNAVKLLPGVDVRGDGGYVAAPPSVHPSGAVYRWAKGRSILEIEP 165

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P   P+ VE               +           +    +    +  A L+
Sbjct: 166 PP--LPEWVEELLNQPQEPAGGVSIQLEGIGDDIERIALGVGQGERNQATARLA 217


>gi|220923968|ref|YP_002499270.1| bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
 gi|219948575|gb|ACL58967.1| Bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
          Length = 970

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/185 (10%), Positives = 37/185 (20%), Gaps = 23/185 (12%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDV-DVLDEQVVDRFNNEFQSCCGKPISRV--GQ 58
           +      +     GI  G  T  V   D+ D              +   G P + +    
Sbjct: 58  IRAWWTKHPRAMIGIPTGARTGNVLDLDLGDPAVITGAAYLERLREHVGGIPETAIAETG 117

Query: 59  APKTLMLFRM-------------------QETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
           +    + FR                          +    +     ++    G   +   
Sbjct: 118 SGGLHLWFRADPDAPIANGANICPALFIPPTEGATRADGRKAKGAAIDVRGEGGYVIVPP 177

Query: 100 IHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKS 159
              +  RAYTW   P    +          +                 +          S
Sbjct: 178 SVREDGRAYTWCPGPEDG-LSPPTEALLRLMRKEEARAARDAQTEAASRGPWAPRPADGS 236

Query: 160 HNNRR 164
              R 
Sbjct: 237 DPARS 241


>gi|218555124|ref|YP_002388037.1| hypothetical protein ECIAI1_2654 [Escherichia coli IAI1]
 gi|218361892|emb|CAQ99492.1| conserved hypothetical protein; putative virulence-associated
           protein E [Escherichia coli IAI1]
          Length = 728

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 189 PPAITGEQLETLWQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLD 248

Query: 176 CFGEEFY 182
               E Y
Sbjct: 249 GANGERY 255


>gi|291283822|ref|YP_003500640.1| putative P-loop ATPase-like protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763695|gb|ADD57656.1| Predicted P-loop ATPase-like protein [Escherichia coli O55:H7 str.
           CB9615]
          Length = 728

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 189 PPAITGEQLETLWQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLD 248

Query: 176 CFGEEFY 182
               E Y
Sbjct: 249 GANGERY 255


>gi|332088051|gb|EGI93176.1| hypothetical protein SB521682_2984 [Shigella boydii 5216-82]
          Length = 753

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 55/180 (30%), Gaps = 6/180 (3%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP--K 61
               +    G  +  G     V A D D+ D  + +   N   SC G+   R  +A   K
Sbjct: 78  ARWSNEPDYGICVRTG---DGVVALDCDINDAGMQEIVRNIILSCLGELPPRRWRADSHK 134

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+    E     +E LA GQQFVA   HP       W        ++ 
Sbjct: 135 CLYLIAVDGDYRKRGHRLEGENKQIELLAKGQQFVACGTHPA-GERIQWDCGLPGEPLKI 193

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
                    +   +      +        R LS +  S  +     ++   +      + 
Sbjct: 194 TSEQLESLWQRLADNLPVKDSYTAGAGRQRDLSCVDPSATDDVADWLDANGWTLSVSSDG 253


>gi|262043412|ref|ZP_06016537.1| virulence-associated E family protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039238|gb|EEW40384.1| virulence-associated E family protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 729

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 57/175 (32%), Gaps = 12/175 (6%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
                    G  +  G   +   A D D  D  V  +  +      G    R  +  + K
Sbjct: 77  ARWSKEPDYGICVRTG---NGWLALDCDSEDVDVQQKIRDLLAQLLGVVPPRRRRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  ++    K+    E   G +E LA GQQFVA   H  +     W         ++
Sbjct: 134 CLYLLGVEGDFRKRIHRLEGELGIIELLANGQQFVACGTH-SSGARIEWDNEL----PDD 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
            P +T D++E  ++    +       ++    SK+            E   +L  
Sbjct: 189 PPAVTTDQLETLWQQLADVLPVSVTTEA--GSSKMRDRSTFTPGATDETAEYLDA 241


>gi|331648291|ref|ZP_08349380.1| virulence-associated E family protein [Escherichia coli M605]
 gi|331042840|gb|EGI14981.1| virulence-associated E family protein [Escherichia coli M605]
          Length = 728

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 189 PPAITGEQLETLWQRLAEQLPVSVTTEAGSTKMRDRSTFTPGATDDTAEYLDANGWTLLD 248

Query: 176 CFGEEFY 182
               E Y
Sbjct: 249 GANGERY 255


>gi|317508622|ref|ZP_07966280.1| bifunctional DNA primase/polymerase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253089|gb|EFV12501.1| bifunctional DNA primase/polymerase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 679

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/171 (11%), Positives = 38/171 (22%), Gaps = 7/171 (4%)

Query: 7   DHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS-CCGKPISRVGQAPKTLML 65
           +       G+  G  +   +A DVD              +       +     +      
Sbjct: 68  EENPRYNVGVRTGKVS-GFFALDVDPRHGGDETLAALVAEHGALPATVVVRTGSGGQHYY 126

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
           F++ E       ++  I   L+    G   VA          Y +   P    +   P  
Sbjct: 127 FQLPEDFEVGN-NKSYIGDGLDVRGKGGFVVAPPSASGEGG-YRFESDPETTAIAPAP-- 182

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
               +E      +         +       + +S   R             
Sbjct: 183 -EWLLELLRPKANEQEAEAVVVEDLPDRDGMPESVQRRYDAYARAAVASEA 232


>gi|260845231|ref|YP_003223009.1| putative replication protein [Escherichia coli O103:H2 str. 12009]
 gi|257760378|dbj|BAI31875.1| probable replication protein [Escherichia coli O103:H2 str. 12009]
          Length = 728

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 56/187 (29%), Gaps = 16/187 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APK 61
               +    G  +  G G     A D D  DE +            G+   R  +  + K
Sbjct: 77  ARWSNEPDYGICVRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGESPPRRWRANSNK 133

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+        G +E LA GQQFVA   H  +     W         +E
Sbjct: 134 CLYLLAVDGDFRKRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDE 188

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLS 175
            P +T +++E  ++            +        R       + +   Y +      L 
Sbjct: 189 PPAITGEQLETLWQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLD 248

Query: 176 CFGEEFY 182
               E Y
Sbjct: 249 GANGERY 255


>gi|220915119|ref|YP_002490424.1| hypothetical protein Mnod_7767 [Methylobacterium nodulans ORS 2060]
 gi|219952973|gb|ACL63358.1| hypothetical protein Mnod_7767 [Methylobacterium nodulans ORS 2060]
          Length = 846

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 70/247 (28%), Gaps = 37/247 (14%)

Query: 3   ATDVDHYVY---NGFGILCGIGTH-----PVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS 54
           A +V+ +        G++ G          V A D DV         N   +        
Sbjct: 56  AAEVETWQRPERASMGLILGPQPSLPPDEHVVAVDADVFTPAAATAVNEILERRLPGAPH 115

Query: 55  RVGQAPKTLMLF------------RMQETNLKKQKSEEKIQGH--LEFLAYGQQFVAYNI 100
           R+G   K    F            R Q        + +  + H  +E L  GQQ V +  
Sbjct: 116 RLGNPAKVGTRFVRTKTADGSEPVRRQGRRFIFDGAPDTKENHNRVELLGQGQQSVVHGT 175

Query: 101 HPKTQRAYTWSIAPHALK--VEELPLLTPDEVEYFFEFFDTITTPRDKE----KSYRKLS 154
           HP    AY W      ++    ELPL+  DE+       DT             ++ +  
Sbjct: 176 HP-CGVAYAWPSGTSIVEMHPSELPLIPIDELNAIIAECDTAMEAAGGVLVSGATFSRSG 234

Query: 155 KIWKSHNNRRYTNIEIRAFLSCFGEEFYN-GSHDEWI---PVVMAIHYETRGSAE----G 206
           +     +          A LS   +   +  S + W+       A+     G        
Sbjct: 235 RNGGGADLTALVEANAEALLSGLADTRNDISSRNRWVMFTKAFAALCLPALGEDRVAEAL 294

Query: 207 KEIVREW 213
                 W
Sbjct: 295 FRFTDRW 301


>gi|323173146|gb|EFZ58777.1| hypothetical protein ECLT68_2560 [Escherichia coli LT-68]
          Length = 565

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 55/180 (30%), Gaps = 6/180 (3%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP--K 61
               +    G  +  G     V A D D+ D  + +   N   SC G+   R  +A   K
Sbjct: 48  ARWSNEPDYGICVRTG---DGVVALDCDINDAGMQEIVRNIILSCLGELPPRRWRADSHK 104

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
            L L  +     K+    E     +E LA GQQFVA   HP       W        ++ 
Sbjct: 105 CLYLIAVDGDYRKRGHRLEGENKQIELLAKGQQFVACGTHPA-GERIQWDCGLPGEPLKI 163

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
                    +   +      +        R LS +  S  +     ++   +      + 
Sbjct: 164 TSEQLESLWQRLADNLPVKDSYTAGAGRQRDLSCVDPSATDDVADWLDANGWTLSVSSDG 223


>gi|109287999|ref|YP_654693.1| hypothetical protein MIV121R [Invertebrate iridescent virus 3]
 gi|123808611|sp|Q196T9|VF184_IIV3 RecName: Full=Putative helicase 121R
 gi|106073622|gb|ABF82151.1| hypothetical protein MIV121R [Aedes taeniorhynchus iridescent
           virus]
          Length = 941

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/212 (11%), Positives = 59/212 (27%), Gaps = 32/212 (15%)

Query: 29  DVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEF 88
           D+D   E  +D   N+     G   S   +  +   ++      +   +           
Sbjct: 181 DIDDAPENFIDDVTNKCWLMYGSSKSEDKKPYRISQVYSGNLEPMDLYE----------- 229

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVE--------YFFEFFDTI 140
                   A++I P     YT    P  + V+ +  + P  +            +    +
Sbjct: 230 --------AFSIKP----FYTKEEEPITVTVDNVKKILPQLLSISSIKKEVLNVKTPMDL 277

Query: 141 TTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYET 200
             P              ++    +    + +  L    ++     ++ W  + + +    
Sbjct: 278 KIPTKIYLKQELKDIEGENSETIKRNLKDAKDLLKILNKKR-ANEYNSWWDIGIILFNIG 336

Query: 201 RGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            G  +   I  +W      YD  +    W+S 
Sbjct: 337 HGCEDAFTIWDKWSSYSDKYDPDACVQVWNSM 368


>gi|325292915|ref|YP_004278779.1| regulatory protein RepA [Agrobacterium sp. H13-3]
 gi|325060768|gb|ADY64459.1| putative regulatory protein RepA [Agrobacterium sp. H13-3]
          Length = 747

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/226 (11%), Positives = 60/226 (26%), Gaps = 27/226 (11%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVD--VLDEQVVDRFNNEFQSCCGKP-ISRVG 57
           ++      Y     G+  G  T   +A D+D         D  +         P  +RV 
Sbjct: 79  LIERMWTKYPKAAVGLPTGEKT-GFFALDIDNKPGGANGFDWLSEMEAEHGPLPDTARVT 137

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                L ++      +   ++   +   ++  + G   +A        R+Y W       
Sbjct: 138 SPNGGLHIYF---KYVVGTRNRGALGAGVDIRSEGGYVLAAGSTMANGRSYKWET----- 189

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
              E+       ++                 +   LS    +       + E+       
Sbjct: 190 DTREIADAPAWLLDLLL-------PKSAPAHTQYSLSAATNNAYVDAAVDRELADLAGAP 242

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEI-------V-REWCK 215
                N  +D    +   +     G +E + +         R+W +
Sbjct: 243 MGSRNNALNDAAFSIGTIVGAGALGESEARALLQDVARGWGRDWSR 288


>gi|183984415|ref|YP_001852706.1| hypothetical protein MMAR_4444 [Mycobacterium marinum M]
 gi|183177741|gb|ACC42851.1| hypothetical protein MMAR_4444 [Mycobacterium marinum M]
          Length = 400

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/235 (14%), Positives = 61/235 (25%), Gaps = 22/235 (9%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           +V      +   G  +  G     +   DVDV  E V D      +S   +  +    + 
Sbjct: 59  VVREWWRRWPDAGIAVHVG--GCGLVVVDVDVP-ENVPDSLWVLLESAAFRSTTTDADSK 115

Query: 61  KTLMLFRMQET-----NLKKQKSEEKIQGHLEFLAYGQQFVA-YNIHPKTQRAYTWSIAP 114
           +    +R++        L + K  +  +   E   YG   V     HP+    Y  +   
Sbjct: 116 RGYYFYRLRRGELFGCGLGRLKPPKGKRWG-EVKCYGGAVVLGPTEHPREGGRYATAPGG 174

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
                  LP    D +    +          +  +  K        N+  +    I    
Sbjct: 175 TLSY---LPAEIADGLNAP-DTDRAEAVTPGELAARVKAFLETNIDNDAPHALAPI---C 227

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYE----TRGSAEGKEIVREWC-KLGRTYDEKS 224
             F     N     W  +  A+                +   W   +G  Y    
Sbjct: 228 RSFDPSPTNRHPTMWDALCWAMREAKAGRFPARDAAIALRARWTDAIGGQYRGGD 282


>gi|327198746|emb|CCA61447.1| unnamed protein product [Diadromus pulchellus ascovirus 4a]
          Length = 925

 Score = 82.5 bits (202), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/242 (12%), Positives = 64/242 (26%), Gaps = 43/242 (17%)

Query: 10  VYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQSCCGKPISRV------GQAP 60
              G G LCG      +  D D       +        +    G+  + V       ++ 
Sbjct: 36  RGQGLGALCGEK-GGFFVVDCDLLKSDAPESFVAGTEAWLDLVGEMPAHVEYPQVRTRSG 94

Query: 61  KTLMLFRM-QETNLKKQKSE---------EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                F          Q+           +     ++ +A G+  V           Y W
Sbjct: 95  GLHAYFAWDPRVKSSVQRYRVCDLFEGEADDRTVKIDIIADGRYIVCPPTP-----GYAW 149

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
                 +     P +  + ++  F     +   R    ++R + K               
Sbjct: 150 LHNSQYVSP---PPMPRELLDLLFPEPADVDRARALCTTFRNVDKAT------------- 193

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIH-YETRGSAEGKEIVREWCKLGRTYD-EKSFNAK 228
            A++            DEW+ VV A+     +   +  ++   + +    Y   +   A 
Sbjct: 194 LAYVVEGIPARRADVRDEWMRVVWAVADTAAKNGYDALDVADAFSRRSHKYAGPEDVEAM 253

Query: 229 WD 230
           + 
Sbjct: 254 YR 255


>gi|283851766|ref|ZP_06369044.1| Bifunctional DNA primase/polymerase [Desulfovibrio sp. FW1012B]
 gi|283572886|gb|EFC20868.1| Bifunctional DNA primase/polymerase [Desulfovibrio sp. FW1012B]
          Length = 832

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/174 (10%), Positives = 37/174 (21%), Gaps = 12/174 (6%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQSCCGKPISRVGQ--- 58
               +     G   G      +  DVD   +  E          ++  G   + V Q   
Sbjct: 89  WWQRWPDAAIGCPTGPA-LGAWVLDVDLPKIPGEPDGRDTLARLEADHGALPATVTQRTG 147

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
           +      F+      + + +  KI   L+    G   +           Y W+       
Sbjct: 148 SGGEQRFFKWSPDGPEIKNTGSKIGPKLDTRGAGGYVIMPPSLHPAGNRYAWTSNGV--- 204

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
             EL       +E              +  +         +             
Sbjct: 205 --ELAEAPAWLIELILVKPTPEPRMERQASTRTATGYGRAALEAEASKVASAPQ 256


>gi|289644930|ref|ZP_06476972.1| Bifunctional DNA primase/polymerase [Frankia symbiont of Datisca
           glomerata]
 gi|289505239|gb|EFD26296.1| Bifunctional DNA primase/polymerase [Frankia symbiont of Datisca
           glomerata]
          Length = 212

 Score = 81.8 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 34/126 (26%), Gaps = 13/126 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +   +         +  G  +  +   D+D      +DR                G    
Sbjct: 68  IHAMLTTIPAGLLAVRTGAVS-GLVVVDIDPGHGGRLDRTL-----MTPTATVATGG-GG 120

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + ++   T +  +         ++  A G    A    HP T R Y W        V 
Sbjct: 121 WHLYYQHPGTPVLSRPLPGH--VGIDIKADGGYVTAPPSTHPTTGRPYQWV---GTRPVN 175

Query: 121 ELPLLT 126
           E+P   
Sbjct: 176 EMPPAL 181


>gi|325106784|ref|YP_004267852.1| Bifunctional DNA primase/polymerase [Planctomyces brasiliensis DSM
           5305]
 gi|324967052|gb|ADY57830.1| Bifunctional DNA primase/polymerase [Planctomyces brasiliensis DSM
           5305]
          Length = 687

 Score = 81.8 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/237 (12%), Positives = 53/237 (22%), Gaps = 22/237 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC-CGKPISRVGQAP 60
           +            GI        +   DVD +D   +      F                
Sbjct: 43  IEQWWTETPNANIGIAT----AGLVVVDVDGIDNSWLQGEEELFSQLSLNAVCMT--PRN 96

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIH-----PKTQRAYTWSIAPH 115
            T   F        K  S  K+  +++    G   V    +        +  Y W     
Sbjct: 97  GTHFWFTQPAGEPVK-CSAGKVAPNVDIRGDGGYVVVPPSYIEDDKKGIKGKYQWVYPQI 155

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTP------RDKEKSYRKLSKIWKSHNNRRYTNIE 169
                EL       +         +             +    L++I  S      +  E
Sbjct: 156 LGMRSELTPAPEWLMRQLNGSPKELAKDFGGGNIIPSGQRNTALARIAGSVRRIGCSEHE 215

Query: 170 IRAFLSCFGEEFYNGSHD--EWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
           IR+ L     +  +   D  E   +  +I               +W      +  + 
Sbjct: 216 IRSLLRAVNSQRCDPPIDNTEVDRIARSI-ARYEPDQTAVSHHEDWAGQDDEHAPQV 271


>gi|86739908|ref|YP_480308.1| hypothetical protein Francci3_1201 [Frankia sp. CcI3]
 gi|86566770|gb|ABD10579.1| conserved hypothetical protein 2SC10A7.05c [Frankia sp. CcI3]
          Length = 295

 Score = 81.4 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 42/186 (22%), Gaps = 14/186 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +   +         I  G     +   D+D  +   +DR      S      +       
Sbjct: 68  IVAMLAAVPDGLLAIRTGTAA-GLAVIDIDPRNGGTLDR------SLMTPTAAVATGGGG 120

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +R                  ++  A G   VA    HP T R Y W+       V 
Sbjct: 121 WHLYYRHPG--HPVLSRPLTGAPGIDIKADGGLVVAPPSLHPTTGRPYQWA---GTRPVA 175

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           E+P      V            PR    +            +     +           E
Sbjct: 176 EMPPALIAAVAA-DPPMTKPAPPRSCTPARVSSRAGEAGGISNPAALLAAHLAAVARAPE 234

Query: 181 FYNGSH 186
               + 
Sbjct: 235 GRRRTT 240


>gi|289642846|ref|ZP_06474982.1| Bifunctional DNA primase/polymerase [Frankia symbiont of Datisca
           glomerata]
 gi|289507323|gb|EFD28286.1| Bifunctional DNA primase/polymerase [Frankia symbiont of Datisca
           glomerata]
          Length = 300

 Score = 81.4 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 39/160 (24%), Gaps = 13/160 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           VA  +         I  G     +   D+D      +D                 G    
Sbjct: 68  VAAMLSAAPRGLLAIRTGALA-GLVVVDIDPGHGGRLDPAL-----MTPTAAVASGG-GG 120

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + +      +  ++     +  ++  A G   VA    HP T+  Y W+       V 
Sbjct: 121 WHLYYAHPGPPVLSRRLPG--RTGVDVKADGGYVVAPPSIHPVTRTPYRWTARQT---VG 175

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
           E+P      V          T P        +        
Sbjct: 176 EMPPPLHAAVTAPAAPSSQPTRPPATAGPPARRPTGGDDS 215


>gi|33864892|ref|NP_896451.1| hypothetical protein SYNW0356 [Synechococcus sp. WH 8102]
 gi|33638576|emb|CAE06871.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 656

 Score = 81.4 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 37/140 (26%), Gaps = 12/140 (8%)

Query: 14  FGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS--RVGQAPKTLMLFRMQET 71
            G   G     +  FD+D L    +                  R   + +  + FR+ + 
Sbjct: 64  VGTRLGPDAGGIVCFDIDGL--SAISELIRMGIEHQPVTWMVGRNTDSNRYKLFFRVPKE 121

Query: 72  NLKKQKSE----EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTP 127
             +    +          +E      Q +    H ++   Y W+        E +  +  
Sbjct: 122 RWEHLPGKCEVKADGNEKVEIFWSTGQCIVAGEHRQSGGEYVWTQR----NPERIAPIPD 177

Query: 128 DEVEYFFEFFDTITTPRDKE 147
           D    + +        R  +
Sbjct: 178 DWWALWQKAMAKTENRRSHK 197


>gi|331028101|ref|YP_004421815.1| integrase [Roseobacter phage RDJL Phi 1]
 gi|301341564|gb|ADK73448.1| integrase [Roseobacter phage RDJL Phi 1]
          Length = 802

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 67/232 (28%), Gaps = 37/232 (15%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLD------EQVVDRFNNEFQSCCGKP---ISRVGQAPKT 62
              G+  G         D+D             + F    +               +   
Sbjct: 66  YNVGVRLGA---GDLVLDIDPRGFPEGETLATDNPFKRLCKDVGLNVDEFPRVETGSGGL 122

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEE 121
            +     E    +  S       +EF ++G+Q V+    HP T+  Y+W      L    
Sbjct: 123 HIYMSKPEDVSTR-DSLNDQYPGVEFKSFGRQVVSAGSIHPDTKLPYSWDFLYPELDELG 181

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
            P      ++                +     +      +       E+   L     E 
Sbjct: 182 TPSAPKLLIDLI--------------RRPTGSAATGGGEH----DQEELAEMLDQLDPED 223

Query: 182 YNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE--KSFNAKWDS 231
           ++  HD W+ ++ A H+ T G   G++   EWC     Y +       +WDS
Sbjct: 224 FS-DHDSWLTLMQACHHATAGD--GRQEFIEWCTRDPEYSDHGTIIGLRWDS 272


>gi|254504973|ref|ZP_05117124.1| hypothetical protein SADFL11_5012 [Labrenzia alexandrii DFL-11]
 gi|222441044|gb|EEE47723.1| hypothetical protein SADFL11_5012 [Labrenzia alexandrii DFL-11]
          Length = 1485

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 58/187 (31%), Gaps = 8/187 (4%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRM 68
           Y  +  G+L       +   DVD     +VD   +  +S  G  +++VG    ++ + R+
Sbjct: 79  YP-HNIGVLL---NDGLVCVDVDTDHPGIVDAVEDWARSLGGDYVAKVGGKGVSVFV-RL 133

Query: 69  QETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIA--PHALKVEELPLLT 126
           ++ +L            ++ LA G+Q +       + + Y W          +++LP L 
Sbjct: 134 EDPDLHLPGKLHVGDHLIDILASGRQTIVPPSMHTSGKRYRWVGDVALEDSSLDDLPSLN 193

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSH 186
               +   +           + S     + ++     +Y                     
Sbjct: 194 ETAWQALLDALGVHG-DLAGKGSALGSGQSYEKDGFSKYLEDLATESFDHMARWMRPLEL 252

Query: 187 DEWIPVV 193
                V 
Sbjct: 253 ARIQRVG 259


>gi|220922585|ref|YP_002497887.1| bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
 gi|219947192|gb|ACL57584.1| Bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
          Length = 970

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/188 (11%), Positives = 41/188 (21%), Gaps = 26/188 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDV-DVLDEQVVDRFNNEFQSCCGKPISRV--GQ 58
           +      +     GI  G  T  V   D+ D              +   G P + +    
Sbjct: 58  IRAWWAKHPRAMIGIPTGARTGNVLDLDLGDPAVITGAAYLERLREHVGGIPETAIAETG 117

Query: 59  APKTLMLFRM-------------------QETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
           +    + FR                          +    +     ++    G   +   
Sbjct: 118 SGGLHLWFRADPDAPIANGANICPALFIPPAEGATRADGRKAKGAAIDVRGEGGYVIVPP 177

Query: 100 IHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKS 159
              +  RAYTW   P       L   T   +    +           E + R       +
Sbjct: 178 SVREDGRAYTWCPGPEDG----LSPPTEALLRLMRKEEARAARDAQAEAASRGPWVPRPT 233

Query: 160 HNNRRYTN 167
            +      
Sbjct: 234 DSIDPAQV 241


>gi|148252805|ref|YP_001237390.1| putative phage / plasmid primase P4 [Bradyrhizobium sp. BTAi1]
 gi|146404978|gb|ABQ33484.1| putative Phage / plasmid primase P4 [Bradyrhizobium sp. BTAi1]
          Length = 749

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 46/178 (25%), Gaps = 17/178 (9%)

Query: 3   ATDVDHY----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVG- 57
             ++  Y        +G+  G  ++ ++  D+D           ++  S  GK    V  
Sbjct: 45  KKELKRYFRNNPQANYGVSTGGTSN-IFVLDIDGR---AGKHSLSKLISEHGKLPRTVTV 100

Query: 58  -QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                    FR   T ++       +   L+    G   V       + + Y++      
Sbjct: 101 LTGSGEHRYFRGNGTPIRNSSGR--LGEGLDIRGDGGYVVGPGSIHPSGKVYSFKEGRAL 158

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTP----RDKEKSYRKLSKIWKSHNNRRYTNIEI 170
             V  +    P  +           T          S R  + +  + +         
Sbjct: 159 DDVA-IAKAPPWLLSLISSDRPHQATRMQLEVPTNNSRRLAAYLVAAQDRELERLSRA 215


>gi|292491152|ref|YP_003526591.1| phage/plasmid primase, P4 family [Nitrosococcus halophilus Nc4]
 gi|291579747|gb|ADE14204.1| phage/plasmid primase, P4 family [Nitrosococcus halophilus Nc4]
          Length = 715

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 51/174 (29%), Gaps = 14/174 (8%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV---GQAPKT 62
              +     G+  G  +   +  DVDV      ++   E +S  G     +     +   
Sbjct: 48  WRRWPKANIGLATGEDS-GCFVLDVDVKKGAPGEQSLEELESEYGVLPETLKAKTPSGGF 106

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
              F+     L    +    +  L+    G   +      +  +AY W            
Sbjct: 107 HYFFQHPGGRLG---NRANFRPGLDIRGDGGYVLVAPSVVE-GKAYNWLNEGTP------ 156

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
           P   PD +          T P    ++ + +++  ++ +  RY    +   L  
Sbjct: 157 PAEAPDWLLELLHEGPKPTVPGGAAQALKGVAEGQRNDSVFRYAASLLHRGLRY 210


>gi|75675821|ref|YP_318242.1| ATPase [Nitrobacter winogradskyi Nb-255]
 gi|74420691|gb|ABA04890.1| RecA-family ATPase [Nitrobacter winogradskyi Nb-255]
          Length = 666

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 69/241 (28%), Gaps = 42/241 (17%)

Query: 4   TDVDHY----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP------I 53
             +D +        FG++       +   D+D   +   +     +   C         +
Sbjct: 51  EQIDKWARENPGCNFGVV--AFASNLIIVDIDTKGDNGREEAWALWAELCASWGLPAALV 108

Query: 54  SRVGQAPKTLMLFRM--QETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
             V        ++       +    +  + I+G +     G   VA   +    R Y   
Sbjct: 109 PHVQSPSGGWHVYCTVPDGVDAATLRQPDAIKGRINIRCIG-YTVAAGSYYD-GRPYQLM 166

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
                              E   +     T    + +S +             ++  ++R
Sbjct: 167 PGAPPPHPAP---------EGLIQHCSGGTRKVTEHRSRQGE-----------HSLRDVR 206

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
           + L+   E     S+++WI +  A+        +G E+      +   Y     + KW++
Sbjct: 207 SMLAWMNERDAFDSYEDWISIGQALKICF--WDDGLELWESV-TVAGRYS---CDQKWET 260

Query: 232 F 232
           F
Sbjct: 261 F 261


>gi|312199632|ref|YP_004019693.1| bifunctional DNA primase/polymerase [Frankia sp. EuI1c]
 gi|311230968|gb|ADP83823.1| Bifunctional DNA primase/polymerase [Frankia sp. EuI1c]
          Length = 311

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 15/136 (11%), Positives = 34/136 (25%), Gaps = 11/136 (8%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ-A 59
           ++A   + +      + C      +   DVD    +   +                G+  
Sbjct: 46  VIAGWWERWPAASIAVAC--KPSGLTVVDVDGPAGRASWQALTARHGQAPTTSVTTGRDD 103

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFL----AYGQQFVAYNIHPKTQRAYTWSIAPH 115
                 +R    +      +  +   ++        G   +A      + R Y W     
Sbjct: 104 GGIHYWYRAPHVDPPGNS-KGLVGAGIDVRGAGEGAGGMVLAPPSRHPSGRRYQWCDRLS 162

Query: 116 ALKVEELPLLTPDEVE 131
              + ELP       +
Sbjct: 163 ---LAELPAWLRRLAQ 175


>gi|289704576|ref|ZP_06501009.1| bifunctional DNA primase/polymerase [Micrococcus luteus SK58]
 gi|289558696|gb|EFD51954.1| bifunctional DNA primase/polymerase [Micrococcus luteus SK58]
          Length = 686

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/256 (12%), Positives = 65/256 (25%), Gaps = 31/256 (12%)

Query: 3   ATDVDHY------VYNGFGILCGIGTHPVYAFDV---------DVLDEQVVDRFNNEFQS 47
           A D+D +       +   G  CG  +  +   ++         DV            ++ 
Sbjct: 42  AADLDAWFGGDDPRHRAIGAACGALSGGLEMLEIEGAHVGLLEDVGRAAGAAGLLELWER 101

Query: 48  CCGKPISRVGQAPKTLMLFRMQE---TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKT 104
             G    R   +      +R++        K  + E  Q   E    G Q V       T
Sbjct: 102 VNGGWCERS-PSGGVHWFYRVEGMDVPGNVKLAATEARQTIAETRGQGGQVVLAPSGGTT 160

Query: 105 QRAYT-WSI-APHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNN 162
            +    W         V  L     + +   F   D       + +    L+    +   
Sbjct: 161 HKTGRAWERLDGGPATVPTLTAAERETLHGLFRALDRAPARTVEHRPASTLAPADGARPG 220

Query: 163 RRYTNIEIRAFLSC---FGEEFYNGSHDEWIPVVMAIH---YETRGSAEGKEIVREWCKL 216
             Y        L     +      G+   W     +       T     G  +       
Sbjct: 221 DLYAARTTWDELLTRHGWQVHHRAGAETHWTRPGKSTAEGPSATTREDGGLYVF----ST 276

Query: 217 GRTYDEKSFNAKWDSF 232
              +D ++  +K+ ++
Sbjct: 277 STAFDPETPYSKFGAY 292


>gi|23014441|ref|ZP_00054257.1| hypothetical protein Magn03008885 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 286

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 43/175 (24%), Gaps = 6/175 (3%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL-DEQVVDRFNNEFQSCCGKPISRVGQAP 60
           V    D       GI  G  +  + A DVD   D                     +    
Sbjct: 66  VQRWFD-GRSLNIGIATGTIS-GIIALDVDPRHDGDTTLAGLEAEHGPLPPTWRFLTGGG 123

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
              +LFR          S   +   L+    G   VA      ++RAY  S+  H   V 
Sbjct: 124 GEHILFRHPGG--TVANSAGLLGPGLDVRGDGGYIVAPPSRHISRRAYAISVDHHPNDVL 181

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
             P      ++              +   +R       +   R      +   L 
Sbjct: 182 LAPP-PEWLMQRLSRRKPAAKDAPQERTDWRGHVGATHAEGTRNTALASLTGHLL 235


>gi|298530805|ref|ZP_07018207.1| Bifunctional DNA primase/polymerase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510179|gb|EFI34083.1| Bifunctional DNA primase/polymerase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 500

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 36/143 (25%), Gaps = 14/143 (9%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV--GQ 58
           ++            G   G  +  V+A D D+ D    D       +    P +R     
Sbjct: 54  IIRKWWTRNPDAQIGTPTGPAS-GVWALDEDLPDGP--DTLEQLIDTYGPLPPTRTQQTG 110

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
           +     LF       + + S  KI   ++    G   +       +   Y W        
Sbjct: 111 SGGKQFLFSWNG--CQVRNSTSKIGPDIDVRGDGGYIILPPSGHPSGGVYQWINELS--- 165

Query: 119 VEELPLLTPDEVEYFFEFFDTIT 141
               P   PD +           
Sbjct: 166 ----PAAAPDWLSELALNPRRPK 184


>gi|239834270|ref|ZP_04682598.1| ATPase-like protein [Ochrobactrum intermedium LMG 3301]
 gi|239822333|gb|EEQ93902.1| ATPase-like protein [Ochrobactrum intermedium LMG 3301]
          Length = 727

 Score = 78.7 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 18/216 (8%), Positives = 49/216 (22%), Gaps = 16/216 (7%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQ-VVDRFNNEFQSCCGKPISRVGQA 59
           +V            G+  G      +  D+D                      ++    +
Sbjct: 66  IVRELWRRNPGAMIGVPTGAP-IGAWVLDIDPKHGGPDTLAALEAEHGALPATLTAETTS 124

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                 F+    +    ++   +   ++    G   +A    P   + Y W +    +  
Sbjct: 125 GGRHYFFK----HKAGVRNRGALGAGIDVRGDGGYVIAACSVPAVGQPYRWLVDMEPVD- 179

Query: 120 EELPLLTPDEVEYFFE--FFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
                     +E      +  T                + ++  +           +   
Sbjct: 180 -----APDWLLELVLPRSYDSTTMYQAPSVSGTINDRYVERAVQSELDDL--AMEPMGNR 232

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREW 213
                + +      V      E+   A  +++ R W
Sbjct: 233 NNRLNDAAFRLGTFVGAGALAESEARALLQDVARGW 268


>gi|91787211|ref|YP_548163.1| Phage/plasmid primase P4-like protein [Polaromonas sp. JS666]
 gi|91696436|gb|ABE43265.1| Phage/plasmid primase P4-like protein [Polaromonas sp. JS666]
          Length = 771

 Score = 78.3 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 22/146 (15%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLD---EQVVDRFNNE--FQSCCGKPISRVGQAPKTLML 65
               G+       P  A D+D +        +R  +     +  G      G+  +  +L
Sbjct: 70  SCNIGLAHAYSNPPTCALDIDNMSLARPWFAERGIDLDALLNAPGAVRIHSGRPGRAKLL 129

Query: 66  FRMQET------NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
           +R+ +          + +               Q  +  + HP T R Y W        +
Sbjct: 130 YRLPQPLPSCTLPWGELRCASGNGTTW------QDVLPPSTHPDTGRPYAWI-----GDI 178

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRD 145
             +  +    +  + +          
Sbjct: 179 ANIQPIPDAPLSAWRQQLAAKGRKEP 204


>gi|171913150|ref|ZP_02928620.1| primase, putative [Verrucomicrobium spinosum DSM 4136]
          Length = 599

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 54/175 (30%), Gaps = 10/175 (5%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML 65
           + H      G+L G  +  + A D+D  D   V+ F             R   A    + 
Sbjct: 7   LQHLQTGNIGVLLGKESDNLCAIDIDDDD--SVEPFLELNPRLRSTT--RTKGARGVQLW 62

Query: 66  FRMQETNLK--KQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA--LKVEE 121
            R      K  K ++EE      E+ A G Q V + IHP +   Y   +A     +   E
Sbjct: 63  IRCNGEYPKVTKIENEEGHPCG-EWRADGGQSVIHGIHP-SGVEYRILVATSPILIAFSE 120

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
           +   +  ++ +    +D I               I  +         +    +  
Sbjct: 121 ITWPSDWQLPWVKSPYDRIVDEEGPPVLEAANGGITLNQMFFVTKYTQEHKCIYH 175


>gi|189426164|ref|YP_001953341.1| P4 family phage/plasmid primase [Geobacter lovleyi SZ]
 gi|189422423|gb|ACD96821.1| phage/plasmid primase, P4 family [Geobacter lovleyi SZ]
          Length = 695

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 38/105 (36%), Gaps = 6/105 (5%)

Query: 130 VEYFFEFFDTITTPRDKEKSYRKLSK--IWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
            E F    +     + +     KL +    +           +++ L     +      +
Sbjct: 120 PEEFRLLIEKALLAKGEPLPAVKLDQVAADEFSIKTPADIANLKSALPAISPD----GRE 175

Query: 188 EWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           EWI V M +H+E  GS EG  +  EW +    + ++    KW  F
Sbjct: 176 EWICVGMGLHHEFAGSEEGLALWEEWSRGSTKFKDEECPEKWAGF 220


>gi|260904380|ref|ZP_05912702.1| hypothetical protein BlinB_03562 [Brevibacterium linens BL2]
          Length = 310

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/154 (11%), Positives = 44/154 (28%), Gaps = 9/154 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS--CCGKP-ISRVGQ 58
           V    D       G+  G  +  V   DVD+ ++       N        G   +     
Sbjct: 60  VQAWWDQIPNANIGLPTGHPS-GVVVVDVDLHEKVNGYDAINRAHDAGKLGHWEVVTRTP 118

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIH-PKTQRAYTWSIAPHAL 117
           +    +++    T   +Q+S +  +  ++F   G   +    H     + + + +     
Sbjct: 119 SGGAHLIY--PATPATQQRSWQAARAGVDFRGDGGYIIVPPSHRHIDGQQHHYRLDQVNN 176

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYR 151
                  +    +  F +    +  P  +     
Sbjct: 177 GP--ATAVDAQGLRDFLDPRPAVPAPESRGTRRT 208


>gi|118581963|ref|YP_903213.1| hypothetical protein Ppro_3564 [Pelobacter propionicus DSM 2379]
 gi|118504673|gb|ABL01156.1| hypothetical protein Ppro_3564 [Pelobacter propionicus DSM 2379]
          Length = 734

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 40/108 (37%), Gaps = 5/108 (4%)

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT-NIEIRAFLSCFGEEFYNGS 185
            + VE           P+   +    L    +       T   +I A L+    +     
Sbjct: 240 QEIVEGLKLELRQKNEPKTAIERQHNLGFDKQIDQEANDTSIQKIEALLNRIDADC---G 296

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE-KSFNAKWDSF 232
           +D+W+ V MA+ +ET GS EG  +   W   G  Y   K    KW SF
Sbjct: 297 YDDWLHVGMAVFHETSGSDEGLALFDRWSSKGSKYKGIKEIEYKWRSF 344


>gi|332186933|ref|ZP_08388674.1| phage/plasmid primase, P4 family, C-terminal domain protein
           [Sphingomonas sp. S17]
 gi|332012943|gb|EGI55007.1| phage/plasmid primase, P4 family, C-terminal domain protein
           [Sphingomonas sp. S17]
          Length = 947

 Score = 76.4 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/218 (11%), Positives = 47/218 (21%), Gaps = 32/218 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDR--------------------F 41
           +      +     G+  G     +   D D     V+DR                     
Sbjct: 63  IRAWWRKWPRAMIGVAVGRA--GLIVIDFDPGVYDVIDRKTKEITGQEEWTLEQLKDALA 120

Query: 42  NNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIH 101
                    + ++ V ++      F+M         +   +  H++    G   +A   H
Sbjct: 121 ERMEGEMLPETLTSVTRSGGEHQWFKMPAGE--PIGNTGSLPNHIDVRGLGGYVIAPPSH 178

Query: 102 -----PKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
                      Y W I         +       V          T    +  +      +
Sbjct: 179 FEGNDDDAPGDYRWLI---DGDASRIAECPEALVAIMRAPPPRNTVDHARPAAGAARFVV 235

Query: 157 WKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVM 194
               + RRY    + + L         G          
Sbjct: 236 DLDASTRRYAMHALDSELQELSSTPKAGGRHGGRNQGA 273


>gi|313903458|ref|ZP_07836849.1| phage/plasmid primase, P4 family [Thermaerobacter subterraneus DSM
           13965]
 gi|313466279|gb|EFR61802.1| phage/plasmid primase, P4 family [Thermaerobacter subterraneus DSM
           13965]
          Length = 849

 Score = 76.4 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 43/188 (22%), Gaps = 18/188 (9%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML 65
              Y     GI        +   D+D  D    +             +S         + 
Sbjct: 69  WSEYPKANIGIRL--EESGLIVVDIDDPDAVPPEDRQRF--DLYEDYVST---GRGKHIY 121

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
           FR  +  + K   + + +   E    G   VA     ++ + Y WS     +  E     
Sbjct: 122 FRRNDLPIPKAAIDLRKERGWEIRLRG-YVVAPPSRHRSGKEYRWSRGIEVVHPE----- 175

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
            PD +                                   T   IR     FG      S
Sbjct: 176 VPDWIAEIIRAASEQKVQDVNIDWDHLPDVDISRIPLSIETRELIR-----FGAPKGARS 230

Query: 186 HDEWIPVV 193
              W  + 
Sbjct: 231 EAIWRVIG 238


>gi|315501675|ref|YP_004080562.1| bifunctional DNA primase/polymerase [Micromonospora sp. L5]
 gi|315408294|gb|ADU06411.1| Bifunctional DNA primase/polymerase [Micromonospora sp. L5]
          Length = 719

 Score = 76.0 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 38/150 (25%), Gaps = 12/150 (8%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLD----EQVVDRFNNEFQSCCGKPISRVGQAP-KT 62
                   +  G     +   DVD  D     +                 S         
Sbjct: 68  KLRAGNIALRLGH---GLIGVDVDAYDDKPGAETFKVLQERLGDLPPTWRSSSRDDGISG 124

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           + LFR +    +   + E   G +EF+ YG    +       + R Y W         +E
Sbjct: 125 IYLFRCRPGRRRGSPAPED-GGGIEFVQYGHRYVICAPSLHPSGRQYVWFSPDGEALEDE 183

Query: 122 L--PLLTPDEVEYFFEFFDTITTPRDKEKS 149
              P   P   E +  +         ++  
Sbjct: 184 APDPEELPWLPEAWDRYLMRDDPVVGEDAP 213


>gi|85059138|ref|YP_454840.1| hypothetical protein SG1160 [Sodalis glossinidius str. 'morsitans']
 gi|84779658|dbj|BAE74435.1| hypothetical protein [Sodalis glossinidius str. 'morsitans']
          Length = 214

 Score = 76.0 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 40/122 (32%), Gaps = 11/122 (9%)

Query: 4   TDVDHY--VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG--KPISRVGQA 59
             +D++     G  +  G     + A D D  DE          +   G   P      A
Sbjct: 81  AMLDNWEEPDYGICVRTGR---GLIALDCDNEDEGHHAIIEQVLRDTLGCLPPCRFRKNA 137

Query: 60  PKTLMLFRMQETNLK---KQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
            K L L        K   +   E+     +E LA GQQF+A  IHP +     W  A   
Sbjct: 138 NKCLYLLNAPFERRKGVLRLPDEDGRPAQIELLATGQQFMAAGIHP-SGARIVWRFALSK 196

Query: 117 LK 118
             
Sbjct: 197 YP 198


>gi|195546631|ref|YP_002117659.1| p101 [Rhizobium phage 16-3]
 gi|102642581|gb|ABF71362.1| p101 [Rhizobium phage 16-3]
          Length = 722

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 18/171 (10%), Positives = 43/171 (25%), Gaps = 10/171 (5%)

Query: 7   DHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR---VGQAPKTL 63
           + Y     G+  G      +  D+D   ++    +  E ++  G              T 
Sbjct: 79  ERYPGALIGLPTGEP-LGAWVLDLDRHGDRDGHAWLAEMEAKHGALPETARASTANGGTH 137

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL--KVEE 121
           + F+    ++   ++   I   ++    G             R Y W          + +
Sbjct: 138 IFFK----HVAGIRNRAAIAPGVDTRGDGGYVCGPGSQMADGRRYQWIDYDGDGLPPIAD 193

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
            P    D ++           P               +  +      ++R 
Sbjct: 194 APAWLIDLLKPKVVEAAERRQPSTYTYQPEDSGAARYAAKSFEMELEKLRN 244


>gi|163782228|ref|ZP_02177227.1| hypothetical protein HG1285_18884 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882760|gb|EDP76265.1| hypothetical protein HG1285_18884 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 880

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 55/193 (28%), Gaps = 22/193 (11%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
              I+CG  +  V   D+D  ++ +   R  ++         S +       + F+    
Sbjct: 64  NLCIVCGEVS-GVVVLDIDGPEKFKAWLREKDKGLKSPLSIPSAIKTGKGFHIWFKHPSE 122

Query: 72  NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE---------L 122
           ++  ++  E      E    G   +       +   Y W +      +E          L
Sbjct: 123 DIGVRRFPE---HGFELRGTGGIVIVPPSLHPSGGIY-WPLHLEERSLEALLSWLKKLTL 178

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
           P L    +E              +   Y   +   +     + T  +++  L      F+
Sbjct: 179 PELPDWLLEV-------AKEDEKRAIRYESDTPTLEGVELSQETAQKLKTLLKEDLLPFW 231

Query: 183 NGSHDEWIPVVMA 195
              H   +   ++
Sbjct: 232 TEGHRHELACGIS 244


>gi|167920131|ref|ZP_02507222.1| phage/plasmid primase, P4 family protein [Burkholderia pseudomallei
           BCC215]
          Length = 761

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/162 (12%), Positives = 42/162 (25%), Gaps = 13/162 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVL--DEQVVDRFNNEFQSCCGKPISR--VGQA 59
              +           G  +  V   DVDV   D   +   +   +     P +R     +
Sbjct: 52  AWANECPDYNVAYATGPASGYVLVVDVDVKNGDATGLKSISRLEKEHGPLPPTRKVFTPS 111

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
               +++R  E    K  S       ++  A G   +A          Y +        V
Sbjct: 112 GGYHLIYRYPENL--KVPSRINFLPRVDVKAEGGYCLAPPSI-INDEPYFY-----DEPV 163

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN 161
             +       +E            + K    +  +   ++ +
Sbjct: 164 LPISRAPAWLLE-LLCSTQGTKPRKRKSAKSKSATIGNRNES 204


>gi|288918371|ref|ZP_06412724.1| Bifunctional DNA primase/polymerase [Frankia sp. EUN1f]
 gi|288350266|gb|EFC84490.1| Bifunctional DNA primase/polymerase [Frankia sp. EUN1f]
          Length = 794

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 42/150 (28%), Gaps = 14/150 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           + T V  +    +G +       +   D+D            +          R G+   
Sbjct: 74  IRTWVRQWPGCNWGGVT----AGLVVVDLDGPRGADGWAALVDEHGEAPTLTHRTGR--G 127

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +++R   T  K   S  KI   ++  A G   V       + R Y    A   ++   
Sbjct: 128 RHLIYRQNGT--KVSNSASKIADSIDIRADGGYVVLPGSLHPSGRLYETEQAGAVVE--- 182

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYR 151
                   V        T T+  D  +  R
Sbjct: 183 ---APRWLVVSATAPRSTATSSTDGPRPGR 209


>gi|256006071|ref|ZP_05431004.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum DSM
           2360]
 gi|255989961|gb|EEU00110.1| Bifunctional DNA primase/polymerase [Clostridium thermocellum DSM
           2360]
          Length = 207

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 29/114 (25%), Gaps = 4/114 (3%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            GI  G  +  +   DVD   ++ +              ++ V     
Sbjct: 62  IRKWWTKTPNANIGIPTGEKSDWLV-LDVDDGGDETISALEAT-HGKLPDTVTAVTGRGG 119

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
              +F+  +      K++      L+  +     V       +   Y W     
Sbjct: 120 RHYVFKYPQGRSIPNKTK--FAPDLDTRSTDGLIVVAPSIHVSGNQYQWLEGHS 171


>gi|187251854|ref|YP_001876336.1| bifunctional DNA primase/polymerase [Elusimicrobium minutum Pei191]
 gi|186972014|gb|ACC98999.1| Bifunctional DNA primase/polymerase [Elusimicrobium minutum Pei191]
          Length = 255

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/178 (10%), Positives = 51/178 (28%), Gaps = 20/178 (11%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
              + +  G  ++ +   D+D     D+ +         +         G        F+
Sbjct: 71  SCNWAVATGKPSN-IVVVDIDFRKDGDKSIAPY------NLPSTYTVSTG--NGFHYYFK 121

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTP 127
           +     +   S+  +   ++F A G   +       +  AY      + + + ++P    
Sbjct: 122 LPMQY-QYLASKINLLQGVDFKANGGYVIIPPSIHISGAAYK---MHNDITIADIPANLL 177

Query: 128 DEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
           + +    +        R+ +     +   +     R      +  +LS   E+     
Sbjct: 178 EVILRQVKNNIFREGERNSQLFRIGVGFAYN----RSKEKSRLTKYLSVVNEDRCYPP 231


>gi|160898867|ref|YP_001564449.1| P4 family phage/plasmid primase [Delftia acidovorans SPH-1]
 gi|160364451|gb|ABX36064.1| phage/plasmid primase, P4 family [Delftia acidovorans SPH-1]
          Length = 857

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 71/237 (29%), Gaps = 27/237 (11%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
           Y G G    I    + A D D          +   ++      +    +   L  F +  
Sbjct: 72  YTGLGFAP-IANGGIVALDFDG-CVSGGQITDARIEALISDTYAEFSPSGTGLRAFYLGA 129

Query: 71  TNLKKQKSEEKIQGH-------------LEFLAYGQQFVAYN-IHPKTQRAYTWSIAPHA 116
              +K  + +  +               +EF  +           P TQ    W +    
Sbjct: 130 MASRKDNAHKSKRVGGQAGAARLDGLFDIEFFGHNGFVTVTGKATPDTQ---LWGLQDTV 186

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
             + +       ++                     + +          +T  + R +L  
Sbjct: 187 APLSQ----GVQQLYAQRFGDTGPLPAVGAVALAGEANLAALGPEKLGWTMDQAREYLF- 241

Query: 177 FGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE-KSFNAKWDSF 232
             +   + S  EW+  +MA+H+E  GS +  ++  EW   G +Y   K    +WDSF
Sbjct: 242 --DCKASVSRAEWLNALMALHHEFDGSEDALDLADEWSATGDSYAGRKDVEGRWDSF 296


>gi|315442842|ref|YP_004075721.1| bifunctional DNA primase/polymerase famiily protein [Mycobacterium
           sp. Spyr1]
 gi|315261145|gb|ADT97886.1| bifunctional DNA primase/polymerase famiily protein [Mycobacterium
           sp. Spyr1]
          Length = 353

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/190 (11%), Positives = 37/190 (19%), Gaps = 17/190 (8%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVL-DEQVVDRFNNEFQSCCGKPI-SRVGQ 58
           +VA     Y  +  G   G     +   DVD                           G+
Sbjct: 97  IVAWWSGRYAGHNIG---GRVPANIVVVDVDPRSGGDESLAALERQHGRMPDAFGEISGR 153

Query: 59  A-PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHA 116
                   FR     L   +    +   ++   +    V     HP T R Y        
Sbjct: 154 GDGGRHYWFRAPAGPLSSSR----LGRGIDIKTHSGYVVLPPSIHPDTGRPYE----KVD 205

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSK--IWKSHNNRRYTNIEIRAFL 174
             +   P      +        T T       +                     E  ++ 
Sbjct: 206 GPITPPPAWLAGLLLPEQPKPSTSTRAMTPATARTAHDFFNTGTGTGLSIEKFNENTSWR 265

Query: 175 SCFGEEFYNG 184
                  +  
Sbjct: 266 DVLEPHGWRP 275


>gi|221213691|ref|ZP_03586665.1| phage/plasmid primase, P4 family [Burkholderia multivorans CGD1]
 gi|221166480|gb|EED98952.1| phage/plasmid primase, P4 family [Burkholderia multivorans CGD1]
          Length = 487

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/155 (12%), Positives = 41/155 (26%), Gaps = 13/155 (8%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVL--DEQVVDRFNNEFQSCCGKPISR--VGQAPKTLMLF 66
                   G  +  V   DVDV   D   +   +   +     P +R     +    +++
Sbjct: 15  DYNVAYATGPASGYVLVVDVDVKNGDATGLKSISRLEKEHGPLPPTRKVFTPSGGYHLIY 74

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
           R  E    K  S       ++  A G   +A          Y +        V  +    
Sbjct: 75  RYPENL--KVPSRINFLPRVDVKAEGGYCLAPPSI-INDEPYFY-----DEPVLPISRAP 126

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN 161
              +E            + K    +  +   ++ +
Sbjct: 127 AWLLE-LLCSTQGTKPRKRKSAKSKSATIGNRNES 160


>gi|269837505|ref|YP_003319733.1| Bifunctional DNA primase/polymerase [Sphaerobacter thermophilus DSM
           20745]
 gi|269786768|gb|ACZ38911.1| Bifunctional DNA primase/polymerase [Sphaerobacter thermophilus DSM
           20745]
          Length = 458

 Score = 73.3 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 27/112 (24%), Gaps = 12/112 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQSCCGKPISRVGQ 58
           V      +     GI  G     +   DVD     D  +        +     P  R G 
Sbjct: 80  VREWWALWPDANIGIALG--GGRLVVLDVDRRHGGDATLAAVEREY-EPLPPAPAVRTG- 135

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                + +        +      +   LE    G   VA      +   Y W
Sbjct: 136 -DGLHLYYAA----GGRPVPTRVLGPGLELRGDGAYVVAPPSIHPSGTRYQW 182


>gi|126727690|ref|ZP_01743522.1| Hypothetical prophage lsa1protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126703106|gb|EBA02207.1| Hypothetical prophage lsa1protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 184

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 45/124 (36%), Gaps = 10/124 (8%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVD--RFNNEFQSCCGKPISRV---GQAPKTLMLFR 67
           G GI+CGI +  +   D+D  D    D        ++  G   + V    Q+    + FR
Sbjct: 59  GIGIVCGIDS-GLLVIDIDTDDGHGADGPTSLAALEAKHGTLPATVEAKTQSGGRHLYFR 117

Query: 68  -MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
            +    +        I   ++    G   VA      T   Y W  +P+  ++ + P   
Sbjct: 118 YLDGPQIG--NGAGVIGPGIDHRGEGGFVVAPPS-QGTYGDYLWVRSPNDHEIADCPGWL 174

Query: 127 PDEV 130
            D++
Sbjct: 175 IDKM 178


>gi|291335468|gb|ADD95080.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C348]
          Length = 243

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 23/66 (34%), Gaps = 4/66 (6%)

Query: 167 NIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFN 226
             E    +     E  +  +D WI V  ++H          +   EW K    Y E   +
Sbjct: 1   MQEAVEAMWAMPPEAAD-DYDIWITVGQSLHSV---DDTLLDPWDEWSKQSSKYKEGECH 56

Query: 227 AKWDSF 232
            +W SF
Sbjct: 57  RRWLSF 62


>gi|239905658|ref|YP_002952397.1| hypothetical protein DMR_10200 [Desulfovibrio magneticus RS-1]
 gi|239795522|dbj|BAH74511.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 677

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 37/131 (28%), Gaps = 10/131 (7%)

Query: 15  GILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP-KTLMLFRMQETNL 73
           G+ CG  +  V   DVD + +       N  +        + G    +    F+      
Sbjct: 82  GVACGPAS-GVLVLDVDDMGKFREWLAANVGEELPATLTVKTGGIGERYHFYFQYPND-- 138

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVEY 132
            ++     ++   +    G + +     HP+T++ Y           E L         Y
Sbjct: 139 GQRYPNRSVKDVFDIRGVGGEVLCPGSLHPETRKPY-----IIVESPENLAPAPDWLRNY 193

Query: 133 FFEFFDTITTP 143
                     P
Sbjct: 194 SLYRTIKPLAP 204


>gi|227542783|ref|ZP_03972832.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227181409|gb|EEI62381.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 259

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 42/172 (24%), Gaps = 12/172 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +        +   G+            DVD  +  + D         C      +  +  
Sbjct: 39  IIKWWTERPHANIGLR---VPAGCLVVDVDPRNGGIADYRRLFPNGSCPYTARTITGSGG 95

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + F +  +     ++       ++     +  V     HPKT RAY W       +  
Sbjct: 96  LHLYFTLPYSG----ETNAHFGKGIDLQGRKRLTVLPPSIHPKTHRAYKWWPFLPPEQWA 151

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
            LP    +                 +      + +          T +E + 
Sbjct: 152 PLP----EWCLPHVYKVPDTKPKVPEHIRRHYMKQSKDPGAGLIRTVVEAQE 199


>gi|194430133|ref|ZP_03062636.1| replication protein [Escherichia coli B171]
 gi|194411843|gb|EDX28162.1| replication protein [Escherichia coli B171]
 gi|323159199|gb|EFZ45189.1| virulence-associated protein E family protein [Escherichia coli
           E128010]
          Length = 642

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 54/175 (30%), Gaps = 16/175 (9%)

Query: 16  ILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--APKTLMLFRMQETNL 73
           +  G G     A D D  DE +            G+   R  +  + K L L  +     
Sbjct: 1   MRTGHGW---LALDCDSEDEDIQADIRKTLVQLLGELPPRRWRANSNKCLYLLAVDGDFC 57

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYF 133
           K+        G +E LA GQQFVA   H  +     W         +E P +T +++E  
Sbjct: 58  KRIHRLAGDMGIIELLANGQQFVACGTH-SSGARIEWDGGL----PDEPPAITGEQLETL 112

Query: 134 FEFFDTITTPRDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
           ++            +        R       + +   Y +      L     E Y
Sbjct: 113 WQRLAEQLPVSVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLDGANGERY 167


>gi|49188486|ref|YP_025316.1| hypothetical protein pIT3_6 [Sulfolobus solfataricus]
 gi|46560102|gb|AAT00521.1| RepA [Sulfolobus solfataricus]
          Length = 915

 Score = 71.7 bits (174), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 58/214 (27%), Gaps = 34/214 (15%)

Query: 4   TDVDHY---VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNN-------EFQSCCGKPI 53
            +V  +         I+ G  +  +   D D  D  V   F +                I
Sbjct: 73  EEVRKWFRDPSTNIAIITGAVSGNLVGIDFD--DPNVYTDFADKLFYDPILGDKAYSTWI 130

Query: 54  SRVGQAPKTLMLFRMQETNL----KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYT 109
           ++ G+     + FR+           ++  +    H++  A G  FVA      +   Y 
Sbjct: 131 TKTGK--GYHIYFRIDVDKGVFKQIFRQKIDIEGKHIDMKAEGGYFVAPPSIHPSGSRYE 188

Query: 110 WSIAP-------------HALKVEELPLLTPDEVEYFFEFFDTITT---PRDKEKSYRKL 153
           +   P                 ++ L +   + +       D+ T      ++ K     
Sbjct: 189 FLAGPPMNKEPAVLSLKEWERLLKLLGVEPWEGLLRILNAPDSATPGNGKAEQRKEQSAS 248

Query: 154 SKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
                  N ++    EI          +  G  D
Sbjct: 249 QTPRNVSNCKKLGEKEILRIEELLEPYYVEGHRD 282


>gi|33865636|ref|NP_897195.1| hypothetical protein SYNW1102 [Synechococcus sp. WH 8102]
 gi|33632806|emb|CAE07617.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 688

 Score = 71.4 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 38/129 (29%), Gaps = 9/129 (6%)

Query: 14  FGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE--- 70
            G+  G  +  +   D+D        + +       G  I R     +  + F++ +   
Sbjct: 59  VGVRPGPDSDNLLFIDIDGASALTFCQEHRCDLKDAGWIIRRTTADDRLKVAFQINDQEL 118

Query: 71  ----TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
               +++ K          LE      Q V    H  +   Y W       +++      
Sbjct: 119 EEELSDIGKTVHSTGAGEQLELFWSTGQCVVLGDHKTSGGQYVWE--GSPAEIDSPTEPW 176

Query: 127 PDEVEYFFE 135
            + ++   +
Sbjct: 177 RELIKLLIQ 185


>gi|255323766|ref|ZP_05364892.1| bifunctional DNA primase/polymerase, N- family [Corynebacterium
           tuberculostearicum SK141]
 gi|255298946|gb|EET78237.1| bifunctional DNA primase/polymerase, N- family [Corynebacterium
           tuberculostearicum SK141]
          Length = 242

 Score = 71.4 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/187 (12%), Positives = 46/187 (24%), Gaps = 14/187 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V +    Y     G         V   D+DV    +             + ++ +  +  
Sbjct: 30  VRSWWSTYPTANIG---ANPPRGVVVIDIDVKHGGIESWAQLTAGHVVPETLTVLTGSGG 86

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
             + FR+     K +         ++   +    V     HP T   Y   +      + 
Sbjct: 87  WHLWFRLPYQG-KLRGQLAATDSGIDVKTHTGYLVMPPSVHPDTGGLY---LLHTWAPIA 142

Query: 121 ELPLLTPDEVEYFFEFFDTITT------PRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
            LP      V                  P D     R +++  +   N+       RA  
Sbjct: 143 PLPQWLYRHVYAPLRATRPARPGLLTIAPGDGAGLIRVVAESEEGQRNKVLFWAACRAAE 202

Query: 175 SCFGEEF 181
                + 
Sbjct: 203 DGLNIDR 209


>gi|25028716|ref|NP_738770.1| hypothetical protein CE2160 [Corynebacterium efficiens YS-314]
 gi|23494002|dbj|BAC18970.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 293

 Score = 70.6 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 38/177 (21%), Gaps = 12/177 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V    + +     G         +   D+D  +    D +           +  +  +  
Sbjct: 89  VQAWWEKWPGANIG---ATPPKGMVVLDIDPRNGGW-DTWVELGGLEVPDTLMMLTGSHG 144

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
               F +        +        ++   +    V     HP T   Y   +  H     
Sbjct: 145 LHYWFTLP--YSGDVRGTAG--EGVDVKTHTGYVVVPPSVHPTTGMHY---LIAHWCTPV 197

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            LP      V             +  E     L    +     +  N+   A     
Sbjct: 198 VLPTWLRAHVYKPLPKPVQARRVQLGESPGAGLVATVEQAGEGQRNNVLHWAACRAL 254


>gi|284504180|ref|YP_003406895.1| D5 family helicase-primase [Marseillevirus]
 gi|282935618|gb|ADB03933.1| D5 family helicase-primase [Marseillevirus]
          Length = 903

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 45/118 (38%), Gaps = 4/118 (3%)

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRK-LSKIWKSHNNRRYTNIEIRA--FLS 175
            ++LP +   +             P +K+ + RK  +++ K+ +       E+R    L 
Sbjct: 246 PKDLPYILSIQRRREPTPIVRGIIPSEKKMTRRKRPARLTKTVDQIMADIAEVRNSRVLD 305

Query: 176 CFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
                    ++D+W+ V   +     G  E  E+  ++      +DEK     WD+ +
Sbjct: 306 MLDSSR-AENYDDWMNVGWTLFNIGNGLPEALELWIDFSSRASNFDEKKCEYLWDTME 362


>gi|259507777|ref|ZP_05750677.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259164570|gb|EEW49124.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 289

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 38/177 (21%), Gaps = 12/177 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V    + +     G         +   D+D  +    D +           +  +  +  
Sbjct: 85  VQAWWEKWPGANIG---ATPPKGMVVLDIDPRNGGW-DTWVELGGLEVPDTLMMLTGSHG 140

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVE 120
               F +        +        ++   +    V     HP T   Y   +  H     
Sbjct: 141 LHYWFTLP--YSGDVRGTAG--EGVDVKTHTGYVVVPPSVHPTTGMHY---LIAHWCTPV 193

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            LP      V             +  E     L    +     +  N+   A     
Sbjct: 194 VLPTWLRAHVYKPLPKPVQARRVQLGESPGAGLVATVEQAGEGQRNNVLHWAACRAL 250


>gi|119869598|ref|YP_939550.1| hypothetical protein Mkms_3566 [Mycobacterium sp. KMS]
 gi|119695687|gb|ABL92760.1| conserved hypothetical protein [Mycobacterium sp. KMS]
          Length = 717

 Score = 69.8 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 54/192 (28%), Gaps = 22/192 (11%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK-----TLM 64
             +  G+        V   DVD    +       E Q   G          +      + 
Sbjct: 82  PGHNIGLRL---PDGVIGIDVDAYGPKKGADTFAEAQGRWGALPPSYRSTSRDDGISGIR 138

Query: 65  LFRMQE--TNLKKQKSEEKIQGHLEFLAYGQQFVA--YNIHPKTQRAYTWSI------AP 114
           L+R+          + ++     +E +    + V    +IH KT + Y W          
Sbjct: 139 LYRVPAGTKLETIIEFKDLDIRDIEIVQRHHRHVQCWPSIHDKTGQRYRWVSELDGSAMD 198

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
                ++LP L    V        +  TP +  ++   +       +        +   L
Sbjct: 199 TPPAPDDLPNLPAAWVAALRAESGSNGTPLNGAEAPVDVQTALTEGDASPR----VAELL 254

Query: 175 SCFGEEFYNGSH 186
           +    + Y GS 
Sbjct: 255 ARAIGDCYGGSR 266


>gi|226363434|ref|YP_002781216.1| hypothetical protein ROP_40240 [Rhodococcus opacus B4]
 gi|226241923|dbj|BAH52271.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 904

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 44/162 (27%), Gaps = 17/162 (10%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVD----RFNNEFQSCCGKPISRVGQA 59
              +    +   +        +   DVD  D++       R    +       IS     
Sbjct: 60  AWTEDKPASNIALR---MPKNIIGIDVDAYDKKQGAVTFARALELWGPLPDTWISTSRND 116

Query: 60  P-KTLMLFRMQETNLKKQKSEEKIQGHLEF--LAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
               +  F + E    +   E      +E     +    VA ++HP T   Y W +    
Sbjct: 117 GVSGIRFFTIPEGTALRTIIELDGTKDIEIVQYFHRYAIVAPSVHPLTSSTYRWVMPDGT 176

Query: 117 L-------KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYR 151
                   +  ELP L    +            P D + + R
Sbjct: 177 DAPETVVPEPHELPTLPDRWLTALEAPIVDTLQPVDVQAALR 218


>gi|78212480|ref|YP_381259.1| hypothetical protein Syncc9605_0942 [Synechococcus sp. CC9605]
 gi|78196939|gb|ABB34704.1| hypothetical protein Syncc9605_0942 [Synechococcus sp. CC9605]
          Length = 321

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/190 (10%), Positives = 43/190 (22%), Gaps = 32/190 (16%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS-RVGQA 59
           +   ++ +      G++       +  FD D          +             R    
Sbjct: 52  IKELIEQFPRAKSIGVITQP----LLCFDFDGATAVNHAVLDGRDPDDVNTWRINRTTDK 107

Query: 60  PKTLMLFRMQET-------------NLKKQKSEEK----------IQGHLEFLAY-GQQF 95
            +  +LF   +              +  K+ S E+               E   + G+Q 
Sbjct: 108 NRFKLLFLPSKEQLAQLPNGQITNTHRTKRPSTERYPYEEMTFVVKGEAEEIFCHPGRQV 167

Query: 96  VAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSK 155
           +    HP +   Y W        +   P              D        +K+      
Sbjct: 168 IVAGAHPASGGHYFWPNGSGPEALSAPPA--EWWGHVLTLARDYPHPAAGADKTVSTSRF 225

Query: 156 IWKSHNNRRY 165
              +     +
Sbjct: 226 ASGNWQRLEH 235


>gi|239905583|ref|YP_002952322.1| hypothetical protein DMR_09450 [Desulfovibrio magneticus RS-1]
 gi|239795447|dbj|BAH74436.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 665

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 52/172 (30%), Gaps = 29/172 (16%)

Query: 15  GILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG------KPISRVGQAP-KTLMLFR 67
           GI CG  +  V   DVD         F    Q              + G    +    F+
Sbjct: 90  GIACGPAS-GVLVLDVDN-----HHLFEAWIQEKHPDEPLPVTLKVKTGGHGERFHYYFQ 143

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLT 126
                  +Q S   ++G  E    G Q +     HP+T++ Y        + VE  P++ 
Sbjct: 144 YPSG--DEQYSCRSVKGIFEIRGIGGQILCPGSLHPETRKPY--------IFVEIAPIMP 193

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG 178
                 +       +    ++K + + S               +  FLS F 
Sbjct: 194 APL---WLLEMSKKSY--GRKKDHDEQSPPEGIRKKHILEIDLVDTFLSNFN 240


>gi|302343152|ref|YP_003807681.1| Bifunctional DNA primase/polymerase [Desulfarculus baarsii DSM
           2075]
 gi|301639765|gb|ADK85087.1| Bifunctional DNA primase/polymerase [Desulfarculus baarsii DSM
           2075]
          Length = 624

 Score = 69.0 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 40/134 (29%), Gaps = 19/134 (14%)

Query: 3   ATDVDHY---VYNGFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRVGQ 58
           A ++  +        G++ G  ++ +   D D  +     +    +          R   
Sbjct: 38  AGELADWFGKPGAMVGVVTGKVSN-LLVVDADNSEAISRAEALLPDGLELPIATTPR--- 93

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
                  F  +E      K+   +   ++  A G   VA    P   R   W +AP    
Sbjct: 94  --GRHYYFAHREGM----KNAVGVMPAVDVRAEGGYVVAP---PGPGR--EWLVAPWDCA 142

Query: 119 VEELPLLTPDEVEY 132
             ELP    D V  
Sbjct: 143 PPELPAQLEDVVRA 156


>gi|85716250|ref|ZP_01047224.1| Hypothetical Membrane Spanning Protein [Nitrobacter sp. Nb-311A]
 gi|85696922|gb|EAQ34806.1| Hypothetical Membrane Spanning Protein [Nitrobacter sp. Nb-311A]
          Length = 853

 Score = 69.0 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/240 (8%), Positives = 48/240 (20%), Gaps = 32/240 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--- 58
           +      Y     G         +   DVD    +   +     ++          Q   
Sbjct: 83  IQAVWGRYPILNIGCF----NEDLILIDVDTKAGKHGAKSLALLEALYEGLPLTYTQRSA 138

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGH---LEFL-AYGQQFVAYNIHPKTQRAYTWSIAP 114
           +      +R     +   K+          ++         V                  
Sbjct: 139 SGGYHFTYRAPPQIVVTIKTCSNKIVGFPDIDIRAGRTGYIVGAGSSTAVGEY----TVE 194

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
             L + + P    D +              D+  +    S+      +          +L
Sbjct: 195 KDLPIADAPQWLIDLL----------PKVHDRRATRNGDSQTPLVELDTESAIARAADWL 244

Query: 175 SCFGEEFYNGSHDEWIPVVMAIH------YETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
                E   G+  +     +A H         +      +   +  K    +       K
Sbjct: 245 ENNAPEAVQGAGGDAETYKVACHVKGFGISPEKCLELMLDHWNDI-KASPPWKPDELEEK 303


>gi|315640373|ref|ZP_07895488.1| prophage Lp4 protein 7 [Enterococcus italicus DSM 15952]
 gi|315483878|gb|EFU74359.1| prophage Lp4 protein 7 [Enterococcus italicus DSM 15952]
          Length = 265

 Score = 68.7 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 49/190 (25%), Gaps = 27/190 (14%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRF--NNEFQSCCGKPISRVGQAP 60
                +Y  +  GI  G  T  +   D+DV +           +        +       
Sbjct: 45  KEHWVNYPESNLGIRVGEDT-GLIVLDIDVHEVDGYKTLSAIEKVHEPLPNTLEVATPTG 103

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
                F++ E    + + +      ++ L  G   VA        + Y          + 
Sbjct: 104 GKHYYFKLPEG--IQIERQINQFAGIDILTNG-YVVAPPSSID-GKKYE----IVNGSLN 155

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           E+ +     ++ F          +      +K +                 AFL      
Sbjct: 156 EIAIFPTWFLKVFDTKKMNELPVKPFFTVGKKYTG----------------AFLDELVAG 199

Query: 181 FYNGSHDEWI 190
              G  ++WI
Sbjct: 200 CAKGGRNDWI 209


>gi|239905623|ref|YP_002952362.1| hypothetical protein DMR_09850 [Desulfovibrio magneticus RS-1]
 gi|239795487|dbj|BAH74476.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 680

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 50/172 (29%), Gaps = 29/172 (16%)

Query: 15  GILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG------KPISRVGQAP-KTLMLFR 67
           GI CG  +  V   DVD         F    Q              + G    +  + F+
Sbjct: 90  GIACGPAS-GVLVLDVDN-----HHLFEAWIQENHPDEPLPVTLKVKTGGHGERFHLYFQ 143

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLT 126
                  +Q     ++G  +    G Q +     HP+T++ Y   +    + +   P+  
Sbjct: 144 YPLG--DEQYFCRSVKGTFDIRGIGGQVLCPGSLHPETRKPY---VVVENVSIAPAPMWL 198

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG 178
            +                  +K++ + +    +          +  FLS   
Sbjct: 199 LEM----------SKKSHGGKKNHYEQNPPESTSKKHILEIAPVDTFLSNLN 240


>gi|159037549|ref|YP_001536802.1| bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
 gi|157916384|gb|ABV97811.1| Bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
          Length = 377

 Score = 67.9 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 38/140 (27%), Gaps = 18/140 (12%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL----------DEQVVDRFNNEFQSCCGK 51
           +          G G+ CG     +   D+DV            + +    +    S    
Sbjct: 142 IRRAWTARP-YGIGLACGP--SHLVVVDLDVPKDDSGGGPSGTDTLAALASQHGASIDAT 198

Query: 52  PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                G+   T + +R  +     + +   +   ++  A+G   VA        R YT  
Sbjct: 199 YTVTTGR-GGTHLYYRHPDGGPDLRNTAGTLGPMVDTRAHGGYVVAAGS-TAAGRPYT-- 254

Query: 112 IAPHALKVEELPLLTPDEVE 131
                     LP      + 
Sbjct: 255 -VSLDTDPAPLPAWLAGLLA 273


>gi|33603114|ref|NP_890674.1| hypothetical protein BB4140 [Bordetella bronchiseptica RB50]
 gi|33568745|emb|CAE34503.1| phage-related hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 700

 Score = 67.5 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 57/224 (25%), Gaps = 48/224 (21%)

Query: 14  FGILCGIGTHPVYA--FDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ---APKTLMLFRM 68
            G   G      +    D D + + ++    N+         SR G              
Sbjct: 108 LGFALGPDESGGHWQGIDFDDIPQNLLSDLANDVHGYVEVSPSRKGAHAIGYGRHF---- 163

Query: 69  QETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPD 128
                    +       +E  A G+ F                       +  L     +
Sbjct: 164 --------ATLGHNGTGIEAYAKGRYFTV------------TEQRIRDGGLICLAAYIEE 203

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
            +            PR   +       + +       T  E+R+ L     E     +  
Sbjct: 204 TLA-----------PRHGARRATNAG-MTEVVPVNAKTVTELRSALLYMRAE----DYHL 247

Query: 189 WIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           W+ + +A+         G+ +  EW      +D K    KW+SF
Sbjct: 248 WVNMGLALREL---GETGRGLWMEWSATSEKFDSKDAAKKWNSF 288


>gi|108800482|ref|YP_640679.1| hypothetical protein Mmcs_3516 [Mycobacterium sp. MCS]
 gi|119869621|ref|YP_939573.1| hypothetical protein Mkms_3589 [Mycobacterium sp. KMS]
 gi|108770901|gb|ABG09623.1| hypothetical protein Mmcs_3516 [Mycobacterium sp. MCS]
 gi|119695710|gb|ABL92783.1| conserved hypothetical protein [Mycobacterium sp. KMS]
          Length = 718

 Score = 67.5 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 39/140 (27%), Gaps = 14/140 (10%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK-----TLM 64
             +  G+        V   DVD    +       E Q   G          +      + 
Sbjct: 82  PGHNIGLRL---PDGVIGIDVDAYGPKKGADTFAEAQGRWGALPPSYRSTSRDDGISGIR 138

Query: 65  LFRMQE--TNLKKQKSEEKIQGHLEFLAYGQQFVA--YNIHPKTQRAYTW--SIAPHALK 118
           L+R+          + ++     +E +    + V    +IH KT + Y W   +    + 
Sbjct: 139 LYRVPAGTKLETIIEFKDLDIRDIEIVQRHHRHVQCWPSIHDKTGQRYRWVSELDGSVMD 198

Query: 119 VEELPLLTPDEVEYFFEFFD 138
               P   PD    +     
Sbjct: 199 TPPAPEDLPDLPAAWVAALR 218


>gi|327409707|ref|YP_004347127.1| putative primase [Lausannevirus]
 gi|326784881|gb|AEA07015.1| putative primase [Lausannevirus]
          Length = 902

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 38/119 (31%), Gaps = 6/119 (5%)

Query: 119 VEELPLLT----PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
             ++P+L       E                K+K   +L K  +          +  + +
Sbjct: 246 PRDIPILLSIQRRREPTPISRGIIPSEKKMAKKKRPTRLVKTMEQIMEDIKMVTD--SGI 303

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
                +    ++D+W+ V   +     G  E  ++  ++      +DEK     W+  +
Sbjct: 304 LGMLNDSRAENYDDWMNVGWTLFNIGNGLPEALDLWIDFSSRASNFDEKKCEYVWEQME 362


>gi|302343670|ref|YP_003808199.1| Bifunctional DNA primase/polymerase [Desulfarculus baarsii DSM
           2075]
 gi|301640283|gb|ADK85605.1| Bifunctional DNA primase/polymerase [Desulfarculus baarsii DSM
           2075]
          Length = 626

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 39/123 (31%), Gaps = 14/123 (11%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQ 69
                GI+ G  ++ +   D D  + + + R           PI+           F  +
Sbjct: 48  PGAMVGIVTGKVSN-LLVIDAD--NSEAISRVEALLPDGLEMPIATT--PRGRHYYFAHR 102

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
           E      K+   +   ++  A G   VA    P   R   W +AP      ELP    D 
Sbjct: 103 EGM----KNAVGVMPAVDVRAEGGYVVAP---PGPGR--EWLVAPWDCAPPELPAQLEDV 153

Query: 130 VEY 132
           V  
Sbjct: 154 VRA 156


>gi|62464803|ref|YP_220367.1| replication initiation protein [Sulfolobus neozealandicus]
 gi|56562187|emb|CAH89324.1| replication initiation protein [Sulfolobus neozealandicus]
          Length = 866

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/228 (12%), Positives = 70/228 (30%), Gaps = 31/228 (13%)

Query: 4   TDVDHY---VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA- 59
            +++ +        GI+CG  ++ +   D D  +++  D++     +        +    
Sbjct: 41  EEIERWFSSGKYNVGIVCGKASNNLVVLDFD--EKRGFDKWYEYIDANYPHIRDMILSTW 98

Query: 60  -----PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP 114
                    +  R+++  ++  K    +   L+    G   VA          Y  S   
Sbjct: 99  LEDTHNGVHVYLRVKDAVIRSSK----VGDKLDIKGDGGYVVATPSLHPEGTEY--SFRL 152

Query: 115 HALKVEELPLLTPDEVEYFFEFFDTI-TTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
                 ++  +T  + +   +    +     +  K  RK        +  RY   E  + 
Sbjct: 153 GPSDGAKIIEITKKQFDEILKTLREVGLIKSEDTKEERKERANAARVSGFRYLKEEDLSK 212

Query: 174 LSCFGEEFYNGSHDE--------WIPV-----VMAIHYETRGSAEGKE 208
           +    +E Y   +          W+ V     + A+        +GK+
Sbjct: 213 VIGLAKEGYKEGYRNQLCMFLSGWLAVAGIHPLQAVKIIKALHDDGKD 260


>gi|303246065|ref|ZP_07332346.1| Bifunctional DNA primase/polymerase [Desulfovibrio fructosovorans
           JJ]
 gi|302492461|gb|EFL52332.1| Bifunctional DNA primase/polymerase [Desulfovibrio fructosovorans
           JJ]
          Length = 668

 Score = 66.7 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 40/144 (27%), Gaps = 12/144 (8%)

Query: 15  GILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAP-KTLMLFRMQETN 72
           G+ CG  +  V   DVD                        R G    +    F+     
Sbjct: 91  GVACGPAS-GVLVLDVDNPRLFDAWMQEKHPDEPLPMTLKVRTGGHGERFHYYFQYPSG- 148

Query: 73  LKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVE 131
             +Q     ++G  +    G Q +     HP+T++ Y         ++  +       +E
Sbjct: 149 -DEQYFCRSVKGIFDIRGIGGQVLCPGSLHPETRKPY------VFAEIVPIAPAPFWLLE 201

Query: 132 YFFEFFDTITTPRDKEKSYRKLSK 155
              +         ++    R   K
Sbjct: 202 MSKKSDGGKKDDDEQSPPDRINEK 225


>gi|327541459|gb|EGF27997.1| Bifunctional DNA primase/polymerase [Rhodopirellula baltica WH47]
          Length = 339

 Score = 66.7 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/245 (10%), Positives = 65/245 (26%), Gaps = 20/245 (8%)

Query: 5   DVDHY--VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF-QSCCGKPISRVGQAPK 61
           ++  +     G G++CG+ ++ +   D D    + +  +     +    +          
Sbjct: 69  ELRRWFRRPAGIGLVCGVQSNGLEVLDFDEDPVETMLEWAKILPEGLLDRLTIVATGGGG 128

Query: 62  TLMLFRMQE-TNLKKQKSEEKIQGHLEFLAYGQQFVAYNI---HPKTQRAYTWSIAPHAL 117
             + +R +  T   K     +    +E    G   V          + ++Y W  A    
Sbjct: 129 FHVPYRCESVTGNTKIAMAAEGGVLIESRGDGGYVVGVGSATRVHSSGKSY-WQTAGEP- 186

Query: 118 KVEELPLLTP------DEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
            +  LP ++              +          +++  +         +       E  
Sbjct: 187 -LPSLPTVSADERKLMWMAAAELDERPDAADEFVRKRRAQLRPLTKPDSDTPWGAFDESA 245

Query: 172 AFLSCFGEEFYNGSH-DEWIPVVMAI--HYETRGSAEGKEIVREWCKLGRTYD-EKSFNA 227
            +        +  ++   W               +  G EI+  +         E + + 
Sbjct: 246 DWREILEPAGWTTTNGKHWTRAGKTFGTSAVLGTANNGNEILTVFSTNAGELSVEGTGHR 305

Query: 228 KWDSF 232
            W  F
Sbjct: 306 NWGKF 310


>gi|288922735|ref|ZP_06416906.1| Bifunctional DNA primase/polymerase [Frankia sp. EUN1f]
 gi|288345912|gb|EFC80270.1| Bifunctional DNA primase/polymerase [Frankia sp. EUN1f]
          Length = 350

 Score = 66.7 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 33/131 (25%), Gaps = 24/131 (18%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVD-------------------RFN 42
           +      +  +G GI  G     +   D+D                              
Sbjct: 101 ITAYWSAHPTHGVGIATGP--SGLVVVDLDTPKPGDRPPSAVWAAEGVRTGVHALTVLAR 158

Query: 43  NEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHP 102
              +S       R G+     + ++                  ++  A+G Q VA   + 
Sbjct: 159 RVGESVTPTYAVRTGR-GGWHLYYQAPAGVRLTNTGRSIGPW-IDTRAWGGQVVAAG-NT 215

Query: 103 KTQRAYTWSIA 113
            + R YT +  
Sbjct: 216 VSGRPYTLTHD 226


>gi|81428209|ref|YP_395209.1| hypothetical protein LSA0594 [Lactobacillus sakei subsp. sakei 23K]
 gi|78609851|emb|CAI54898.1| Hypothetical prophage lsa1protein [Lactobacillus sakei subsp. sakei
           23K]
          Length = 266

 Score = 66.7 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/132 (12%), Positives = 33/132 (25%), Gaps = 18/132 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQSCCGKPISRVG- 57
           V T   +      G+            D+D   V D           +    K    +  
Sbjct: 45  VKTWWTNNPDCNIGVAT----RGFIVLDIDINHVDDADGYHSL-EVLEDTYNKLPETLTV 99

Query: 58  --QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAP 114
              +    + F++ E    +   +      ++  A      +          AYT+    
Sbjct: 100 KTASGGRHLYFKLPEG--VELPQKIAFLNGVDIKANPNNYVLLPPS-RINGDAYTFENKR 156

Query: 115 HALKVEELPLLT 126
               + +LP   
Sbjct: 157 ---PMADLPEWL 165


>gi|163854284|ref|YP_001642327.1| P4 family phage/plasmid primase [Methylobacterium extorquens PA1]
 gi|163665889|gb|ABY33256.1| phage/plasmid primase, P4 family [Methylobacterium extorquens PA1]
          Length = 697

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 34/124 (27%), Gaps = 13/124 (10%)

Query: 4   TDVDHY---VYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA 59
            D++ +     +   GI  G  ++ +   D+D       D   +             G+ 
Sbjct: 21  EDIEAHGTFPEHFNIGIKLGSKSNGIVDVDLDC------DAAVSLGARLLNTETRVFGRD 74

Query: 60  --PKTLMLFRMQETNLKKQ-KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
               +  L+R+ +     + K     +  +E      Q V      +      +      
Sbjct: 75  DNRASHYLYRVHDPRSTLRFKHPVSGEVLVELRGNNSQTVLPGSIYEDGSIIRFEDYSLP 134

Query: 117 LKVE 120
              E
Sbjct: 135 EPFE 138


>gi|78212470|ref|YP_381249.1| hypothetical protein Syncc9605_0932 [Synechococcus sp. CC9605]
 gi|78196929|gb|ABB34694.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 226

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 42/175 (24%), Gaps = 33/175 (18%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS-RVGQA 59
           V   ++ +      G++       +  FD D          N+            R    
Sbjct: 51  VQELLEQFPQTKSVGVITQP----LLCFDFDGETATQHAVLNDRDPDYVNTWRINRTTDP 106

Query: 60  PKTLMLFR--------------------MQETNLKKQKSEEK----IQGHLEFLAY-GQQ 94
            +  +LF                        +++++   E+          E   + G+Q
Sbjct: 107 NRYKLLFLPSKKQLAQLPNGQITHSFKTRPPSSVRRPPYEKGAVVAKGEAEEVFCHPGRQ 166

Query: 95  FVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKS 149
            +    HP +   Y W +      +   P              D         K+
Sbjct: 167 VIVAGEHPSSGGHYFWPVGFGPEALCAPPE--EWWSHVLELSRDYPRPAAGANKN 219


>gi|320103976|ref|YP_004179567.1| Bifunctional DNA primase/polymerase [Isosphaera pallida ATCC 43644]
 gi|319751258|gb|ADV63018.1| Bifunctional DNA primase/polymerase [Isosphaera pallida ATCC 43644]
          Length = 629

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/200 (8%), Positives = 47/200 (23%), Gaps = 22/200 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC---CGKPISRVGQ 58
           +      +      I        +   D+D  +    + +  +            + +  
Sbjct: 46  IERWWGQHPTANVAIAT----AGLLVVDLDPAEGNAANPWLKDDPDKRLDLAAAPTAMTP 101

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
                 +FR        + +  ++   ++    G   +           Y+W        
Sbjct: 102 RGGRHHVFRKPAGK-GWRCTASRLAPKVDTRTDGGYIIVPPSWRPDGA-YSWVPGLELDG 159

Query: 119 VEELPLLTPDEVEYFFEFFDTITT-------------PRDKEKSYRKLSKIWKSHNNRRY 165
             +     P  +    +     T              P  + +    L+++  +      
Sbjct: 160 PPDRLPEPPPWLVALLDSLAQETPTLAHVAAGGGQANPIPEGQRNATLARLGGNMRRVGM 219

Query: 166 TNIEIRAFLSCFGEEFYNGS 185
           T  EI A L    ++     
Sbjct: 220 TLAEIAAALLQTNKDRCFPP 239


>gi|229821005|ref|YP_002882531.1| Bifunctional DNA primase/polymerase [Beutenbergia cavernae DSM
           12333]
 gi|229566918|gb|ACQ80769.1| Bifunctional DNA primase/polymerase [Beutenbergia cavernae DSM
           12333]
          Length = 206

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 30/97 (30%), Gaps = 3/97 (3%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV-GQAPKTLMLFRMQET 71
             G+  G  +   +  D+D            E +     P  RV   +    + + M   
Sbjct: 109 NVGLATGRAS-GFWVLDIDPAKGGAASIKALEAEHGALAPTRRVRTGSGGWHLYYAMPLD 167

Query: 72  NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAY 108
               + S+  +   ++    G   VA      T+ AY
Sbjct: 168 GSDVRNSQGLVAPGIDVRGTGGYVVAPPSV-STKGAY 203


>gi|306833439|ref|ZP_07466566.1| prophage Lp4 protein 7 [Streptococcus bovis ATCC 700338]
 gi|304424209|gb|EFM27348.1| prophage Lp4 protein 7 [Streptococcus bovis ATCC 700338]
          Length = 574

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 23/106 (21%), Gaps = 10/106 (9%)

Query: 6   VDHY---VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           + ++        G+  G   +     D+D   E         F                 
Sbjct: 45  IQNWFSNTDYNVGVRTG---NGFIVIDIDNKSEVNGYESIKLFLKDFPSTKIVKTPNNGW 101

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAY 108
            M +R+             I   ++    G   V         R +
Sbjct: 102 HMYYRVDRE----ISCRTGIVKGVDIRGDGGYVVGIGSVVNGNRYF 143


>gi|125975319|ref|YP_001039229.1| prophage Lp4 protein 7, DNA replication [Clostridium thermocellum
           ATCC 27405]
 gi|125715544|gb|ABN54036.1| prophage Lp4 protein 7, DNA replication [Clostridium thermocellum
           ATCC 27405]
          Length = 183

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 41/169 (24%), Gaps = 10/169 (5%)

Query: 27  AFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHL 86
             DVD                     ++ V        +F+         K++      L
Sbjct: 1   MLDVD-DGGDETLSALESTHGKLPDTVTAVTGRGGRHYVFKYPRGRSIPNKTK--FAPGL 57

Query: 87  EFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK--VEELPLLTPDEV---EYFFEFFDTIT 141
           +  + G   V       +   Y W     +      E P      +   E     F+  +
Sbjct: 58  DNHSTGGLIVVAPSIHVSDNQYQWLKGHSSFDKTPAEAPEWLLKLMGREETLLTPFEGSS 117

Query: 142 TPRDKEKSYRKLSKIW--KSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
                ++  R  +      +   R  T   I A L        N   DE
Sbjct: 118 IVAGIKEGSRNSTLTSLAGTMRVRGMTEESIYAALLAENNARCNPPLDE 166


>gi|283778057|ref|YP_003368812.1| bifunctional DNA primase/polymerase [Pirellula staleyi DSM 6068]
 gi|283436510|gb|ADB14952.1| Bifunctional DNA primase/polymerase [Pirellula staleyi DSM 6068]
          Length = 409

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 55/204 (26%), Gaps = 16/204 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLD--EQVVDRFNNEFQSCCGKPISRVGQA 59
           +     ++   G  I+ G  +  + A D D ++  EQ    F+          +      
Sbjct: 47  IYHWWANHPERGLAIVLGQVSSCIVARDFDTMEAYEQWAASFSELAAKLP--TVETS--- 101

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHL--EFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
            +   ++   +    +++ +E I      E    G    A      +   Y W I+    
Sbjct: 102 -RGRHVYARADFEAIRRRGKETIYEFDDGELRLSGCYVAAPPSMHPSGSQYRWLISMV-- 158

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
              ELP +       F          R+   +                    +   +   
Sbjct: 159 ---ELPPVVDVFSCGFVPCNREDRDYRENRANRVNPDDRADLATELPKKPKTLGTQVVAL 215

Query: 178 GEEFYNGSHDEWIPVVMAIHYETR 201
            +E      + W  V+ AI     
Sbjct: 216 LKENNFAP-EVWQQVLAAIEQTVP 238


>gi|254560380|ref|YP_003067475.1| P4 family phage/plasmid primase [Methylobacterium extorquens DM4]
 gi|254267658|emb|CAX23504.1| putative P4 family phage/plasmid primase [Methylobacterium
           extorquens DM4]
          Length = 743

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 36/124 (29%), Gaps = 13/124 (10%)

Query: 4   TDVDHY----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA 59
            D++ +     +   GI  G  +  +   D+D       D   +             G+ 
Sbjct: 66  EDIEAHGTFPEHYNIGIKLGSASDGIVDVDLDC------DAAVSLGAKLLNTETRVFGRD 119

Query: 60  --PKTLMLFRMQETNLKKQ-KSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
             P +  ++R+ + +   + K     +  +E    G Q V      K      +      
Sbjct: 120 DNPASHYMYRVFDPHSTVKFKHPISRKMIVELRGNGSQTVLPGSIYKDGTDIRFEDYSLP 179

Query: 117 LKVE 120
             + 
Sbjct: 180 EPLN 183


>gi|302520906|ref|ZP_07273248.1| bifunctional DNA primase/polymerase [Streptomyces sp. SPB78]
 gi|302429801|gb|EFL01617.1| bifunctional DNA primase/polymerase [Streptomyces sp. SPB78]
          Length = 248

 Score = 65.6 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 34/123 (27%), Gaps = 13/123 (10%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV---G 57
           +V            G  C +  +     D+D       D+     +   G     V    
Sbjct: 121 LVRRWWAEQPDANIGAPCAL--NGWAVLDIDPRHG--GDQSFAVLEERVGVLPGTVMQAT 176

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                 +L+R     L        +   L+    G   +A ++H  +   Y WS     L
Sbjct: 177 GGGGLHILYRTPNVPL-----PGTLGPGLDVKHNGYILLAPSVH-SSGNRYRWSGDGRFL 230

Query: 118 KVE 120
             E
Sbjct: 231 HPE 233


>gi|255067391|ref|ZP_05319246.1| inner membrane protein [Neisseria sicca ATCC 29256]
 gi|255048361|gb|EET43825.1| inner membrane protein [Neisseria sicca ATCC 29256]
          Length = 1008

 Score = 65.6 bits (158), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 6/67 (8%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
              EIRA LS  G +      D WI +  A+  E     +G  +  EW +    Y+ +  
Sbjct: 8   EYDEIRAALSHIGAD----DRDMWIRMGAAVKDEM--GEDGFHLWDEWSQTSGNYNARDA 61

Query: 226 NAKWDSF 232
            A W SF
Sbjct: 62  KAAWKSF 68


>gi|291621990|emb|CAX65023.1| gp42 protein [Vibrio phage VP58.5]
          Length = 1117

 Score = 65.6 bits (158), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 29/73 (39%), Gaps = 5/73 (6%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
           H     T  E++  LS       +  +D W  V  A+H E     +G  +   W   G  
Sbjct: 23  HGRNPLTYQEVQECLSFISP---DQDYDTWARVGRALHSEF--GKDGFTLFDNWSSGGSN 77

Query: 220 YDEKSFNAKWDSF 232
           Y EK+   +W SF
Sbjct: 78  YKEKAVREQWKSF 90


>gi|330470704|ref|YP_004408447.1| bifunctional DNA primase/polymerase [Verrucosispora maris
           AB-18-032]
 gi|328813675|gb|AEB47847.1| bifunctional DNA primase/polymerase [Verrucosispora maris
           AB-18-032]
          Length = 302

 Score = 65.2 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 36/131 (27%), Gaps = 18/131 (13%)

Query: 12  NGFGILCGIGTHPVYAFDVDVL------DEQVVDRFNNEFQSCCGKP-----ISRVGQAP 60
            G GI CG     +   D+D        D +       +     G           G+  
Sbjct: 74  YGIGIACGP--SGLVVVDLDTPKHPAEADGRDGLAVLADLADTHGATIDPTYTVTTGR-G 130

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
            T + ++   T    + +   +   ++  A G   VA        R Y   +       +
Sbjct: 131 GTHLYYQHPNTGPALRNTAGTVGPMVDTRAAGGYVVAAGSI-VAGRPY---VVALDCDPD 186

Query: 121 ELPLLTPDEVE 131
            LP      + 
Sbjct: 187 PLPAWLAGMLA 197


>gi|254253429|ref|ZP_04946747.1| Superfamily II helicase [Burkholderia dolosa AUO158]
 gi|124896038|gb|EAY69918.1| Superfamily II helicase [Burkholderia dolosa AUO158]
          Length = 958

 Score = 64.8 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 24/73 (32%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N         R  L     +      D W  V MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERARVALGYVPPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ K     W SF
Sbjct: 56  YNGKDARDVWKSF 68


>gi|182437403|ref|YP_001825122.1| hypothetical protein SGR_3610 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178465919|dbj|BAG20439.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 319

 Score = 64.8 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 29/126 (23%), Gaps = 6/126 (4%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEFQSCCGKPISRVG--QAPKTLM 64
              G+GI CG   H +   D+D+                          V          
Sbjct: 82  RATGYGIACGRAPHRLIGVDLDIDPSYGSDAAGALRQLGLQHLFTIPPTVTVLTPSGGRH 141

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L+     +     S  ++   ++    G   V       T   Y  +     L     P 
Sbjct: 142 LWLTGPADATVPNSAGRLAPGIDIRGSGGYLVGPGSV-TTHGRYRLAPGTAHLTPAPCPR 200

Query: 125 LTPDEV 130
                +
Sbjct: 201 ALLRLL 206


>gi|330818031|ref|YP_004361736.1| primase 2 [Burkholderia gladioli BSR3]
 gi|327370424|gb|AEA61780.1| primase 2 [Burkholderia gladioli BSR3]
          Length = 953

 Score = 64.8 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|326778039|ref|ZP_08237304.1| Bifunctional DNA primase/polymerase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326658372|gb|EGE43218.1| Bifunctional DNA primase/polymerase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 319

 Score = 64.8 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 29/126 (23%), Gaps = 6/126 (4%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEFQSCCGKPISRVG--QAPKTLM 64
              G+GI CG   H +   D+D+                          V          
Sbjct: 82  RATGYGIACGRAPHRLIGVDLDIDPSYGSDAAGALRQLGLQHLFTIPPTVTVLTPSGGRH 141

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L+     +     S  ++   ++    G   V       T   Y  +     L     P 
Sbjct: 142 LWLTGPADATVPNSAGRLAPGIDIRGSGGYLVGPGSV-TTHGRYRLAPGTAHLTPAPCPR 200

Query: 125 LTPDEV 130
                +
Sbjct: 201 ALLRLL 206


>gi|170733820|ref|YP_001765767.1| primase 2 [Burkholderia cenocepacia MC0-3]
 gi|169817062|gb|ACA91645.1| Primase 2 [Burkholderia cenocepacia MC0-3]
          Length = 953

 Score = 64.8 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|307294812|ref|ZP_07574654.1| Bifunctional DNA primase/polymerase [Sphingobium chlorophenolicum
           L-1]
 gi|306879286|gb|EFN10504.1| Bifunctional DNA primase/polymerase [Sphingobium chlorophenolicum
           L-1]
          Length = 694

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 33/119 (27%), Gaps = 9/119 (7%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETN 72
             GI  G  ++ V  FD D ++ +      +          ++   A     +F      
Sbjct: 61  NVGIATGRLSN-VIVFDTDNVEAEQFMANLDL------PVTAKSKTAKGYHWMFAHPG-- 111

Query: 73  LKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVE 131
              +      +  L+    G   VA          Y W   P  +   + P      +E
Sbjct: 112 FAVRNHVRLEKYKLDVRGDGGFIVAPPSIHPDGSIYQWVNHPMDVGFAQAPADLLALLE 170


>gi|76809069|ref|YP_332699.1| inner membrane protein [Burkholderia pseudomallei 1710b]
 gi|237811419|ref|YP_002895870.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
 gi|254260840|ref|ZP_04951894.1| DNA primase TraC [Burkholderia pseudomallei 1710a]
 gi|76578522|gb|ABA47997.1| inner membrane protein [Burkholderia pseudomallei 1710b]
 gi|237505486|gb|ACQ97804.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
 gi|254219529|gb|EET08913.1| DNA primase TraC [Burkholderia pseudomallei 1710a]
          Length = 953

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|184200566|ref|YP_001854773.1| hypothetical protein KRH_09200 [Kocuria rhizophila DC2201]
 gi|183580796|dbj|BAG29267.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 301

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 45/165 (27%), Gaps = 25/165 (15%)

Query: 4   TDVDHYVY-NGFGILCGIGTHPVYAFDVDVLD------------EQVVDRFNNEFQSCCG 50
             +D +    G GI CG     +   D D                  VD F + +     
Sbjct: 64  AQLDRWPKGAGVGIACGR--SGLVVIDCDSHGSTPPPEWDRPGIRDGVDVFADLWSRHSP 121

Query: 51  -----KPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
                   +    +    + FR       + ++   ++  ++  A+G        + K  
Sbjct: 122 NVSMFDTFTVTTPSGGLHLYFRAPVG--SRIRNRTGVEWQVDVRAHGGYACGPGTNLKQG 179

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
              T++ A    K+  LP    D +                 +S 
Sbjct: 180 ---TYTPAGDPGKLLPLPQWLHDMLAPQEPAQRRPMPVAPPTRSQ 221


>gi|254190716|ref|ZP_04897223.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938391|gb|EDO94061.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 922

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|240171663|ref|ZP_04750322.1| hypothetical protein MkanA1_20283 [Mycobacterium kansasii ATCC
           12478]
          Length = 834

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 34/136 (25%), Gaps = 12/136 (8%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA- 59
           ++A        +G  + CG        FDVD  D        +           +  +  
Sbjct: 124 VIAAWYAA-TDHGIALHCGR--SGAVVFDVDDPDA-----MPDVLARHLDTAPHQSSRPD 175

Query: 60  --PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP-HA 116
              +   +F M         +        E        +A          Y W+ A    
Sbjct: 176 TPRRGHYVFAMPPGQTLGNGTGRLGGAWGEIRGANGVIIAAPSWHPEGGEYRWAHAGIVP 235

Query: 117 LKVEELPLLTPDEVEY 132
           +   ++  L PD    
Sbjct: 236 VLPADIAELLPDAASA 251


>gi|134294538|ref|YP_001118273.1| inner membrane protein [Burkholderia vietnamiensis G4]
 gi|134137695|gb|ABO53438.1| inner membrane protein [Burkholderia vietnamiensis G4]
          Length = 958

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 24/73 (32%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N         R  L     +      D W  V MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ K     W SF
Sbjct: 56  YNGKDARDVWKSF 68


>gi|167618366|ref|ZP_02386997.1| inner membrane protein [Burkholderia thailandensis Bt4]
          Length = 958

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 24/73 (32%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N         R  L     +      D W  V MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ K     W SF
Sbjct: 56  YNGKDARDVWKSF 68


>gi|84517218|ref|ZP_01004573.1| hypothetical protein SKA53_00225 [Loktanella vestfoldensis SKA53]
 gi|84508893|gb|EAQ05355.1| hypothetical protein SKA53_00225 [Loktanella vestfoldensis SKA53]
          Length = 260

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 32/127 (25%), Gaps = 6/127 (4%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
           ++      I  G   + V   D+DV                    +     +    + FR
Sbjct: 52  NFPNAMTAIPTGPI-NGVTVVDLDVKGGVNGIETLRGLIDDLPPTMLVRTPSGGIHLYFR 110

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSI--APHALKVEELPLL 125
                     S  K+   ++    G   +++      +  Y W    +    +   +P  
Sbjct: 111 TGSE--GLPSSVGKLGPGIDIRGSGANAISFGS-TSQKGMYRWDHSVSGFTWRPAPMPAD 167

Query: 126 TPDEVEY 132
               +  
Sbjct: 168 LKRLIYA 174


>gi|171317656|ref|ZP_02906841.1| Primase 2 [Burkholderia ambifaria MEX-5]
 gi|171097184|gb|EDT42034.1| Primase 2 [Burkholderia ambifaria MEX-5]
          Length = 953

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|260654750|ref|ZP_05860238.1| ATPase, RecA family [Jonquetella anthropi E3_33 E1]
 gi|260630465|gb|EEX48659.1| ATPase, RecA family [Jonquetella anthropi E3_33 E1]
          Length = 691

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 24/63 (38%), Gaps = 8/63 (12%)

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
              L     + Y    ++WI V MA+ +E      G ++   W +    Y E     KW 
Sbjct: 5   IDALKFISPDSY----EDWIAVGMALKHEGL----GLDVWDAWSRDSSKYREGECAGKWA 56

Query: 231 SFD 233
            F+
Sbjct: 57  GFN 59


>gi|115534315|ref|YP_783844.1| hyphotheical protein [Streptomyces laurentii]
 gi|23978907|dbj|BAC21270.1| hyphotheical protein [Streptomyces laurentii]
          Length = 250

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 30/139 (21%), Gaps = 16/139 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL--------DEQVVDRFNNEFQSCCGKPI 53
           +A           G+  G     +   D+D+           +V                
Sbjct: 14  IAGAWGQGP-FNVGLATGP--SGLVVVDLDMPKEGASGLSGAEVFAALCERAGQPLPATF 70

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIA 113
                +    + F               +   ++  A+G   VA          YT    
Sbjct: 71  RAGTASGGEHLYFTAPVGIRLGNS-AGLLGQLVDTRAWGGYVVAPGSITP-GGVYT---V 125

Query: 114 PHALKVEELPLLTPDEVEY 132
                V  LP    + +  
Sbjct: 126 LDDAPVLPLPSWLLEALTA 144


>gi|333025828|ref|ZP_08453892.1| hypothetical protein STTU_3331 [Streptomyces sp. Tu6071]
 gi|332745680|gb|EGJ76121.1| hypothetical protein STTU_3331 [Streptomyces sp. Tu6071]
          Length = 240

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 34/114 (29%), Gaps = 5/114 (4%)

Query: 1   MVATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG---KPISRV 56
           M+           G+GI CG+  + +   D+D        R      +  G       RV
Sbjct: 1   MIRALFTRAPRASGYGIACGLAPYHLIGLDLDTKHGADPLRALALLGARHGFVLPATVRV 60

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                   L+      L  + S  ++   ++    G   V       T+  Y +
Sbjct: 61  ATPSGGAHLWLSAPAGLTVRNSASRLAPGIDVRGTGGYLVGPGS-RTTRGVYRF 113


>gi|167567620|ref|ZP_02360536.1| inner membrane protein [Burkholderia oklahomensis EO147]
 gi|167569133|ref|ZP_02362007.1| inner membrane protein [Burkholderia oklahomensis C6786]
          Length = 953

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|295837848|ref|ZP_06824781.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           sp. SPB74]
 gi|197699918|gb|EDY46851.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           sp. SPB74]
          Length = 344

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 33/115 (28%), Gaps = 7/115 (6%)

Query: 1   MVATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC----CGKPISR 55
           ++        +  G+GI CG+  H +   D+D        R      +         +  
Sbjct: 97  VIRALFARAPHASGYGIACGLAPHHLLGLDLDTKHGADPLRALVLLGARHGFVLPVTLRV 156

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
              +    + F         + S  ++   ++    G   V       T+  Y +
Sbjct: 157 ATPSGGAHLWFSAPAGR-TVRNSAGRLAPGIDVRGAGGYLVGPGS-RTTRGVYRF 209


>gi|254181452|ref|ZP_04888049.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184211990|gb|EDU09033.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 953

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|326381302|ref|ZP_08202996.1| pancreatic ribonuclease [Gordonia neofelifaecis NRRL B-59395]
 gi|326199549|gb|EGD56729.1| pancreatic ribonuclease [Gordonia neofelifaecis NRRL B-59395]
          Length = 362

 Score = 63.7 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/163 (13%), Positives = 43/163 (26%), Gaps = 17/163 (10%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVV----DRFNNEFQSCCGKPISRVGQA--PKTLML 65
             +G+        + A DVD  D +           +              A  P     
Sbjct: 107 CNYGMRT---PAGLLAIDVDHYDGKTGAVTLADLEAKLGPLPSTWRVTSHGAANPSGQRW 163

Query: 66  FRMQETNLKKQKSEEKIQGHLE-FLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           +R+        + E      +E      +  V           Y W     A+  E++PL
Sbjct: 164 YRVPA----VAEYESAAGKDIEVIHRNHRYSVLPPSVHPKGGRYAWISPDGAIT-EDVPL 218

Query: 125 LT--PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRY 165
           +T  P+    + ++  +   P         +    +     R 
Sbjct: 219 VTRIPELPAKWVDYLTSTRPPVPGSTPAGIVRATAELDRMHRD 261


>gi|302536929|ref|ZP_07289271.1| predicted protein [Streptomyces sp. C]
 gi|302445824|gb|EFL17640.1| predicted protein [Streptomyces sp. C]
          Length = 336

 Score = 63.3 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/136 (11%), Positives = 33/136 (24%), Gaps = 24/136 (17%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----------------FQSCCGKPIS 54
              G+  G     +   D+D+  E       +                   +    +  +
Sbjct: 102 YNVGLATGPA--GLLVVDLDIPKEDDGPAPADWAGATDGLDVFAMICERAGERLPTETFT 159

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAP 114
              +     + F        +  S  ++   ++  A+G   VA      T          
Sbjct: 160 VRTRRGGQHLYFTAPAEKRLR-GSAGRLGWKVDTRAWGGYVVAAGSTVGTGSY----EII 214

Query: 115 HALKVEELPLLTPDEV 130
           H      LP    D +
Sbjct: 215 HDAPPAALPTWLGDLL 230


>gi|238028381|ref|YP_002912612.1| inner membrane protein [Burkholderia glumae BGR1]
 gi|237877575|gb|ACR29908.1| Inner membrane protein [Burkholderia glumae BGR1]
          Length = 958

 Score = 63.3 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 24/73 (32%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N         R  L     +      D W  V MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERARVALGYVLPD----DRDTWRQVGMALKAEF--GEEGFALWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ K     W SF
Sbjct: 56  YNGKDARDVWKSF 68


>gi|15805557|ref|NP_294253.1| hypothetical protein DR_0530 [Deinococcus radiodurans R1]
 gi|6458224|gb|AAF10112.1|AE001911_7 hypothetical protein DR_0530 [Deinococcus radiodurans R1]
          Length = 891

 Score = 63.3 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 32/124 (25%), Gaps = 17/124 (13%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML 65
           +  +   G G+L           D D     +     +        P    G+      +
Sbjct: 54  LTAHPGAGVGLLHSESQTAALDIDHDGAALALAAVGVDLAAVLASNPYRVRGKKG-EKPI 112

Query: 66  FRMQE-----------TNLKKQKSEEKIQGHLEFL----AYGQQFVAYNI-HPKTQRAYT 109
           FR+ +            +   +K        L         G Q V     HP T R Y 
Sbjct: 113 FRVPDGLSLNRHALSWPDPSGKKGPGGRPAPLTIFELRGGAGVQDVMPPSVHPDTGRPYE 172

Query: 110 WSIA 113
           W+  
Sbjct: 173 WTGP 176


>gi|134296560|ref|YP_001120295.1| TOPRIM domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134139717|gb|ABO55460.1| TOPRIM domain protein [Burkholderia vietnamiensis G4]
          Length = 797

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 6/69 (8%)

Query: 164 RYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEK 223
                 IRA LS        G  D W+ + MAI  E      G ++  +W +   +Y E 
Sbjct: 4   YADEERIRAALSHVP----AGDRDTWVQMGMAIKAEL--GEAGFDLWDDWSRSASSYSEA 57

Query: 224 SFNAKWDSF 232
              + W SF
Sbjct: 58  DAKSVWKSF 66


>gi|167582916|ref|ZP_02375790.1| inner membrane protein [Burkholderia thailandensis TXDOH]
          Length = 952

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQNYNGKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  TRDVWKSF 63


>gi|237813308|ref|YP_002897759.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
 gi|237503709|gb|ACQ96027.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
          Length = 949

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 24/68 (35%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  ++Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMAVKAEF--GEEGFSLWSEWSQGAQSYNAKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|167825274|ref|ZP_02456745.1| hypothetical protein Bpseu9_16513 [Burkholderia pseudomallei 9]
 gi|226197848|ref|ZP_03793422.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei Pakistan 9]
 gi|225930036|gb|EEH26049.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei Pakistan 9]
          Length = 949

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 24/68 (35%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  ++Y+ K 
Sbjct: 2   SEFERARVALGYVPPD----DRDTWRQVGMAVKAEF--GEEGFSLWSEWSQGAQSYNAKD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|311743682|ref|ZP_07717488.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
 gi|311312812|gb|EFQ82723.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
          Length = 1564

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/145 (13%), Positives = 38/145 (26%), Gaps = 20/145 (13%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVL--------DEQVVDRFNNEFQSCCGKPISRV---- 56
           + ++   +        V   DVD              +     +         S      
Sbjct: 59  HPHHSIALR---MPDGVIGIDVDQYVKKGKQKHGADTLAALVEKLGPLPPTWSSTARGDE 115

Query: 57  -GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEF--LAYGQQFVAYNIHPKTQRAYTW-SI 112
            G  P  ++LF++         +     G +E     +    VA +I+P+T   Y W   
Sbjct: 116 HGPGPSRVLLFQVPAQRYITNLTAAGT-GDIEIIQRHHRYIVVAPSINPETGTQYQWYDE 174

Query: 113 APHALKVEELPLLTPDEVEYFFEFF 137
                     PL   +    +    
Sbjct: 175 TDQPSDKVPNPLQLAELPAAWLAHL 199


>gi|318060883|ref|ZP_07979604.1| hypothetical protein SSA3_23263 [Streptomyces sp. SA3_actG]
 gi|318075930|ref|ZP_07983262.1| hypothetical protein SSA3_04265 [Streptomyces sp. SA3_actF]
          Length = 296

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/170 (9%), Positives = 35/170 (20%), Gaps = 18/170 (10%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVL-----DEQVVDRFNNEFQSC---CGKPISRVGQAPKT 62
               G+  G     +   D+DV                  +          +    +   
Sbjct: 69  DYNVGLATGPA--NLLVVDLDVPKPGAEGPDGAAHLRALTERHGQPMPSTRTVRTPSGGA 126

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
            + F           +   +   ++  A+G   VA      T R         ++    L
Sbjct: 127 HLYFPAPLAARLHN-TAGTLAPLVDTRAWGGYVVAPGSILPTGRY-------ESVAPFAL 178

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
             L P            +       +     +    + +         R 
Sbjct: 179 RPLPPWLRGLLTPPHPCVQARAATGRQGYGSAYTRAALDGEATNVRTARE 228


>gi|157311092|ref|YP_001469087.1| gp088 [Lactococcus phage KSY1]
 gi|108861432|gb|ABG21631.1| gp088 [Lactococcus phage KSY1]
          Length = 445

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/113 (16%), Positives = 38/113 (33%), Gaps = 6/113 (5%)

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGE 179
            + P        Y  +    ++  R  + +  ++ K  K  +  +   +++   L     
Sbjct: 21  HKYPTKPAVGEPYITDEKQGLSPYRVSDFAKIRVKKEIKQSSENKRVGMDLIPLLEVIDP 80

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
              +  + +W+ V MA+  E        E    W +    Y       KWDSF
Sbjct: 81  N--DLEYHDWVKVGMALKQEGYQ----FETWDTWSQRDVRYKSSEMQDKWDSF 127


>gi|290959765|ref|YP_003490947.1| hypothetical protein SCAB_53671 [Streptomyces scabiei 87.22]
 gi|260649291|emb|CBG72406.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 301

 Score = 62.9 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 36/158 (22%), Gaps = 17/158 (10%)

Query: 13  GFGILCGIGTHPVYAFDVDVL-------DEQVVDRFNNEFQSCCGKPISRV---GQAPKT 62
             GI  G     +   D+D L              F    +       +       +   
Sbjct: 75  NVGIATGPA--GLLVVDLDTLKPTDEAGTPDGAANFQALCERAGHTVPATRRIRTPSGGE 132

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
            + F      ++   +   +   ++  A+G Q VA          YT         V  L
Sbjct: 133 HLYFTAPSG-VRFANTTGTLTPKVDTRAWGGQVVAPGSITPHG-PYT---VLDDQPVANL 187

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
                  +            P     + R  + +    
Sbjct: 188 SEWLQKALTASQRRATAPILPTLARDADRYAAAVLNRE 225


>gi|322489396|emb|CBZ24655.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 543

 Score = 62.9 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/130 (9%), Positives = 30/130 (23%), Gaps = 17/130 (13%)

Query: 120 EELPLLTPDEV--EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR------------- 164
            + P  + +++      +          + +             +               
Sbjct: 392 SDAPAESAEQLRRAAVLQATTKHRFKLIRPRQIMGPQATQAVEYDAYGNVVPPFLTEAAK 451

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEK 223
           +   +               S+D W+ V +A+H          E    +       Y  +
Sbjct: 452 WRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHN-FSNEDHVFEEWVRFSLKSPLKYSRE 510

Query: 224 SFNAKWDSFD 233
               KW  F+
Sbjct: 511 VCRKKWLQFE 520


>gi|261326266|emb|CBH09092.1| hypothetical protein, conserved [Trypanosoma brucei gambiense DAL972]
          Length = 1249

 Score = 62.9 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 23/76 (30%), Gaps = 3/76 (3%)

Query: 159  SHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR 218
            + + + +        L           +D W+ V +A+H          E    +     
Sbjct: 1150 TESAKWHRFKTAVEKLHRLPP-RAAECYDIWVRVGLALHN-FSNEDHVFEEWVRFSLKCP 1207

Query: 219  -TYDEKSFNAKWDSFD 233
              Y  ++   KW  FD
Sbjct: 1208 QKYSRETCRRKWQQFD 1223


>gi|115504605|ref|XP_001219095.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|83642577|emb|CAJ16608.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain
            927/4 GUTat10.1]
          Length = 1249

 Score = 62.9 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 23/76 (30%), Gaps = 3/76 (3%)

Query: 159  SHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR 218
            + + + +        L           +D W+ V +A+H          E    +     
Sbjct: 1150 TESAKWHRFKTAVEKLHRLPP-RAAECYDIWVRVGLALHN-FSNEDHVFEEWVRFSLKCP 1207

Query: 219  -TYDEKSFNAKWDSFD 233
              Y  ++   KW  FD
Sbjct: 1208 QKYSRETCRRKWQQFD 1223


>gi|308176189|ref|YP_003915595.1| bifunctional primase/DNA polymerase protein [Arthrobacter
           arilaitensis Re117]
 gi|307743652|emb|CBT74624.1| putative bifunctional primase/DNA polymerase protein [Arthrobacter
           arilaitensis Re117]
          Length = 301

 Score = 62.9 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 29/102 (28%), Gaps = 6/102 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQ 58
           V+   D +      I  G  +  +   D+D+             +      G        
Sbjct: 56  VSAWWDRWPSANLAIPTGPAS-GIDVVDIDIGSTGSGVPAFQRARREGLVHGWAALVRTP 114

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
           +    + F       ++Q S +    H++F   G   +A   
Sbjct: 115 SGGLHVYF--PAGTSREQPSWQAPMAHIDFRGTGGYVLAPPS 154


>gi|320009650|gb|ADW04500.1| Bifunctional DNA primase/polymerase [Streptomyces flavogriseus ATCC
           33331]
          Length = 338

 Score = 62.5 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 32/128 (25%), Gaps = 9/128 (7%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEFQSCCGKPISRVG 57
           V           G+GI CG   H +   D+D+        V                 V 
Sbjct: 112 VRALFAAAPRATGYGIACGRQPHRLIGIDLDIDTTHGNDSVAALRQLALQHLFTIPPTVT 171

Query: 58  --QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
                    L+      +    S  ++   ++    G   V       T   Y   +AP 
Sbjct: 172 VLTPSGGRHLWLTGPPGVSVPNSAGRLAPGIDVRGAGGYLVGPGSV-TTHGRYR--LAPG 228

Query: 116 ALKVEELP 123
              +   P
Sbjct: 229 TAHLAPAP 236


>gi|315503922|ref|YP_004082809.1| bifunctional DNA primase/polymerase [Micromonospora sp. L5]
 gi|315410541|gb|ADU08658.1| Bifunctional DNA primase/polymerase [Micromonospora sp. L5]
          Length = 299

 Score = 62.5 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 36/134 (26%), Gaps = 18/134 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV----------DRFNNEFQSCCGK 51
           +          G G+ CG     +   D+D                 +       +    
Sbjct: 63  IRRAWSARP-YGIGLACGP--SRLVVVDLDTPKTGGAGGRDGLTVLAELAAAHAATIDPT 119

Query: 52  PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                G+   T + +R  +T    + +   +   ++  A+G   VA        R YT  
Sbjct: 120 YTVTTGR-GGTHLYYRHPDTGPALRNTAGTLGPMVDTRAHGGYVVAPGS-TVAGRPYT-- 175

Query: 112 IAPHALKVEELPLL 125
                  +  LP  
Sbjct: 176 -VDLDTDLAPLPGW 188


>gi|107023303|ref|YP_621630.1| inner membrane protein [Burkholderia cenocepacia AU 1054]
 gi|116690386|ref|YP_836009.1| inner membrane protein [Burkholderia cenocepacia HI2424]
 gi|105893492|gb|ABF76657.1| inner membrane protein [Burkholderia cenocepacia AU 1054]
 gi|116648475|gb|ABK09116.1| inner membrane protein [Burkholderia cenocepacia HI2424]
          Length = 958

 Score = 62.5 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                 R  L     +      D W  V MA+  E     EG  +  EW +  + Y+ K 
Sbjct: 7   SEFERARVALGYVPPD----DRDTWSQVGMALKAEF--GEEGFALWNEWSQGAQNYNVKD 60

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 61  ARDVWKSF 68


>gi|115352457|ref|YP_774296.1| TOPRIM domain-containing protein [Burkholderia ambifaria AMMD]
 gi|115282445|gb|ABI87962.1| TOPRIM domain protein [Burkholderia ambifaria AMMD]
          Length = 797

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 6/62 (9%)

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
           RA LS    +      D W+ + MAI  E      G +   +W +    Y E    + W 
Sbjct: 11  RAALSHVPAD----DRDTWVQMGMAIKAEF--GEAGFDFWDDWSRSASNYSEADAKSVWK 64

Query: 231 SF 232
           SF
Sbjct: 65  SF 66


>gi|322497389|emb|CBZ32464.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 545

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 12/130 (9%), Positives = 30/130 (23%), Gaps = 17/130 (13%)

Query: 120 EELPLLTPDEV--EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR------------- 164
            + P  + +++      +          + +             +               
Sbjct: 394 SDAPAESAEQLHRAAVLDATTRHRFKLIRPRQIMGPQATQAVEYDAYGNVVPPFLTEAAK 453

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEK 223
           +   +               S+D W+ V +A+H          E    +       Y  +
Sbjct: 454 WRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHN-FSNEDHVFEEWVRFSLKSPLKYSRE 512

Query: 224 SFNAKWDSFD 233
               KW  F+
Sbjct: 513 VCRKKWMQFE 522


>gi|321399110|emb|CBZ08451.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 545

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 12/130 (9%), Positives = 30/130 (23%), Gaps = 17/130 (13%)

Query: 120 EELPLLTPDEV--EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR------------- 164
            + P  + +++      +          + +             +               
Sbjct: 394 SDAPAESAEQLHRAAVLDATTRHRFKLIRPRQIMGPQATQAVEYDAYGNVVPPFLTEAAK 453

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEK 223
           +   +               S+D W+ V +A+H          E    +       Y  +
Sbjct: 454 WRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHN-FSNEDHVFEEWVRFSLKSPLKYSRE 512

Query: 224 SFNAKWDSFD 233
               KW  F+
Sbjct: 513 VCRKKWMQFE 522


>gi|146080339|ref|XP_001463994.1| hypothetical protein [Leishmania infantum JPCM5]
          Length = 545

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 12/130 (9%), Positives = 30/130 (23%), Gaps = 17/130 (13%)

Query: 120 EELPLLTPDEV--EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR------------- 164
            + P  + +++      +          + +             +               
Sbjct: 394 SDAPAESAEQLHRAAVLDATTRHRFKLIRPRQIMGPQATQAVEYDAYGNVVPPFLTEAAK 453

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEK 223
           +   +               S+D W+ V +A+H          E    +       Y  +
Sbjct: 454 WRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHN-FSNEDHVFEEWVRFSLKSPLKYSRE 512

Query: 224 SFNAKWDSFD 233
               KW  F+
Sbjct: 513 VCRKKWMQFE 522


>gi|51870034|ref|YP_073585.1| predicted ATPase [Lymphocystis disease virus - isolate China]
 gi|51858242|gb|AAU10926.1| predicted ATPase [Lymphocystis disease virus - isolate China]
          Length = 865

 Score = 62.1 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 31/105 (29%), Gaps = 5/105 (4%)

Query: 125 LTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG 184
           + P + E +   F  +      +   RK   I                +L     E    
Sbjct: 220 IMPQDKEPYLISFKNVKPKLIDKILSRKAEAILNEETRPSKL-----KYLINLLPEECAD 274

Query: 185 SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
             D W+     +   T GS EG ++   + K    Y+E      W
Sbjct: 275 DRDVWLETGFCVWQITDGSIEGYDVWTSFSKKSEKYNEDECFDLW 319


>gi|326331498|ref|ZP_08197788.1| putative prophage Lp4 protein 7, DNA replication [Nocardioidaceae
           bacterium Broad-1]
 gi|325950754|gb|EGD42804.1| putative prophage Lp4 protein 7, DNA replication [Nocardioidaceae
           bacterium Broad-1]
          Length = 304

 Score = 62.1 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 28/102 (27%), Gaps = 7/102 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQ 58
           V      +     GI  G  +  + A DVDV  ++      +                  
Sbjct: 65  VQRWWQRHPDANIGIPTGAAS-GLAAVDVDVHGDRTGFAAFDRAGRAGLVDRWSWLVRTP 123

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
           +      FR  +  ++          HL+F   G   +A   
Sbjct: 124 SGGLHAYFRPIDPEMRSWSLP---GQHLDFRGDGGYVIAPPS 162


>gi|318042163|ref|ZP_07974119.1| hypothetical protein SCB01_10655 [Synechococcus sp. CB0101]
          Length = 271

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 40/169 (23%), Gaps = 31/169 (18%)

Query: 4   TDVDHYVY-NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP-------ISR 55
             +  Y      G   G+ T P+  FD D                    P       + R
Sbjct: 26  AQLQAYRSMRSVGARTGLLTGPLLCFDFDG------ATSLELGLDHLIDPGWACTWQVHR 79

Query: 56  VGQAPKTLMLFRM--------------QETNLKKQKSEEKIQGHLEFLAYG-QQFVAYNI 100
              A +  +LFR               Q   +   K++      LE    G +Q +    
Sbjct: 80  DTDANRLKVLFRPTMEQLQQLPDGAEFQGKTITAPKTDTSKGEALEVFFDGGRQVIVLGE 139

Query: 101 HPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKS 149
           HP +   Y W        +   P              D         K 
Sbjct: 140 HPSSGGHYFWPDGMGPEALAAPPA--HWWEHALRIAADCQQRLTTGSKP 186


>gi|157865925|ref|XP_001681669.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68124967|emb|CAJ02695.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 543

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/129 (9%), Positives = 30/129 (23%), Gaps = 17/129 (13%)

Query: 121 ELPLLTPDEV--EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR-------------Y 165
           + P  + +++      +          + +             +               +
Sbjct: 393 DAPAESAEQLRRAAVLDATTKHRFKLIRPRQIMGPQATRAVEYDAYGNVVPPFLTEAAKW 452

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKS 224
              +               S+D W+ V +A+H          E    +       Y  + 
Sbjct: 453 RRFKAVTAKLRTLPPRAAESYDVWVRVGLALHN-FSNEDHVFEEWVRFSLKSPLKYSREV 511

Query: 225 FNAKWDSFD 233
              KW  F+
Sbjct: 512 CRKKWVQFE 520


>gi|148256277|ref|YP_001240862.1| hypothetical protein BBta_4941 [Bradyrhizobium sp. BTAi1]
 gi|146408450|gb|ABQ36956.1| hypothetical protein BBta_4941 [Bradyrhizobium sp. BTAi1]
          Length = 736

 Score = 61.3 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 24/71 (33%), Gaps = 6/71 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N       E+   L     +     +  W+ +  A+H E     EG ++   W      
Sbjct: 208 KNTAPADRAEVERALEVIASD----DYQVWLRIGAALHDEF--GDEGFDLFDRWSAKSDK 261

Query: 220 YDEKSFNAKWD 230
           YD +    KW+
Sbjct: 262 YDNREVERKWE 272


>gi|312878208|ref|ZP_07738135.1| Primase 1 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795021|gb|EFR11423.1| Primase 1 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 181

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/114 (14%), Positives = 31/114 (27%), Gaps = 4/114 (3%)

Query: 43  NEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHP 102
                     + ++  +    +LF+  E  +        I+  ++    G   +      
Sbjct: 2   ELEFGKLPDTVEQITGSGGRHLLFKYPEDVI--VPCRVNIRPGIDIRGDGGYIIVEPSKH 59

Query: 103 KTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
                Y W ++ H L V  +       +E   E       P D      K  K 
Sbjct: 60  IRGE-YCWEVSSHPLDVP-IAEAPKWLIELVAEKPVETKKPLDFWWQIAKGVKE 111


>gi|290959118|ref|YP_003490300.1| hypothetical protein SCAB_47031 [Streptomyces scabiei 87.22]
 gi|260648644|emb|CBG71756.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 289

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 30/131 (22%), Gaps = 6/131 (4%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRV--- 56
           V        +  G+GI CG+  H +   D+D                         V   
Sbjct: 71  VRELFSAAPWATGYGIACGLHPHHLIGVDLDTKSGTDSSAALRELALRHLFTIPETVVVL 130

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
             +    +       ++    S  ++   ++    G   V            T     H 
Sbjct: 131 TPSGGRHIWLTGP-PDVVVPNSASRLAPGIDIRGAGGYLVGPGSRTDHGVYGTAPGTSHL 189

Query: 117 LKVEELPLLTP 127
                 P L  
Sbjct: 190 SPAPCPPALLR 200


>gi|239942767|ref|ZP_04694704.1| hypothetical protein SrosN15_17369 [Streptomyces roseosporus NRRL
           15998]
 gi|239989226|ref|ZP_04709890.1| hypothetical protein SrosN1_18136 [Streptomyces roseosporus NRRL
           11379]
 gi|291446237|ref|ZP_06585627.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291349184|gb|EFE76088.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 303

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 30/119 (25%), Gaps = 8/119 (6%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVL---DEQVVDRFNNEFQSCCGKPISRVG--QAPKTLM 64
              G+GI CG   H +   D+DV                          V          
Sbjct: 80  RATGYGIACGRAPHRLIGIDLDVDPAYGSDAAGALRQLALQHLFTIPPTVTVLTPSGGRH 139

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
           L+     +     S  ++   ++    G   V         R Y   +AP    +   P
Sbjct: 140 LWLTGPADATVPNSAGRLAPGIDIRGTGGYLVGPGSVTAHGR-YR--LAPGTAHLTPAP 195


>gi|83311028|ref|YP_421292.1| hypothetical protein amb1929 [Magnetospirillum magneticum AMB-1]
 gi|82945869|dbj|BAE50733.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 469

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/233 (9%), Positives = 48/233 (20%), Gaps = 34/233 (14%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP--ISRVGQAPKTLMLFRMQ 69
              G+        +   D D    +          +  G P     +         F++ 
Sbjct: 62  YNVGVCT----SGLLVTDPDAKGGKPGLVNWEINDAIFGTPDHPVTITPTGGQHHFFKLP 117

Query: 70  ET--------NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
                          K E  +   ++  ++    V           Y W     A  V +
Sbjct: 118 AGINPETVGNIADSAKRESPLGKGIDARSWHGFVVGAGSVID-GVPYRW--QAEAASVAD 174

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
           LP      ++            R   +             +          +L     E 
Sbjct: 175 LPDAPDWIIDKC---------KRQVVERPDTAETPEGLTLDTPAALHRATWYLQHEAPEA 225

Query: 182 YNGSHDEWIPVVMAIHYETRG------SAEGKEIVREWCKLGRTYDEKSFNAK 228
             G   +     +A H    G           +   +  +    +  +    K
Sbjct: 226 VEGDGGDSTAFSVACHVRDYGVSREMALELLLDHWND--RCCPPWSPEDLELK 276


>gi|326955330|gb|AEA29023.1| Bifunctional DNA primase/polymerase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 296

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/145 (9%), Positives = 35/145 (24%), Gaps = 24/145 (16%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQ---------------VVDRFNNEF 45
           ++            G++ G     +   D+DV                   +        
Sbjct: 48  VIEAWYRQAP-FNIGLVTGK---GLVVVDLDVARGGDGRSGESGELSGREHLARIARETG 103

Query: 46  QSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
           +   G   +    +    + F + +    +     ++   ++  A G   VA        
Sbjct: 104 EEYPGDTYTVRTPSGGDHLYFAVSDREFLRNTG-GRLGARIDTRANGGYIVAAGSRRP-G 161

Query: 106 RAYTWSIAPHALKVEELPLLTPDEV 130
             Y      +   +  LP      +
Sbjct: 162 GMYR---VVNRRPIAPLPSWLATAL 183


>gi|48477428|ref|YP_023134.1| virulence-associated protein E [Picrophilus torridus DSM 9790]
 gi|48430076|gb|AAT42941.1| virulence-associated protein E [Picrophilus torridus DSM 9790]
          Length = 1004

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 40/149 (26%), Gaps = 25/149 (16%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV----------------DRFNNEFQSCC 49
           +  +     GI  G  +  ++ +D D+   +                     +   Q   
Sbjct: 43  IRSWKTENMGIPTGDIS-GIFVYDCDIKTGENGNIGINGLYGFLKILKLKTLDEYIQKYP 101

Query: 50  GKPISRVGQAPKTLMLFRMQ--ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
              I + G        F++     +  +  +       L+    G   VA          
Sbjct: 102 DAFIVQTGS--GYQFYFKIPVGLDHNLRNTTNINGIKGLDVRGNGGYVVAPGSIHPNGNE 159

Query: 108 YTWSIAPHALKVEELPLLTPDEVEYFFEF 136
           Y          ++++PL+       ++E 
Sbjct: 160 YK----IIHGSLDKIPLMPEKLYNLWYEH 184


>gi|313896490|ref|ZP_07830041.1| primase C-terminal domain protein [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312974914|gb|EFR40378.1| primase C-terminal domain protein [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 669

 Score = 60.6 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 22/64 (34%), Gaps = 6/64 (9%)

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
           I + L        + +   WI V MA+  E         I  +W +    Y       KW
Sbjct: 5   ILSALKYINVAEVDRAT--WISVGMALKEEGYPC----SIWDDWSQRDPRYHPGECEKKW 58

Query: 230 DSFD 233
           + F+
Sbjct: 59  EGFN 62


>gi|158421602|ref|YP_001527829.1| bifunctional DNA primase/polymerase [Deinococcus geothermalis DSM
           11300]
 gi|158342845|gb|ABW35131.1| Bifunctional DNA primase/polymerase [Deinococcus geothermalis DSM
           11300]
          Length = 402

 Score = 60.6 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/167 (9%), Positives = 34/167 (20%), Gaps = 10/167 (5%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
           + G G++ G  +  +   DVD  +     RF        G+   R  ++       R   
Sbjct: 77  WRGLGLVTGSVS-GIVVIDVDQSEGV--ARFTEWG--LLGRAHVR-TRSGGLHWYLRHPG 130

Query: 71  TNLKKQKSEEKIQ----GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
             ++  +S+   +      ++    G   V                         LP   
Sbjct: 131 WPVRTVQSQTNKRLEWIRGIDVRGDGGYVVIPPTRFGRVGYEPLRDHRDLDDPSLLPFEV 190

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
              +                                 +         
Sbjct: 191 QVLLGLHAAPSAPGPRAAVSPAPASGPWVARDGRTLDQELLYRALEL 237


>gi|325266444|ref|ZP_08133121.1| conjugal transfer mating pair stabilization protein TraN [Kingella
           denitrificans ATCC 33394]
 gi|324981887|gb|EGC17522.1| conjugal transfer mating pair stabilization protein TraN [Kingella
           denitrificans ATCC 33394]
          Length = 1854

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 27/73 (36%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
                    E+R  L+           + W  V  A+  E      G+ +  +W +    
Sbjct: 2   TITYETDYDEVRNALTYLDP----NDRETWWKVGAALKSEF--DEGGRGLWEDWSRSYPK 55

Query: 220 YDEKSFNAKWDSF 232
           ++E+  NA+W SF
Sbjct: 56  WNERESNAQWKSF 68


>gi|302553095|ref|ZP_07305437.1| hypothetical protein SSQG_04324 [Streptomyces viridochromogenes DSM
           40736]
 gi|302470713|gb|EFL33806.1| hypothetical protein SSQG_04324 [Streptomyces viridochromogenes DSM
           40736]
          Length = 295

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/160 (10%), Positives = 29/160 (18%), Gaps = 22/160 (13%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDV-------LDEQVVDRFNNEFQSCCGKPI 53
           ++            GI  G     +   D+DV                    +       
Sbjct: 56  LIRATWATRP-YNVGIATGPA--GLLVIDLDVCKPEEPKGAPDGATSLKALCERTGHTVP 112

Query: 54  SR---VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
           +            + F        K     ++  H++  A+G   VA             
Sbjct: 113 ATYRVRTARGGEHLYFTAPAGMRLKNS-ANRLGPHIDTRAWGGYVVAPGSTTPDGAY--- 168

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
                   V  LP      +                    
Sbjct: 169 -EVNDEAPVAPLP----WWLAALLTEHPKPAVVELAPVRD 203


>gi|153853410|ref|ZP_01994819.1| hypothetical protein DORLON_00808 [Dorea longicatena DSM 13814]
 gi|149754196|gb|EDM64127.1| hypothetical protein DORLON_00808 [Dorea longicatena DSM 13814]
          Length = 750

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 26/68 (38%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
             + +++  +           + +W+ V MA+ +E        ++   W K  R Y    
Sbjct: 2   EQHTDLQEIIEYLNPAEL--DYQDWVNVGMALKHEGYS----VDVWDTWSKNDRRYHSGE 55

Query: 225 FNAKWDSF 232
              KW++F
Sbjct: 56  CEKKWNTF 63


>gi|294789713|ref|ZP_06754945.1| primase C 2 (PriCT-2) superfamily [Simonsiella muelleri ATCC 29453]
 gi|294482350|gb|EFG30045.1| primase C 2 (PriCT-2) superfamily [Simonsiella muelleri ATCC 29453]
          Length = 987

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 21/67 (31%), Gaps = 6/67 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                I+  L+           + W  +  AI  E      G E+   W +    Y ++ 
Sbjct: 2   SDYDNIQNALNHIDP----QDRETWFRMGAAIKDEL--GENGFEMWDNWSRQSDNYKQQD 55

Query: 225 FNAKWDS 231
             + W S
Sbjct: 56  AQSVWKS 62


>gi|29566880|ref|NP_818445.1| gp145 [Mycobacterium phage Omega]
 gi|29425605|gb|AAN12787.1| gp145 [Mycobacterium phage Omega]
          Length = 219

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/116 (9%), Positives = 30/116 (25%), Gaps = 9/116 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +            G+  G         D+D    + +       +        +V     
Sbjct: 107 IRKWWTENPNYNIGLPTGRAA-GFDVVDIDG--PEGMKSLAELGEGVLPDVHGKVATPRG 163

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
             +     +       +   ++  +++ + G   VA        + Y+W + P   
Sbjct: 164 FHLYVAGTDDG-----NRAGVRPGIDYRSTGGFVVAVPSV-VNGKQYSWVVRPSPE 213


>gi|283769256|ref|ZP_06342160.1| primase C-terminal 2 (PriCT-2) [Bulleidia extructa W1219]
 gi|283104232|gb|EFC05611.1| primase C-terminal 2 (PriCT-2) [Bulleidia extructa W1219]
          Length = 764

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 24/68 (35%), Gaps = 7/68 (10%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG-RTYDEKS 224
              ++   L        N ++ EW+ V MA+ YE        ++   W       Y    
Sbjct: 4   RIEDLITALEYVDP--RNLNYQEWVNVGMALKYEG----AYVDVWDRWSSQDTERYHAGE 57

Query: 225 FNAKWDSF 232
              KW+SF
Sbjct: 58  CEKKWNSF 65


>gi|322816464|gb|EFZ24760.1| hypothetical protein TCSYLVIO_9094 [Trypanosoma cruzi]
          Length = 712

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 19/56 (33%), Gaps = 2/56 (3%)

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
                 S+D W+ V +A+H          E    +       Y  +S   KW  F+
Sbjct: 632 PPRSAESYDIWVRVGLALHN-FSNEDHVFEEWVRFSLKCPQKYSRESCRKKWQQFE 686


>gi|71667860|ref|XP_820875.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70886237|gb|EAN99024.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 721

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 19/56 (33%), Gaps = 2/56 (3%)

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
                 S+D W+ V +A+H          E    +       Y  +S   KW  F+
Sbjct: 641 PPRSAESYDIWVRVGLALHN-FSNEDHVFEEWVRFSLKCPQKYSRESCRKKWQQFE 695


>gi|71660435|ref|XP_821934.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70887325|gb|EAO00083.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 722

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 19/56 (33%), Gaps = 2/56 (3%)

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
                 S+D W+ V +A+H          E    +       Y  +S   KW  F+
Sbjct: 642 PPRSAESYDIWVRVGLALHN-FSNEDHVFEEWVRFSLKCPQKYSRESCRKKWQQFE 696


>gi|291531537|emb|CBK97122.1| RecA-family ATPase [Eubacterium siraeum 70/3]
          Length = 739

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 25/71 (35%), Gaps = 6/71 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
               + ++   L        + S+ EW+ V MA+  E         +   W      Y +
Sbjct: 1   MSEFDFDLNEALKYISPS--DLSYQEWVNVGMALKEEGYS----VTVWDNWSANDNRYHK 54

Query: 223 KSFNAKWDSFD 233
                KW+SF+
Sbjct: 55  GECEKKWESFN 65


>gi|224541910|ref|ZP_03682449.1| hypothetical protein CATMIT_01083 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525144|gb|EEF94249.1| hypothetical protein CATMIT_01083 [Catenibacterium mitsuokai DSM
           15897]
          Length = 748

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 23/63 (36%), Gaps = 7/63 (11%)

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEKSFNAKWD 230
             L+         S+ EW  V MA+ +E   +++       W       Y       KW+
Sbjct: 8   ELLNYINPSEL--SYQEWTNVGMALKHEGYEASD----WDSWSSQDSERYKRGECFTKWN 61

Query: 231 SFD 233
           SF+
Sbjct: 62  SFN 64


>gi|134097719|ref|YP_001103380.1| hypothetical protein SACE_1124 [Saccharopolyspora erythraea NRRL
           2338]
 gi|291006321|ref|ZP_06564294.1| hypothetical protein SeryN2_17535 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133910342|emb|CAM00455.1| hypothetical protein SACE_1124 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 314

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/162 (10%), Positives = 33/162 (20%), Gaps = 26/162 (16%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVDVLDE--------------QVVDRFNNEFQSCCGKPIS 54
           +     G+  G     +   D DV                   +D F          P  
Sbjct: 69  HDAYNIGLATGPA--GLLVVDFDVPKPGKPVPDRWAAQGVESGMDVFLLLCAEAGQAPPL 126

Query: 55  RV----GQAPKTLMLFRMQETNLKKQKS--EEKIQGHLEFLAYGQQFVAYNIHPKTQRAY 108
                   +  T + F +      +        +   ++   +G   VA     +     
Sbjct: 127 ETFTVATPSGGTHLYFTVPADAGLRITQGERNGLGWGIDTRGHGGYVVAPGSIRRDGTY- 185

Query: 109 TWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
                 H   +  LP    + +          T         
Sbjct: 186 ---TITHDRPLMPLPGWLIERLRPQELPPQQPTPVATISGRR 224


>gi|167749501|ref|ZP_02421628.1| hypothetical protein EUBSIR_00457 [Eubacterium siraeum DSM 15702]
 gi|167657529|gb|EDS01659.1| hypothetical protein EUBSIR_00457 [Eubacterium siraeum DSM 15702]
          Length = 739

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 25/71 (35%), Gaps = 6/71 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
               + ++   L        + S+ EW+ V MA+  E         +   W      Y +
Sbjct: 1   MSEFDFDLNEALKYISPS--DLSYQEWVNVGMALKEEGYS----VTVWDNWSANDNRYHK 54

Query: 223 KSFNAKWDSFD 233
                KW+SF+
Sbjct: 55  GECEKKWESFN 65


>gi|13358409|ref|NP_078717.1| D5 family NTPase involved in DNA replication [Lymphocystis disease
           virus 1]
          Length = 874

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 33/119 (27%), Gaps = 9/119 (7%)

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG---E 179
           P +                    K      + KI     N     +E ++ L        
Sbjct: 219 PRILACFYLTIMPQDKEPYLVTFKTVKLSLVDKIISKKANLLIEPLEKQSKLQKLIDLLP 278

Query: 180 EFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW------DSF 232
              +     W+ +   +   T GS EG ++   + K    +++      W      +SF
Sbjct: 279 NECSNDRIIWLEIGFCLWQITDGSNEGFQLWLSFSKRSEKFNQDECFDIWFKQMKPNSF 337


>gi|302520426|ref|ZP_07272768.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gi|302429321|gb|EFL01137.1| conserved hypothetical protein [Streptomyces sp. SPB78]
          Length = 334

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 34/114 (29%), Gaps = 5/114 (4%)

Query: 1   MVATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG---KPISRV 56
           ++           G+GI CG+  + +   D+D        R      +  G       RV
Sbjct: 95  VIRALFARAPRASGYGIACGLAPYHLIGLDLDTKHGADPLRALALLGARHGFVLPATVRV 154

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                   L+      L  + S  ++   ++    G   V       T+  Y +
Sbjct: 155 ATPSGGAHLWLSAPAGLTVRNSASRLAPGIDVRGTGGYLVGPGS-RTTRGVYRF 207


>gi|302552580|ref|ZP_07304922.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302470198|gb|EFL33291.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 202

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 31/117 (26%), Gaps = 8/117 (6%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCC---GKPISRVGQAPKTLMLF 66
             G+GI CG+  H +   D+DV                        +  V  +    +  
Sbjct: 81  ATGYGIACGLPPHHLIGLDLDVKTGTDSSAALRELALRHLFTIPPTVVIVTPSGGRHLWL 140

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
                 +    S  ++   ++    G   V             ++ AP    +   P
Sbjct: 141 SGPSE-VVVPNSAGRLAPGIDIRGAGGYLVGPGS---RTGQGVYAAAPGTAHLAPAP 193


>gi|239908829|ref|YP_002955571.1| hypothetical protein DMR_41940 [Desulfovibrio magneticus RS-1]
 gi|239798696|dbj|BAH77685.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 873

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 42/142 (29%), Gaps = 14/142 (9%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
               GI+ G  +  V   D+D          +N F+         V  A      +   E
Sbjct: 62  NCNAGIVTGP-SSGVIVLDIDNQVLFSRFVASNNFEVRD---TFTVKTAKGEHRYYLYPE 117

Query: 71  TN---LKKQKSEEKIQGHL-EFLAYGQQFVAY-NIHPKTQRAYTWSIAPHALKVEELPLL 125
                    K     +  + +    G Q VA  +IHP+T   Y      + ++V E P  
Sbjct: 118 NKEVNSFPVKHPLFKKVSIFDVRGVGGQVVAPFSIHPETNEIYR---IINDVEVAEAPDW 174

Query: 126 TPDEVEYFFEFFDTITTPRDKE 147
               ++        +      +
Sbjct: 175 L--LMDKSNYDLSDLMYVSPGD 194


>gi|256377802|ref|YP_003101462.1| Bifunctional DNA primase/polymerase [Actinosynnema mirum DSM 43827]
 gi|255922105|gb|ACU37616.1| Bifunctional DNA primase/polymerase [Actinosynnema mirum DSM 43827]
          Length = 271

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 34/171 (19%), Gaps = 20/171 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP-ISRVG-QA 59
           V            GI C      +   D+DV            F+     P   RVG  +
Sbjct: 43  VRAWWARAP-FNVGIAC--RGAGLLVVDLDVPGG------REVFEGLGSSPVTYRVGTPS 93

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                 FR     L         +  ++    G   VA          Y           
Sbjct: 94  GGEHRYFRAPPVRLGNSAGRLGPR--VDTRGVGGYVVAAGSA-VRGVRYRVLCD------ 144

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
           E +       V        +   P     S R  +                
Sbjct: 145 EPVAPAPEWLVAALAPAPRSPVAPAVNPSSRRVRAYRDAVVAGEVERVRGA 195


>gi|328882523|emb|CCA55762.1| hypothetical protein SVEN_2476 [Streptomyces venezuelae ATCC 10712]
          Length = 321

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 40/183 (21%), Gaps = 21/183 (11%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVL-------DEQVVDRFNNEFQSCCGKPI 53
           ++A    H      GI  G     +   D+D L           V  F    +       
Sbjct: 79  LLAAAWTHAP-YNIGIATGP--SGLLVVDLDTLKPTDEEGTPDGVTTFEALCERAGQAVP 135

Query: 54  SR---VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                        + F     +     +  ++  H++   +G   VA             
Sbjct: 136 LTHRVRTARGGQHLYFTQPTGHRLGN-TAGRLGKHIDTRGWGGYVVAPGSTTADGAY--- 191

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
                 L       L P  ++          T           +  + +   R       
Sbjct: 192 ----EVLDSRPPAPLPPWILDALTARPQPAQTATVPPAPLTVRASRYAAAALRNEVGNVA 247

Query: 171 RAF 173
           RA 
Sbjct: 248 RAA 250


>gi|323138660|ref|ZP_08073727.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
 gi|322396148|gb|EFX98682.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
          Length = 416

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/138 (10%), Positives = 27/138 (19%), Gaps = 14/138 (10%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
               +      I     +  +   D D     D                           
Sbjct: 60  WWTRWPDALPAIDL--ASAGLLVIDADRHGGPDGVAAFDQLVAVHGLPDGAPVIETARGG 117

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
              +FR     L  ++        +     G   +A        R   W  A  +  + E
Sbjct: 118 LHYIFRNLPDQLGNREG-GLAGRGINVRGAGGYIIAPGSILPDGR--CWREADGSPTLVE 174

Query: 122 ------LPLLTPDEVEYF 133
                 +P +    V   
Sbjct: 175 AYSSGTIPEVPAWIVALI 192


>gi|77405307|ref|ZP_00782403.1| conserved hypothetical protein [Streptococcus agalactiae H36B]
 gi|77176102|gb|EAO78875.1| conserved hypothetical protein [Streptococcus agalactiae H36B]
          Length = 765

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 26/73 (35%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            +N    +  +   L           +  W+ V MA+ +E   + +       W +    
Sbjct: 4   KDNMAENDFNLLPLLDYINP--ATVDYQTWVQVGMALKHEGYTAMD----WDVWSQSDSR 57

Query: 220 YDEKSFNAKWDSF 232
           Y +    AKWDSF
Sbjct: 58  YKKGECFAKWDSF 70


>gi|226306821|ref|YP_002766781.1| hypothetical protein RER_33340 [Rhodococcus erythropolis PR4]
 gi|226185938|dbj|BAH34042.1| hypothetical protein RER_33340 [Rhodococcus erythropolis PR4]
          Length = 290

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/158 (9%), Positives = 36/158 (22%), Gaps = 23/158 (14%)

Query: 4   TDVDHYV----YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA 59
           T ++ +         G+        +   D+D     +    N    S     + R  + 
Sbjct: 61  TQIEKWTRTHADGNIGLR---PDVGMLVVDIDSA-ALLAPWMNERGLSLPPTRVVRTNR- 115

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYT-WSIAPHALK 118
             +   +                   ++        +A     K+ R Y  W   P    
Sbjct: 116 -GSHYYYAHSSERPLLAAIP-----GVDLKTEKGFVLAPGSIHKSGRIYRVWRDLP---- 165

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
              +  L  + +++          P         +   
Sbjct: 166 ---IAELPAEWLKHIQRPEPKPRPPVVTRSGGPSVGTP 200


>gi|318061648|ref|ZP_07980369.1| hypothetical protein SSA3_27160 [Streptomyces sp. SA3_actG]
 gi|318078252|ref|ZP_07985584.1| hypothetical protein SSA3_16412 [Streptomyces sp. SA3_actF]
          Length = 249

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 35/114 (30%), Gaps = 5/114 (4%)

Query: 1   MVATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG---KPISRV 56
           ++         + G+GI CG+  + +   D+D        R      +  G       RV
Sbjct: 10  VIRALFARAPRSSGYGIACGLAPYHLIGLDLDTKHGADPLRALALLGARHGFVLPATVRV 69

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                   L+      L  + S  ++   ++    G   V       T+  Y +
Sbjct: 70  ATPSGGAHLWLSAPAGLTVRNSASRLAPGIDVRGTGGYLVGPGS-RTTRGVYRF 122


>gi|167462159|ref|ZP_02327248.1| RecA-family ATPase [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 768

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 28/86 (32%), Gaps = 7/86 (8%)

Query: 149 SYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKE 208
                              +++ + L          ++ EWI V MA+ YE   +++   
Sbjct: 4   RQFNHGSKQGKVEKPMEHKLDLVSLLEYIDPS--YLNYQEWINVGMALKYEGYTASD--- 58

Query: 209 IVREWCKLGR-TYDEKSFNAKWDSFD 233
              +W K     Y       KW +F+
Sbjct: 59  -WDDWSKRDSTRYHPGECFKKWTTFE 83


>gi|296394743|ref|YP_003659627.1| phage/plasmid primase [Segniliparus rotundus DSM 44985]
 gi|296181890|gb|ADG98796.1| phage/plasmid primase, P4 family [Segniliparus rotundus DSM 44985]
          Length = 761

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 39/141 (27%), Gaps = 16/141 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV----LDEQVVDRFNNEFQSCCGKPISRVG 57
           V    +    +   +        V   D+D          +      +       +S   
Sbjct: 49  VVAWSEERAGSNLALRL---PDGVVGIDIDHYAGKRGGDTLAEAVRRWGPLPPTVMSTSR 105

Query: 58  QAP-KTLMLFRMQETNL--KKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTW--S 111
           +     + L+R+        +    E   G +E +       VA        RAY W  S
Sbjct: 106 EDGVSGIRLYRLPSPAALTTQIGFPELGLGGIEVVQRHHRYLVAPPSIHPEGRAYRWLDS 165

Query: 112 IAPHALKVEE---LPLLTPDE 129
            A    ++ E   LPLL    
Sbjct: 166 QAMGPAELPEPGSLPLLPERW 186


>gi|307269951|ref|ZP_07551277.1| primase 2 [Enterococcus faecalis TX4248]
 gi|306513741|gb|EFM82347.1| primase 2 [Enterococcus faecalis TX4248]
          Length = 758

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 27/72 (37%), Gaps = 6/72 (8%)

Query: 161 NNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY 220
           N +    +++   L        +  + EW+ V MA+  E   + +      +W +    Y
Sbjct: 11  NTQMENKLDLIELLEYIDP--ASLGYQEWVNVGMALKQEGYTAVD----WDQWSQSDSRY 64

Query: 221 DEKSFNAKWDSF 232
                  KW+SF
Sbjct: 65  HSGECFKKWESF 76


>gi|220908021|ref|YP_002483332.1| hypothetical protein Cyan7425_2616 [Cyanothece sp. PCC 7425]
 gi|219864632|gb|ACL44971.1| hypothetical protein Cyan7425_2616 [Cyanothece sp. PCC 7425]
          Length = 142

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 22/63 (34%), Gaps = 3/63 (4%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF---QSCCGKPISRVGQAPKTLMLFRM 68
            G G+L G  +  + A D D      V +        ++         G+  +  ML+ +
Sbjct: 76  TGVGLLTGEASGGLVAVDHDGHSADEVLKELAGCPPEEALPPTLHWTSGRTGRYQMLYPV 135

Query: 69  QET 71
            + 
Sbjct: 136 SKE 138


>gi|145592628|ref|YP_001156925.1| hypothetical protein Strop_0062 [Salinispora tropica CNB-440]
 gi|145301965|gb|ABP52547.1| hypothetical protein Strop_0062 [Salinispora tropica CNB-440]
          Length = 391

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 42/142 (29%), Gaps = 30/142 (21%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQ-------------VVDRFNNEFQSCCGKPI------ 53
           G GI CG     +   D+DV                              G+PI      
Sbjct: 152 GVGIACGP--SGLVVIDLDVRKPDQDAPPGNPHPAATSGIDVFAALCETAGQPIPDDTYA 209

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEE----KIQGHLEFLAYGQQFVAYNIHPKTQRAYT 109
              G+   + + FR    +   + +       +   ++  A+G   VA        R+YT
Sbjct: 210 VTTGR-GGSHLYFRHPADSPALRNTAGERGNGLGWLVDTRAHGGYVVAAGS-TVAGRSYT 267

Query: 110 WSIAPHALKVEELPLLTPDEVE 131
                  L V ELP    + + 
Sbjct: 268 ---VARDLPVAELPGWLAERLA 286


>gi|62184576|ref|YP_220481.1| hypothetical protein pFP11.26 [Streptomyces sp. F11]
 gi|61661460|gb|AAX51330.1| unknown [Streptomyces sp. F11]
          Length = 301

 Score = 59.8 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 49/179 (27%), Gaps = 19/179 (10%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDE----------QVVDRFNNEFQSCCG---KPISRV-GQ 58
             G+ CG     + A D+DV  E            V   ++      G    P   V   
Sbjct: 51  NIGVACGP--SGLVALDLDVPHEGEVSGSPEIVDGVTMLDSLAARTPGARVTPTLTVRTP 108

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
           +    +++R     +  + +   +   L+  A G   V      +   AY          
Sbjct: 109 SGGRHLVYRAPAG-VAVRNTARTLGFCLDTRAAGGYVVGIGSVVE-GAAYVLE-DGSPTD 165

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
              LP      +    +       PR  +   R      +    +R+    +R+     
Sbjct: 166 PAVLPGWLLTLITAAPKPPKAGGAPRRADVVARLRELTRQGTREQRWAAGILRSECGEL 224


>gi|76810763|ref|YP_331725.1| inner membrane protein [Burkholderia pseudomallei 1710b]
 gi|76580216|gb|ABA49691.1| inner membrane protein [Burkholderia pseudomallei 1710b]
          Length = 955

 Score = 59.4 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 22/73 (30%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N            L     +      D W    MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERASVALGYVPAD----DRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ +     W SF
Sbjct: 56  YNARDARDVWKSF 68


>gi|21222404|ref|NP_628183.1| hypothetical protein SCO4001 [Streptomyces coelicolor A3(2)]
 gi|13122165|emb|CAC32341.1| hypothetical protein 2SC10A7.05c [Streptomyces coelicolor A3(2)]
          Length = 291

 Score = 59.4 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 27/114 (23%), Gaps = 9/114 (7%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQV----VDRFNNEFQSCCGKPISRV 56
           V        +  G+GI CG+  H +   D+D                            V
Sbjct: 73  VRALFAAAPWATGYGIACGLPPHHLIGVDLDTKSAAAQTDSATALRELALRHLFTIPPTV 132

Query: 57  ---GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
                +    +       ++    S  ++   ++    G   V      +    
Sbjct: 133 VVLTPSGGRHLWLTGPPDHV-VPNSAGRLAPGIDIRGAGGYLVGPGSRTRHGAY 185


>gi|48697236|ref|YP_024966.1| putative primase/helicase protein [Burkholderia phage BcepC6B]
 gi|47779042|gb|AAT38405.1| putative primase/helicase protein [Burkholderia phage BcepC6B]
          Length = 888

 Score = 59.4 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 66/253 (26%), Gaps = 32/253 (12%)

Query: 3   ATDVDHYVYNGFG-ILCGIGTHPVYAFDVDVLDEQV--------VDRFNNEFQ--SCCGK 51
           A  V+     G   I  G  T  +   D+D    +           R     +       
Sbjct: 77  AHHVNGGPAYGAAQIEPGASTTRIACLDLDSHKGETPWPDMQDVAVRIMARLEAAGLRPI 136

Query: 52  PISRVGQAP-KTLMLFRMQETNLKKQKSEEKIQGHLEFL------AYGQQFVAY--NIHP 102
           P    G A     +L+   +     + +        E        A GQ  V    N  P
Sbjct: 137 PFRSSGGAGLHIYVLWDEPQDAYSVRCALRAALAACELRDGTKGIAAGQVEVFPKQNSVP 196

Query: 103 KTQRAYTWSIAPHALKVE----ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                  + +      V     EL  +         ++  +   P    +          
Sbjct: 197 SDGFGNMFVLPLAGKSVPLDSFELDDMPKTF-AAEMDWPSSAAVPLVAREEIVMPGTADV 255

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNG-SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG 217
                      I++ L        +   ++ W  VV  IH+  RGS +G  +  E+    
Sbjct: 256 PV-----ELELIKSALDMIPNAGVDELDYEAWRDVVFGIHHAARGSDDGLALAHEFSARS 310

Query: 218 RTYDEKSF-NAKW 229
             Y+ +      W
Sbjct: 311 SKYNPRFLDERVW 323


>gi|237810289|ref|YP_002894740.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
 gi|237504566|gb|ACQ96884.1| primase C 2 (PriCT-2) family [Burkholderia pseudomallei MSHR346]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|53717722|ref|YP_106708.1| hypothetical protein BPSL0082 [Burkholderia pseudomallei K96243]
 gi|52208136|emb|CAH34066.1| hypothetical protein BPSL0082 [Burkholderia pseudomallei K96243]
          Length = 955

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 22/73 (30%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N            L     +      D W    MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERASVALGYVPAD----DRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ +     W SF
Sbjct: 56  YNARDARDVWKSF 68


>gi|256786521|ref|ZP_05524952.1| hypothetical protein SlivT_18689 [Streptomyces lividans TK24]
 gi|289770413|ref|ZP_06529791.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|289700612|gb|EFD68041.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 291

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 27/114 (23%), Gaps = 9/114 (7%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQV----VDRFNNEFQSCCGKPISRV 56
           V        +  G+GI CG+  H +   D+D                            V
Sbjct: 73  VRALFAAAPWATGYGIACGLPPHHLIGVDLDTKSAAAQTDSATALRELALRHLFTIPPTV 132

Query: 57  ---GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
                +    +       ++    S  ++   ++    G   V      +    
Sbjct: 133 VVLTPSGGRHLWLTGPPDHV-VPNSAGRLAPGIDIRGAGGYLVGPGSRTRHGAY 185


>gi|302385773|ref|YP_003821595.1| Primase 2 [Clostridium saccharolyticum WM1]
 gi|302196401|gb|ADL03972.1| Primase 2 [Clostridium saccharolyticum WM1]
          Length = 735

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 24/68 (35%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
            +  ++   L+         S+ +WI V MA+ +E        ++   W    R Y    
Sbjct: 2   DSTYDLMEVLNHIDPSEL--SYQDWINVGMALQHEGYS----VDVWDRWSMNDRRYHAGE 55

Query: 225 FNAKWDSF 232
              KW  F
Sbjct: 56  CEKKWRGF 63


>gi|126440554|ref|YP_001057153.1| hypothetical protein BURPS668_0098 [Burkholderia pseudomallei 668]
 gi|126220047|gb|ABN83553.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|312900435|ref|ZP_07759744.1| primase 2 [Enterococcus faecalis TX0470]
 gi|311292457|gb|EFQ71013.1| primase 2 [Enterococcus faecalis TX0470]
          Length = 752

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 25/68 (36%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
              +++   L        +  + EW+ V MA+  E   + +      +W +    Y    
Sbjct: 15  ENKLDLIELLEYIDP--ASLGYQEWVNVGMALKQEGYTAVD----WDQWSQSDSRYHSGE 68

Query: 225 FNAKWDSF 232
              KW+SF
Sbjct: 69  CFKKWESF 76


>gi|167822127|ref|ZP_02453598.1| inner membrane protein [Burkholderia pseudomallei 9]
 gi|226193316|ref|ZP_03788926.1| DNA primase TraC [Burkholderia pseudomallei Pakistan 9]
 gi|225934916|gb|EEH30893.1| DNA primase TraC [Burkholderia pseudomallei Pakistan 9]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|254261053|ref|ZP_04952107.1| DNA primase TraC [Burkholderia pseudomallei 1710a]
 gi|254219742|gb|EET09126.1| DNA primase TraC [Burkholderia pseudomallei 1710a]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|302544086|ref|ZP_07296428.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302461704|gb|EFL24797.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           himastatinicus ATCC 53653]
          Length = 303

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 39/161 (24%), Gaps = 7/161 (4%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP-----ISR 55
           +        +  G+GI CG   H +   D+D+  E  VD      +              
Sbjct: 70  IRALFAAAPWATGYGIACGCAPHHLIGVDLDLKHEPRVDGAAALARLARRYAFAVPHTVT 129

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
           V        L+      L    S  +I   ++    G   V         R Y  +    
Sbjct: 130 VLTPGGGRHLWLCGPPGLGVPNSAGRIAPGIDIRGTGGYLVGPGSATSRGR-YRLAPGSP 188

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
           A     +P      V+          T R            
Sbjct: 189 AWHPAPVPPELLSLVQPPVRTPPERATARPSAVGAPGRDAA 229


>gi|257080671|ref|ZP_05575032.1| RecA-family ATPase [Enterococcus faecalis E1Sol]
 gi|256988701|gb|EEU76003.1| RecA-family ATPase [Enterococcus faecalis E1Sol]
          Length = 743

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 25/68 (36%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
              +++   L        +  + EW+ V MA+  E   + +      +W +    Y    
Sbjct: 6   ENKLDLIELLEYIDP--ASLGYQEWVNVGMALKQEGYTAVD----WDQWSQSDSRYHSGE 59

Query: 225 FNAKWDSF 232
              KW+SF
Sbjct: 60  CFKKWESF 67


>gi|167736508|ref|ZP_02409282.1| hypothetical protein Bpse14_00515 [Burkholderia pseudomallei 14]
          Length = 953

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ K     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNAKDARDVWKSF 63


>gi|154333715|ref|XP_001563114.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134060124|emb|CAM37437.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 580

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 18/56 (32%), Gaps = 2/56 (3%)

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
                 ++D W+ V +A+H          E    +       Y  +    KW  F+
Sbjct: 503 PPRAAETYDVWVRVGLALHN-FSNEDHVFEEWVLFSLKSPLKYSREVCRKKWVQFE 557


>gi|297193395|ref|ZP_06910793.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297151754|gb|EFH31333.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 315

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/139 (12%), Positives = 31/139 (22%), Gaps = 4/139 (2%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVV-DRFNNEFQSCCGKPISRVG--QAPKTLMLFR 67
             G+GI CG   H +   D+D            +            V          L+ 
Sbjct: 107 ATGYGIACGRPPHHLIGIDLDTKSSTDSMAELQHLALRHLFTIPETVTVLTPSGGRHLWL 166

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTP 127
               +     S  ++   ++    G   V           Y  +     L     P    
Sbjct: 167 TGPPDTVVPNSASRLAPGIDVRGTGGYLVGPGSVTAHGA-YRIAPGTAHLAPAPCPRALL 225

Query: 128 DEVEYFFEFFDTITTPRDK 146
             +           +P  +
Sbjct: 226 RLIAPPARTRSAAGSPHGQ 244


>gi|323340042|ref|ZP_08080308.1| RecA-family ATPase [Lactobacillus ruminis ATCC 25644]
 gi|323092548|gb|EFZ35154.1| RecA-family ATPase [Lactobacillus ruminis ATCC 25644]
          Length = 769

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 23/69 (33%), Gaps = 7/69 (10%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEKS 224
              ++   L           ++ W+ V MA+ +E     +       W +     Y +  
Sbjct: 2   EKFDLVPLLDYIDP--AMLDYNGWVQVGMALKHEGYSVDD----WDTWSQRDSARYHDGE 55

Query: 225 FNAKWDSFD 233
              KW+ FD
Sbjct: 56  CERKWNGFD 64


>gi|126452256|ref|YP_001064398.1| hypothetical protein BURPS1106A_0113 [Burkholderia pseudomallei
           1106a]
 gi|242316894|ref|ZP_04815910.1| DNA primase TraC [Burkholderia pseudomallei 1106b]
 gi|126225898|gb|ABN89438.1| DNA primase TraC [Burkholderia pseudomallei 1106a]
 gi|242140133|gb|EES26535.1| DNA primase TraC [Burkholderia pseudomallei 1106b]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|78067109|ref|YP_369878.1| virulence-associated E family protein [Burkholderia sp. 383]
 gi|77967854|gb|ABB09234.1| Virulence-associated E family protein [Burkholderia sp. 383]
          Length = 761

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 55/191 (28%), Gaps = 8/191 (4%)

Query: 47  SCCGKPISRVGQAP-KTLMLFRMQETNLKKQKSEEKIQGHLEFL-----AYGQQFVAYNI 100
              G P    G A      L+   +     +++   I   ++           Q   +  
Sbjct: 123 GLNGIPFRSSGGAGIHIYFLWDEPQDAYSARQALRSILAAVDLHDGTKGVAAGQVEIFPK 182

Query: 101 HPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
                     ++    L  + +PL + +  +    +   +  P        +   +    
Sbjct: 183 QDSVSHNGYGNMFLLPLAGKSVPLDSFELDDMPKAYVTEMDWPSSAPVPRAEREIVVPPP 242

Query: 161 NNRRYTNIEI-RAFLSCFGEEFYNG-SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR 218
                      ++ L        N   +D W  V+  +H+ ++GS EG  +V E+     
Sbjct: 243 AVVAPAEFGALKSALDAIPNGGENELDYDSWRNVLFGVHHASQGSDEGLALVHEFSARSS 302

Query: 219 TYDEKSFNAKW 229
            YD       W
Sbjct: 303 KYDPAKTERDW 313


>gi|239928908|ref|ZP_04685861.1| hypothetical protein SghaA1_11855 [Streptomyces ghanaensis ATCC
           14672]
 gi|291437235|ref|ZP_06576625.1| hypothetical protein SSFG_02335 [Streptomyces ghanaensis ATCC
           14672]
 gi|291340130|gb|EFE67086.1| hypothetical protein SSFG_02335 [Streptomyces ghanaensis ATCC
           14672]
          Length = 296

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/148 (10%), Positives = 32/148 (21%), Gaps = 22/148 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL----------DEQVVDRFNNEFQSCCGK 51
           +            GI  G     +   D+DV                             
Sbjct: 61  IRAAWSQAP-FNVGIATGP--SGLLVVDLDVPKDKGSSDAPGGAATFAALCERAGHAVPT 117

Query: 52  PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                  +  T + F      ++   +   +   ++  A+G   VA           T  
Sbjct: 118 TYRTRTASGGTHLYFTAPNG-VRLPNTAGTVADSVDTRAWGGYVVAAGS--------TTP 168

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDT 139
             P+         + P  ++   +    
Sbjct: 169 AGPYEALCGSAAAVLPAWLQSILQPAPA 196


>gi|56694890|ref|YP_164400.1| hypothetical protein BCBBV1cgp22 [Bacillus phage BCJA1c]
 gi|52631317|gb|AAU85069.1| 22 [Bacillus phage BCJA1c]
          Length = 740

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 27/70 (38%), Gaps = 7/70 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEK 223
              +++ A L           + EW+ V MA+  E   +++      +W K  G  Y   
Sbjct: 2   ENKMDLIALLEYIDPS--YLDYQEWLNVGMALKSEGYTASD----WEDWSKRDGPRYHPG 55

Query: 224 SFNAKWDSFD 233
               KW +F+
Sbjct: 56  ECFKKWTTFE 65


>gi|167813585|ref|ZP_02445265.1| hypothetical protein Bpse9_00515 [Burkholderia pseudomallei 91]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|167843732|ref|ZP_02469240.1| hypothetical protein BpseB_00480 [Burkholderia pseudomallei B7210]
          Length = 950

 Score = 59.4 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|61741085|gb|AAX54510.1| ATPase [Lymphocystis disease virus 1]
          Length = 865

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 19/58 (32%)

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            +L            D W+ +   +   T GS +G  I   + K    Y+E      W
Sbjct: 262 QYLIDLLPLECADDRDIWLEIGFCMWQITEGSPKGYTIWTSFSKKSEKYNEDECFDLW 319


>gi|167900117|ref|ZP_02487518.1| hypothetical protein Bpse7_40730 [Burkholderia pseudomallei 7894]
          Length = 255

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQNYNARDARDVWKSF 63


>gi|302559769|ref|ZP_07312111.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           griseoflavus Tu4000]
 gi|302477387|gb|EFL40480.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           griseoflavus Tu4000]
          Length = 317

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 25/102 (24%), Gaps = 5/102 (4%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVV-DRFNNEFQSCCGKPISRV---GQAPKTLML 65
              G+GI CG+  H +   D+D                       + V     +    + 
Sbjct: 109 RATGYGIACGLPPHHLIGVDLDTKTGTDARAALRELALRHLFTIPATVVVLTPSGGRHLW 168

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
                 ++    S  ++   ++    G   V           
Sbjct: 169 LTGP-PDVVVPNSAGRLAPGIDIRGAGGYLVGPGSRTDHGAY 209


>gi|291460141|ref|ZP_06599531.1| RecA-family ATPase [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417482|gb|EFE91201.1| RecA-family ATPase [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 764

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 6/67 (8%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
           T  ++ A L           + EWI V MA+  E   ++E      +W +    Y     
Sbjct: 2   TQFDLTALLGYIDPS--TLDYQEWINVGMALKQEGHTASE----WDQWSRADARYKPGEC 55

Query: 226 NAKWDSF 232
             KW +F
Sbjct: 56  FKKWMTF 62


>gi|167583159|ref|ZP_02376033.1| DNA primase [Burkholderia thailandensis TXDOH]
          Length = 950

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 21/68 (30%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                    L     +      D W    MA+  E     EG  I  EW +  + Y+ + 
Sbjct: 2   SEFERASIALGYVPAD----DRDTWRQAGMALKAEF--GEEGFAIWNEWSQGAQNYNARD 55

Query: 225 FNAKWDSF 232
               W SF
Sbjct: 56  ARDVWKSF 63


>gi|309780874|ref|ZP_07675614.1| regulatory prophage protein [Ralstonia sp. 5_7_47FAA]
 gi|308920340|gb|EFP65997.1| regulatory prophage protein [Ralstonia sp. 5_7_47FAA]
          Length = 670

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/170 (12%), Positives = 42/170 (24%), Gaps = 21/170 (12%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVG---Q 58
           +      +  +  G+  G       A D+D  D +   R      +      S +    Q
Sbjct: 70  IQDHWSAHPADNVGLFMG---DEYVALDIDTKDGKEGARTLAWLAAKYPPIRSTLTQRSQ 126

Query: 59  APKTLMLFRMQETNLKKQK-------SEEKIQGHLEFL-AYGQQFVAYNIHPKTQRAYTW 110
           +     +FR+      + +               L+ +       VA +       AY W
Sbjct: 127 SGGWHKIFRLTPAQRCRLRKHTNVRLGPCHANSGLDIITGNAIIVVAPSTTHV--GAYKW 184

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
                     E+  +  D  E           P +        +K     
Sbjct: 185 KDLD-----AEILDMPDDLFELLVSVEHAGREPANDPAPQLLGAKPPVVE 229


>gi|29566306|ref|NP_817873.1| gp22 [Mycobacterium phage Corndog]
 gi|29425031|gb|AAN01954.1| gp22 [Mycobacterium phage Corndog]
          Length = 786

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 60/218 (27%), Gaps = 17/218 (7%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPI------SRVGQ 58
             + Y      +        V   DVD    +       E +   G         SR+  
Sbjct: 55  WSELYPDGNLCLRL---PDGVVGIDVDAYGAKTGAAALAEAERRWGPLPDGPQSTSRLDD 111

Query: 59  APKTLMLFRMQETNL--KKQKSEEKIQGHLEFLA-YGQQFVAYNIHPKTQRAYTWSIAPH 115
               L LFR+    L        E   G +E +  + +  V +       RAY W  +  
Sbjct: 112 PVSGLRLFRVPPGTLLETIIVFRELSIGDIEVIQPHHRYAVCWPSIHPEGRAYWWRNSQG 171

Query: 116 AL----KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
                 +++++P L P  +E       ++    +     R+                   
Sbjct: 172 QTIGIPELDDIPELPPSWLEGLKLTPRSLDLSMEG-FDVRQAVTAGDPSPLVSARLTMAI 230

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEI 209
             L+  G   ++      + ++        G  +   +
Sbjct: 231 KELNLPGTSRHDTCLRHVLAILRMGAEGQPGVEQALTL 268


>gi|28379720|ref|NP_786612.1| prophage Lp4 protein 7, DNA replication [Lactobacillus plantarum
           WCFS1]
 gi|28272560|emb|CAD65487.1| prophage Lp4 protein 7, DNA replication [Lactobacillus plantarum
           WCFS1]
          Length = 259

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/154 (12%), Positives = 41/154 (26%), Gaps = 16/154 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDV----DVLDEQVVDRFNNEFQSCCGKPISRVG 57
           +    +H      GI        +   DV    D+   Q + R N   ++          
Sbjct: 47  IKGWFEHVPGANLGIRLDQVK--LLVVDVDRHGDIDGVQTLKRLNEHGKTLPSDTYIEQT 104

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                  LF++ +      K    +   ++ LA     VA ++      AY         
Sbjct: 105 PNDGLHYLFKLPDKL--DMKRRTGLYPGIDVLAD-FVLVAPSVI--NGSAYR-----AIE 154

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYR 151
              E+       ++           P+   +  +
Sbjct: 155 PTNEITTAPQWLIDDLLPSQRMNKAPQPASQIRK 188


>gi|145224477|ref|YP_001135155.1| hypothetical protein Mflv_3896 [Mycobacterium gilvum PYR-GCK]
 gi|145216963|gb|ABP46367.1| hypothetical protein Mflv_3896 [Mycobacterium gilvum PYR-GCK]
          Length = 692

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 30/132 (22%), Gaps = 14/132 (10%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR--VGQAPK 61
              D +     GI CG     +   D D   E           +          V     
Sbjct: 76  AWKDRHGLANIGIACGP--SGLVVLDEDGDGEVT-----RWCVTYGVTLPDTYEVTTGRG 128

Query: 62  TLMLFRMQET-NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
             + F    T        +      L+    G   V       +   YT     + L   
Sbjct: 129 RHLYFAWDHTAQRIGNVPKAVKDFALDVRGDGGYAVGEGSQHVSGAIYT----GNGLPAA 184

Query: 121 ELPLLTPDEVEY 132
            LP+   + +  
Sbjct: 185 PLPVQVAEILLA 196


>gi|294486130|gb|ADE87946.1| putative primase [Escherichia phage vB_EcoM_ECO1230-10]
          Length = 767

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 23/66 (34%), Gaps = 5/66 (7%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
           T  EI   LS           + W+ + MA+  E      G  +  +W +    Y+ K  
Sbjct: 11  TEQEIAEALSYIDAGC---DRETWVRMAMAVKSEL--GDGGFTVWNDWSRQSDKYNSKDA 65

Query: 226 NAKWDS 231
              W S
Sbjct: 66  RDTWKS 71


>gi|83717727|ref|YP_440202.1| DNA primase [Burkholderia thailandensis E264]
 gi|83651552|gb|ABC35616.1| DNA primase [Burkholderia thailandensis E264]
          Length = 955

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 22/73 (30%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N            L     +      D W    MA+  E     EG  +  EW +  + 
Sbjct: 2   SNTPMSEFERASVALGYVPAD----DRDTWRHAGMALKAEF--GEEGFALWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ +     W SF
Sbjct: 56  YNARDTRDVWKSF 68


>gi|291336267|gb|ADD95832.1| predicted ATPase [uncultured organism MedDCM-OCT-S09-C213]
          Length = 890

 Score = 59.0 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 36/94 (38%), Gaps = 1/94 (1%)

Query: 138 DTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIH 197
            ++  P +  +  +      +  +   + NI++   L+           +EWI V   ++
Sbjct: 259 PSLPAPMEVNRRIKPKRTREERQDLDFHNNIDMVKRLTAMLSRKRAEDRNEWIRVGWILY 318

Query: 198 YETRGSAEGKEIVREWCKL-GRTYDEKSFNAKWD 230
               G  E ++I  ++ +     +DE     +W+
Sbjct: 319 NIGNGCDEARDIWLDFSRQCDDKFDETECITQWN 352


>gi|257140828|ref|ZP_05589090.1| DNA primase [Burkholderia thailandensis E264]
          Length = 950

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ +     W SF
Sbjct: 16  ADDRDTWRHAGMALKAEF--GEEGFALWNEWSQGAQNYNARDTRDVWKSF 63


>gi|329938729|ref|ZP_08288125.1| hypothetical protein SGM_3617 [Streptomyces griseoaurantiacus M045]
 gi|329302220|gb|EGG46112.1| hypothetical protein SGM_3617 [Streptomyces griseoaurantiacus M045]
          Length = 341

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 31/117 (26%), Gaps = 8/117 (6%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVD-RFNNEFQSCC---GKPISRVGQAPKTLMLF 66
             G+GI CG+  H +   D+D                         +  V  +    +  
Sbjct: 107 ATGYGIACGLPPHHLIGVDLDTKSGTDSTTALRELALRHLFTIPPTVVVVTPSGGRHLWL 166

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
                ++    S  ++   ++    G   V             +  AP A  +   P
Sbjct: 167 TGP-PDVVVPNSASRLAPGIDIRGAGGYLVGPGSRTDHG---VYETAPGAAHLSPAP 219


>gi|284040171|ref|YP_003390101.1| ATPase P [Spirosoma linguale DSM 74]
 gi|283819464|gb|ADB41302.1| P-loop ATPase and inactivated derivatives-like protein [Spirosoma
           linguale DSM 74]
          Length = 749

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 62/211 (29%), Gaps = 26/211 (12%)

Query: 21  GTHPVYAFDVDVLDEQVVDRFNNEFQSCCGK-PISRVGQAPKTLMLFRMQETNLKKQKSE 79
               + + D+D L+E  + R  N  +S      + R        ++FR+      +    
Sbjct: 92  VPSGLMSVDLDHLEESEIQRVFNLLKSDPYVYAVFRSVGGKGLCVIFRVDYQRWLE---- 147

Query: 80  EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDT 139
                 +      Q  +             W  +   +         PD    +      
Sbjct: 148 --SFEGIRIYLTEQHGLVMG----------WDASVKDICRLRFVSYDPDTYVNYKAQLFK 195

Query: 140 ITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYE 199
               ++K++  +      ++        I  RA           GS+++W  +  A+  +
Sbjct: 196 KYPRKEKKEVVKLPYTHTETDIRYVLDQIHARAL-------DLTGSYEDWFRIGWALISQ 248

Query: 200 TRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
                  + I  E  +   +YD    + K++
Sbjct: 249 Y--GEVARPIFHEVSQYHSSYDSNDCDKKFN 277


>gi|302545972|ref|ZP_07298314.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302463590|gb|EFL26683.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           himastatinicus ATCC 53653]
          Length = 301

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 34/141 (24%), Gaps = 19/141 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL----------DEQVVDRFNNEFQSCCGK 51
           +A     + +    +  G     +   D+DV             +               
Sbjct: 66  IAAWWSRH-WYNVAVATGP--SGLVVIDLDVPKDNSSADTPFGVETFKALCERAGQPVPA 122

Query: 52  PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                  +    + F      ++   +  K+   ++  A+G   VA          Y   
Sbjct: 123 TYRVRTASSGWHLYFTAP-PGVQLANTAGKLGPLIDTRAWGGYVVAAGSA-INGGVY--- 177

Query: 112 IAPHALKVEELPLLTPDEVEY 132
            A   + V  LP      +  
Sbjct: 178 -ADSGVHVAPLPEWLCARLTA 197


>gi|331091444|ref|ZP_08340282.1| hypothetical protein HMPREF9477_00925 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404000|gb|EGG83550.1| hypothetical protein HMPREF9477_00925 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 741

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 21/68 (30%), Gaps = 6/68 (8%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
               +I+  L          ++ EWI V MA+  +         +   W +    Y    
Sbjct: 2   ERGYDIKQILDFLNPSEL--NYQEWIYVGMALKEDGYD----VSVWDSWSRSDSRYHSGE 55

Query: 225 FNAKWDSF 232
              KW  F
Sbjct: 56  CQRKWAGF 63


>gi|182436697|ref|YP_001824416.1| hypothetical protein SGR_2904 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178465213|dbj|BAG19733.1| hypothetical protein [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 294

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/173 (9%), Positives = 37/173 (21%), Gaps = 17/173 (9%)

Query: 13  GFGILCGIGTHPVYAFDVDV---------LDEQVVDRFN-NEFQSCCGKPISRVGQAPKT 62
             G+  G     +   D+D           D     +                   +   
Sbjct: 70  NVGLATGP--SGLVVVDLDPVKAKDPKGTPDGVTSLQALCERAGQTVPATYRTRTASGGH 127

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
            + F      ++   S  ++  H++  A+G   VA                 +      L
Sbjct: 128 HLYFTAP-PGVRLGNSAGRLGKHIDTRAHGGYVVAAGSTLPNGAY----EVVNPTDPVPL 182

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
           P      +         +  P     S    + +             +R +  
Sbjct: 183 PEWLYALLAPRQPSRGLMAVPVPVRASRYAAAALRAETAAVAGAGEGVRNWTL 235


>gi|239916596|ref|YP_002956154.1| hypothetical protein Mlut_00280 [Micrococcus luteus NCTC 2665]
 gi|281414938|ref|ZP_06246680.1| hypothetical protein MlutN2_07018 [Micrococcus luteus NCTC 2665]
 gi|239837803|gb|ACS29600.1| Hypothetical protein Mlut_00280 [Micrococcus luteus NCTC 2665]
          Length = 314

 Score = 58.6 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 25/102 (24%), Gaps = 6/102 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQ 58
           V      +      +  G  +  +   DVDV                    G        
Sbjct: 61  VEAWWRTHPDANLAVPTGAAS-GMVVVDVDVHAPTDGYEAFERAHRAGLVSGWAFLVSTP 119

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
           +      +    T  + Q+S +  +  ++F   G   +    
Sbjct: 120 SGGMHAYY--PATPDRAQRSWQAARAGVDFRGGGGYILLPPS 159


>gi|15674737|ref|NP_268911.1| hypothetical protein SPy_0671 [Streptococcus phage 370.1]
 gi|94992064|ref|YP_600163.1| ATPase [Streptococcus phage 2096.1]
 gi|13621860|gb|AAK33632.1| hypothetical protein, phage associated [Streptococcus phage 370.1]
 gi|94545572|gb|ABF35619.1| RecA-family ATPase [Streptococcus phage 2096.1]
          Length = 757

 Score = 58.6 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 25/70 (35%), Gaps = 6/70 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
                 ++   L          S+ +W+ V  A+ +E   + +       W +    Y +
Sbjct: 1   MTDDKFDLLPLLDYIDPSKL--SYQDWVNVGFALKHEGYTAMD----WDIWSQSDSRYKK 54

Query: 223 KSFNAKWDSF 232
               AKWDSF
Sbjct: 55  GECFAKWDSF 64


>gi|284038164|ref|YP_003388094.1| ATPase P [Spirosoma linguale DSM 74]
 gi|283817457|gb|ADB39295.1| P-loop ATPase and inactivated derivatives-like protein [Spirosoma
           linguale DSM 74]
          Length = 748

 Score = 58.3 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 63/209 (30%), Gaps = 26/209 (12%)

Query: 23  HPVYAFDVDVLDEQVVDRFNNEFQSCCGK-PISRVGQAPKTLMLFRMQETNLKKQKSEEK 81
             + + D+D L+E  ++R  N  +S      + R        ++FR+      +      
Sbjct: 93  SGLMSVDLDHLEESEINRVFNLLKSDPYVYAVFRSVGGKGLCVIFRVDYQRWLE------ 146

Query: 82  IQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
               +      Q  +             W  +   +         P+    +        
Sbjct: 147 SFEGIRIYLTEQHGLVMG----------WDASVKDICRLRFVSYDPETYVNYKAQLFKKY 196

Query: 142 TPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETR 201
             ++K++  +      +S        I  +A            ++++W  +  A+  +  
Sbjct: 197 PRKEKKEVVKLPYTHTESDIRYVLDQIHAKAL-------DLTAAYEDWFRIGWALISQY- 248

Query: 202 GSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
                + I  E  +   +YD  + + K++
Sbjct: 249 -GDAARPIFHEVSQYHSSYDPNNCDKKFN 276


>gi|167835892|ref|ZP_02462775.1| hypothetical protein Bpse38_05335 [Burkholderia thailandensis
           MSMB43]
          Length = 950

 Score = 58.3 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  + Y+ K     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFALWNEWSQGAQNYNAKDACDVWKSF 63


>gi|218295952|ref|ZP_03496732.1| Bifunctional DNA primase/polymerase [Thermus aquaticus Y51MC23]
 gi|218243690|gb|EED10218.1| Bifunctional DNA primase/polymerase [Thermus aquaticus Y51MC23]
          Length = 298

 Score = 58.3 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 56/215 (26%), Gaps = 21/215 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +          G GIL       V   D D        +         G    +      
Sbjct: 53  ITKWWRSCPGCGVGIL---APEEVLVLDFDDPTAWERLKGE---YPTLGDAPRQRTPKGG 106

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPHALKVE 120
             +  R+ +    +  +  +    ++    G+   VA        R YTW +    +K E
Sbjct: 107 YHVFLRLPQ--RVRLSATVRKLAGVDLRGMGKAYVVASPTRLADGRGYTWEVPL--VKPE 162

Query: 121 ELPLLTPDEVEYFFEFF--------DTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
           +LPL+  + +               +  ++PR         +            N  IR 
Sbjct: 163 DLPLIPENLLLRLLPPPPAPREVVVEAGSSPRRLRALLESYAAAVAGAPEGTRHNTLIRY 222

Query: 173 FLSC--FGEEFYNGSHDEWIPVVMAIHYETRGSAE 205
            ++         +    E + V  A+         
Sbjct: 223 AVAAGGLIPHGLSPEEAEEVLVAAAMRAGLPELEA 257


>gi|167463641|ref|ZP_02328730.1| RecA-family ATPase [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 750

 Score = 58.3 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 28/70 (40%), Gaps = 7/70 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDEK 223
              +++ A L          S+ +W+ V MA+ YE   +++      +W K     Y   
Sbjct: 2   EHKLDLVALLEYIDPS--YLSYQDWVAVGMALKYEGYTASD----WDDWSKRDSTRYHPG 55

Query: 224 SFNAKWDSFD 233
               KW +F+
Sbjct: 56  ECFKKWSTFE 65


>gi|302559042|ref|ZP_07311384.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           griseoflavus Tu4000]
 gi|302476660|gb|EFL39753.1| N- superfamily bifunctional DNA primase/polymerase [Streptomyces
           griseoflavus Tu4000]
          Length = 296

 Score = 58.3 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/155 (11%), Positives = 33/155 (21%), Gaps = 16/155 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL--------DEQVVDRFNNEFQSCCGKPI 53
           +            GI  G     +   D+D                              
Sbjct: 65  IRAAWAAGP-FNVGIATGPA--GLLVIDLDKPKSSADTPCGVTTFTALCERTGQPVPTTR 121

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIA 113
           +    +    + F           +   +   ++  A+G   VA                
Sbjct: 122 TVRTASGGRHLYFTAPAGIRLGN-TAGALAPLVDTRAHGGYVVAPGSTTPAGTY----EV 176

Query: 114 PHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEK 148
            H   V  LP      V        +++TPR   +
Sbjct: 177 IHDDPVLPLPAWLLKAVAPAPAQPVSLSTPRCGNR 211


>gi|29830757|ref|NP_825391.1| hypothetical protein SAV_4214 [Streptomyces avermitilis MA-4680]
 gi|29607870|dbj|BAC71926.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 305

 Score = 58.3 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 16/165 (9%), Positives = 33/165 (20%), Gaps = 6/165 (3%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRV---GQAPKTLMLF 66
             G+GI CG+  H +   D+D                         V     +    +  
Sbjct: 98  ATGYGIACGLHPHFLIGIDLDTKSGTDSSAALRELALRHLFTIPDTVVVLTPSGGRHVWL 157

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
                ++    S  ++   ++    G   V           Y+ +     L     P   
Sbjct: 158 SGP-PDVVVPNSAGRLAPGIDIRGAGGYLVGPGS-RTRHGVYSTAPGTARLAPAPCPTAL 215

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
              +               +         +      R        
Sbjct: 216 LRLLTPPPRTHHPTPPATGEHGQGLVQFVLAAHEGQRNTRLFWAA 260


>gi|53721419|ref|YP_110404.1| hypothetical protein BPSS0382 [Burkholderia pseudomallei K96243]
 gi|52211833|emb|CAH37832.1| hypothetical protein BPSS0382 [Burkholderia pseudomallei K96243]
          Length = 955

 Score = 57.9 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 22/73 (30%), Gaps = 6/73 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            N            L     +      D W    MA+  E     EG  +  EW +  + 
Sbjct: 2   SNAPMSEFERASVALGYVPAD----DRDTWRQAGMALKAEF--GEEGFTLWNEWSQGAQN 55

Query: 220 YDEKSFNAKWDSF 232
           Y+ +     W SF
Sbjct: 56  YNVRDARDVWKSF 68


>gi|326446239|ref|ZP_08220973.1| hypothetical protein SclaA2_34472 [Streptomyces clavuligerus ATCC
           27064]
          Length = 333

 Score = 57.9 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/212 (11%), Positives = 47/212 (22%), Gaps = 44/212 (20%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDV-----------------------LDEQV 37
           ++          G G+ CG     +   DVD                           + 
Sbjct: 49  LITAWWTRQPRFGVGVACGPA--GLVVIDVDAHPAPLPTPDRLLPGIHIPESVCLDGLRH 106

Query: 38  VDRFNNEFQSCCGKP--------ISRVGQAPKTLMLF-RMQETNLKKQKSEE---KIQGH 85
                    +  G+P        +     +    + +        +          +   
Sbjct: 107 GFHSLAVLAALRGRPDPSQDESTLRVRTPSGGLHLWYTARPGQEWRCSTGSGVNRALAWQ 166

Query: 86  LEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           ++  A+G   +A      + R         A      P   PD +    E       P  
Sbjct: 167 VDVRAHGGYIIAPGTRTASGRY-------TACGPVRRPAPLPDWLAAELERTGHRPVPPH 219

Query: 146 KEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
              +    S+ W + N  R         L+  
Sbjct: 220 PRTATPVPSRAWAAVNAARGGRDSAARVLATV 251


>gi|297200823|ref|ZP_06918220.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces
           sviceus ATCC 29083]
 gi|297147743|gb|EFH28715.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces
           sviceus ATCC 29083]
          Length = 264

 Score = 57.9 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/101 (11%), Positives = 23/101 (22%), Gaps = 5/101 (4%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRV---GQAPKTLMLF 66
             G+GI CG+  H +   D+D                         V     +    +  
Sbjct: 82  ATGYGIACGLPPHHLIGVDLDTKSGTDSSAALRELALRHLFTIPDTVVVLTPSGGRHLWL 141

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
                +     S  ++   ++    G   V           
Sbjct: 142 TGP-PDAAVPNSAGRLAPGIDIRGAGGYLVGPGSRTDHGTY 181


>gi|326330159|ref|ZP_08196470.1| putative prophage Lp4 protein 7, DNA replication [Nocardioidaceae
           bacterium Broad-1]
 gi|325951972|gb|EGD44001.1| putative prophage Lp4 protein 7, DNA replication [Nocardioidaceae
           bacterium Broad-1]
          Length = 302

 Score = 57.9 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 41/159 (25%), Gaps = 14/159 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS--CCGKP-ISRVGQ 58
           V            GI  G  +  +   DVDV          N            +     
Sbjct: 64  VNDWWSKSPTANIGIPTGAVS-GIAVVDVDVHGADSGFTAFNRAHRAGLVDAWELLVRTP 122

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIH---PKTQRAYTWSIAPH 115
           +      F   +  ++          HL+F   G   VA       P  +R+Y       
Sbjct: 123 SGGLHAYFSPAKAEMRSWSLP---AQHLDFRGDGGYIVAPPSRITTPDGERSY----GLI 175

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLS 154
           A+   E   L  D +  F E    +  P    +   +  
Sbjct: 176 AVAQHESRPLDADRLRTFLEPVRIVQPPASLTRDGVRPD 214


>gi|312868644|ref|ZP_07728838.1| primase C-terminal domain protein [Lactobacillus oris PB013-T2-3]
 gi|311095853|gb|EFQ54103.1| primase C-terminal domain protein [Lactobacillus oris PB013-T2-3]
          Length = 750

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 25/69 (36%), Gaps = 7/69 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEK 223
               ++R  L          S+ EW  V MA+ +E    ++      +W +  G  Y   
Sbjct: 2   DEQFDLRPLLDYIDPASC--SYAEWAQVGMALKHEGYSVSD----WDQWSQRDGDRYHAG 55

Query: 224 SFNAKWDSF 232
               KW +F
Sbjct: 56  ECERKWRTF 64


>gi|46198964|ref|YP_004631.1| hypothetical protein TTC0656 [Thermus thermophilus HB27]
 gi|46196588|gb|AAS81004.1| hypothetical conserved protein [Thermus thermophilus HB27]
          Length = 293

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 47/218 (21%), Gaps = 18/218 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
                    G GIL G     V   D D  +     R  +           +        
Sbjct: 48  AWWRSCPRCGVGILPGP---EVLVLDFDDPEAWEGLRQEHPALE---AAPRQRTPKGGRH 101

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWS-IAPHALKVEE 121
           +  R+ E    +  +  +    ++    G+   VA     K  R YTW        ++  
Sbjct: 102 VFLRLPEG--VRLSASVRAIPGVDLRGMGRAYVVAAPTRLKDGRTYTWEAPLTPPEELPP 159

Query: 122 LPLLTPDEVEY--------FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
           +P     ++          +                             R  T I     
Sbjct: 160 VPQALLLKLLPPPPPPRPSWGAVGTASPKRLQALLQAYAAQVARTPEGQRHLTLIRYAVA 219

Query: 174 LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVR 211
                    +    E + V  A+            +  
Sbjct: 220 AGGLIPHGLDPREAEEVLVAAAMSAGLPEWEARDAVRW 257


>gi|239930266|ref|ZP_04687219.1| hypothetical protein SghaA1_18699 [Streptomyces ghanaensis ATCC
           14672]
 gi|291438614|ref|ZP_06578004.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291341509|gb|EFE68465.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 288

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 32/115 (27%), Gaps = 6/115 (5%)

Query: 10  VYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQS-CCGKPISRVGQAPKTLML 65
              G+GI CG+  H +   D+D     D     R      S      +  +  +    + 
Sbjct: 80  RATGYGIACGLPPHHLIGIDLDTKGGTDPSAALRELTLRHSFTIPATVVVLTPSGGRHLW 139

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
                 ++    S  ++   ++    G   V           YT +     L   
Sbjct: 140 LSGP-PDVVVPNSAGRLAPGIDVRGAGGYLVGPGSRTDHG-TYTTAPGTAHLPPA 192


>gi|291453089|ref|ZP_06592479.1| hypothetical protein SSHG_03382 [Streptomyces albus J1074]
 gi|291356038|gb|EFE82940.1| hypothetical protein SSHG_03382 [Streptomyces albus J1074]
          Length = 288

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/132 (9%), Positives = 30/132 (22%), Gaps = 18/132 (13%)

Query: 13  GFGILCGIGTHPVYAFDVD-----VLDEQVVDRFNNEFQSC---CGKPISRVGQAPKTLM 64
             G+  G     +   D+D                   +          +    +  T +
Sbjct: 62  NIGLATGPAR--LVVIDLDKPKDGTDAPDGAANLLALCEHAGQPVPTTRTVRTASGGTHL 119

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
            F   +    +  +   +   ++  A+G   +A         AY             +  
Sbjct: 120 YFSAPDGTRLRN-TAGALGPLIDTRAHGGYVLAPGSV-INGHAYR------VEGPALIRP 171

Query: 125 LTPDEVEYFFEF 136
           L    +E     
Sbjct: 172 LPGWLLERLAPP 183


>gi|160897071|ref|YP_001562653.1| primase 2 [Delftia acidovorans SPH-1]
 gi|160362655|gb|ABX34268.1| Primase 2 [Delftia acidovorans SPH-1]
          Length = 309

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 6/65 (9%)

Query: 168 IEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNA 227
             IR  L        +   + WI   MAI  E      G ++  EW +   +Y+ K+  A
Sbjct: 3   DRIRNALQYLN----HDDREVWIMAGMAIKAEI--GESGFDLWDEWSRRADSYNPKAARA 56

Query: 228 KWDSF 232
            W SF
Sbjct: 57  SWRSF 61


>gi|320450759|ref|YP_004202855.1| bifunctional DNA primase/polymerase, N- family [Thermus scotoductus
           SA-01]
 gi|320150928|gb|ADW22306.1| bifunctional DNA primase/polymerase, N- family [Thermus scotoductus
           SA-01]
          Length = 330

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 42/123 (34%), Gaps = 10/123 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
                    G G+L G     V   DVD       +R   E  +    P +R  +     
Sbjct: 54  AWWRACPECGVGLLPGP---EVLVLDVDAPGAW--ERLKEEHPALLEAPRARTPR-GGVH 107

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
           +  R+    + +  +  K    ++    G+   VA      T   Y W +A    + EEL
Sbjct: 108 VYLRLPPEAVGRLTATTKALPGVDLRGLGRSYLVAPPTTLPTGA-YAWEVALR--RPEEL 164

Query: 123 PLL 125
           PL+
Sbjct: 165 PLV 167


>gi|239981226|ref|ZP_04703750.1| hypothetical protein SalbJ_17449 [Streptomyces albus J1074]
          Length = 296

 Score = 57.5 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/132 (9%), Positives = 30/132 (22%), Gaps = 18/132 (13%)

Query: 13  GFGILCGIGTHPVYAFDVD-----VLDEQVVDRFNNEFQSC---CGKPISRVGQAPKTLM 64
             G+  G     +   D+D                   +          +    +  T +
Sbjct: 70  NIGLATGPAR--LVVIDLDKPKDGTDAPDGAANLLALCEHAGQPVPTTRTVRTASGGTHL 127

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
            F   +    +  +   +   ++  A+G   +A         AY             +  
Sbjct: 128 YFSAPDGTRLRN-TAGALGPLIDTRAHGGYVLAPGSV-INGHAYR------VEGPALIRP 179

Query: 125 LTPDEVEYFFEF 136
           L    +E     
Sbjct: 180 LPGWLLERLAPP 191


>gi|221195525|ref|ZP_03568580.1| RecA-family ATPase [Atopobium rimae ATCC 49626]
 gi|221184712|gb|EEE17104.1| RecA-family ATPase [Atopobium rimae ATCC 49626]
          Length = 727

 Score = 57.5 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 24/71 (33%), Gaps = 7/71 (9%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYD 221
            +  + ++   L          S+ EW+   MA+H       +      EW +     Y 
Sbjct: 1   MKEQHRDLLDALDAIDPAGL--SYQEWVDCGMALHESGFTWQD----WDEWSRQDSARYH 54

Query: 222 EKSFNAKWDSF 232
           E     KW SF
Sbjct: 55  EGECERKWKSF 65


>gi|9634995|ref|NP_056711.1| gp271 [Streptococcus phage Sfi11]
 gi|7523555|gb|AAF63058.1|AF158600_12 gp271 [Streptococcus phage Sfi11]
 gi|7523585|gb|AAF63087.1|AF158601_15 gp271 [Streptococcus phage SFi18]
          Length = 271

 Score = 57.5 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/141 (7%), Positives = 32/141 (22%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N          +  +  +
Sbjct: 42  IRRVWRDNPDANIALRT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPPTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|307293588|ref|ZP_07573432.1| Bifunctional DNA primase/polymerase [Sphingobium chlorophenolicum
           L-1]
 gi|306879739|gb|EFN10956.1| Bifunctional DNA primase/polymerase [Sphingobium chlorophenolicum
           L-1]
          Length = 574

 Score = 57.5 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 58/219 (26%), Gaps = 27/219 (12%)

Query: 4   TDVDHYVYN--GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
            +V  ++       +   +    + A DVD  + +   R      +   K      +   
Sbjct: 53  KEVKRWLKTDDQINLAGALKDTGICAVDVDGPEGEKALRRI----TKVSKTRKTKTR-NG 107

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           +   +R             K+   L+F+  G   +           Y          +  
Sbjct: 108 SHRFYRYDGNLGGSV---IKLASDLDFIMSG-YVMLPGSRHPDGGLYK----SDDFSLP- 158

Query: 122 LPLLTPDEVEYFFEF-FDTITTPRDKEKSYR--------KLSKIWKSHNNRRYTNIEIRA 172
           +  ++P+ V+           +P   +   R         L+ I  S   + Y    I  
Sbjct: 159 IADMSPELVKAIRNHRRPRKKSPEPSKTEARIVKGKRNDSLASIAGSLRRQGYEEEVILT 218

Query: 173 FLSCFGEEFYNGS--HDEWIPVVMAIHYETRGSAEGKEI 209
            L  F + +        E   +  +I        E   +
Sbjct: 219 MLDAFNQHYCRPPLRSQEVERIAHSISRYAPEHEELFGL 257


>gi|261363790|ref|ZP_05976673.1| inner membrane protein [Neisseria mucosa ATCC 25996]
 gi|288568370|gb|EFC89930.1| inner membrane protein [Neisseria mucosa ATCC 25996]
          Length = 805

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 22/64 (34%), Gaps = 6/64 (9%)

Query: 168 IEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNA 227
            EI   LS           D W+    ++ +E     E  ++   W +   +Y  +   +
Sbjct: 5   DEIEKALSYIEPH----DRDVWVNTAYSLKHEL--GEEAFDMWDRWSQQSDSYRSRDARS 58

Query: 228 KWDS 231
            W S
Sbjct: 59  VWKS 62


>gi|9632925|ref|NP_049954.1| putative replication protein [Streptococcus phage Sfi19]
 gi|5524020|gb|AAD44073.1|AF115102_32 orf271 gp [Streptococcus phage Sfi19]
 gi|455527|emb|CAA54617.1| unnamed protein product [Streptococcus phage SFi18]
 gi|4049996|gb|AAC97923.1| gp271 [Streptococcus phage Sfi19]
          Length = 271

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/141 (7%), Positives = 33/141 (23%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N        + +  +  +
Sbjct: 42  IRRVWRDNPDANIALRT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPQTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|331090165|ref|ZP_08339053.1| hypothetical protein HMPREF1025_02636 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330402111|gb|EGG81683.1| hypothetical protein HMPREF1025_02636 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 668

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 20/48 (41%), Gaps = 4/48 (8%)

Query: 185 SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           S  +WI V MA+  E         I  +W +  + Y       KW+SF
Sbjct: 18  SRADWIAVGMALKEEGYPC----SIWDDWSRNDKRYHPGECERKWNSF 61


>gi|288904658|ref|YP_003429879.1| hypothetical protein GALLO_0442 [Streptococcus gallolyticus UCN34]
 gi|288731383|emb|CBI12934.1| hypothetical protein, phage associated [Streptococcus gallolyticus
           UCN34]
          Length = 757

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 10/71 (14%), Positives = 23/71 (32%), Gaps = 6/71 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
               + ++   L           +  W  + MA+ +E   + +       W +    Y +
Sbjct: 1   MAERDFDLLPLLDYINP--AMVDYSTWCQIGMALKHEGYTAMD----WDNWSQADTRYKK 54

Query: 223 KSFNAKWDSFD 233
                KW +F+
Sbjct: 55  GECFKKWTTFN 65


>gi|194466777|ref|ZP_03072764.1| Bifunctional DNA primase/polymerase [Lactobacillus reuteri 100-23]
 gi|194453813|gb|EDX42710.1| Bifunctional DNA primase/polymerase [Lactobacillus reuteri 100-23]
          Length = 263

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/160 (9%), Positives = 36/160 (22%), Gaps = 18/160 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFN---NEFQSCCGKPISRVGQ 58
           + T    + Y    +         +  D+D      +D F            + +++  +
Sbjct: 41  IKTVWKKHPYAQIALRT----DKFFVVDIDRHHADNIDGFESIKQLPAEYFPETLTQTTK 96

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHAL 117
                + +  +     +       Q  ++  A+     V           Y W       
Sbjct: 97  HGGRQLFYLKRPDM--RVNQLIGYQPGIDIKAHQNNYVVVAPS-----EGYQWLNK---N 146

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
            +   P      +          T      K   + S   
Sbjct: 147 PIVTAPKSLVVNINQMRASNRRNTPNDFVIKPRERNSTTD 186


>gi|66391796|ref|YP_238520.1| replication protein [Streptococcus phage 2972]
 gi|56718453|gb|AAW27959.1| replication protein [Streptococcus phage 2972]
          Length = 271

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/141 (7%), Positives = 32/141 (22%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N          +  +  +
Sbjct: 42  IRRVWRDNPDANIALRT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPPTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDKVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|294630239|ref|ZP_06708799.1| bifunctional DNA primase/polymerase [Streptomyces sp. e14]
 gi|292833572|gb|EFF91921.1| bifunctional DNA primase/polymerase [Streptomyces sp. e14]
          Length = 291

 Score = 57.1 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/127 (10%), Positives = 32/127 (25%), Gaps = 9/127 (7%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC----GKPISRV 56
           V           G+GI CG+  + +   D+D                         +  +
Sbjct: 73  VRALFAAAPRATGYGIACGLPPYHLIGVDLDTKAGTDAVAALRGLARRHRFTVPATVVVL 132

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
             +    +        +    S  ++   ++    G   V      +      +++ P  
Sbjct: 133 TPSGGRHLWLSGPAD-VVVPNSASRLAPGIDIRGAGGYLVGPGSRTERG---VYAVTPGT 188

Query: 117 LKVEELP 123
             +   P
Sbjct: 189 AHLPPAP 195


>gi|294817427|ref|ZP_06776069.1| Bifunctional DNA primase/polymerase [Streptomyces clavuligerus ATCC
           27064]
 gi|294322242|gb|EFG04377.1| Bifunctional DNA primase/polymerase [Streptomyces clavuligerus ATCC
           27064]
          Length = 374

 Score = 56.7 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/212 (11%), Positives = 47/212 (22%), Gaps = 44/212 (20%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDV-----------------------LDEQV 37
           ++          G G+ CG     +   DVD                           + 
Sbjct: 90  LITAWWTRQPRFGVGVACGPA--GLVVIDVDAHPAPLPTPDRLLPGIHIPESVCLDGLRH 147

Query: 38  VDRFNNEFQSCCGKP--------ISRVGQAPKTLMLF-RMQETNLKKQKSEEKIQ---GH 85
                    +  G+P        +     +    + +        +        +     
Sbjct: 148 GFHSLAVLAALRGRPDPSQDESTLRVRTPSGGLHLWYTARPGQEWRCSTGSGVNRALAWQ 207

Query: 86  LEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           ++  A+G   +A      + R         A      P   PD +    E       P  
Sbjct: 208 VDVRAHGGYIIAPGTRTASGRY-------TACGPVRRPAPLPDWLAAELERTGHRPVPPH 260

Query: 146 KEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
              +    S+ W + N  R         L+  
Sbjct: 261 PRTATPVPSRAWAAVNAARGGRDSAARVLATV 292


>gi|282848866|ref|ZP_06258256.1| primase C-terminal domain protein [Veillonella parvula ATCC 17745]
 gi|282581371|gb|EFB86764.1| primase C-terminal domain protein [Veillonella parvula ATCC 17745]
          Length = 693

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 7/69 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEK 223
            + I++R  L          S++EW+ V +A+H E         I  EW    G  + E 
Sbjct: 2   ESKIDLRELLEYIDPAQC--SYEEWLNVGLALHQEGYP----MFIWEEWSADDGERFHEG 55

Query: 224 SFNAKWDSF 232
              AKW+SF
Sbjct: 56  ECAAKWESF 64


>gi|320450734|ref|YP_004202830.1| bifunctional DNA primase/polymerase, N- family [Thermus scotoductus
           SA-01]
 gi|320150903|gb|ADW22281.1| bifunctional DNA primase/polymerase, N- family [Thermus scotoductus
           SA-01]
          Length = 300

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 36/125 (28%), Gaps = 11/125 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
                    G GIL       V   DVD  +     R +            +        
Sbjct: 56  AWWRSCPEAGVGIL---APEGVLVLDVDQGEAWEALRRDFPALE---AAPRQKTPKGGVH 109

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
           +  R+ E    K  +  +    ++    G+   VA     K  R Y W +    ++ E L
Sbjct: 110 LFLRLPEG--VKLSASVRAIPGVDLRGMGRAYVVAAPTRLKDGRTYAWEVPL--VRPEAL 165

Query: 123 PLLTP 127
           P +  
Sbjct: 166 PPVPD 170


>gi|225734507|gb|ACO25275.1| D5 family NTPase [Epizootic haematopoietic necrosis virus]
          Length = 973

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 26/85 (30%), Gaps = 5/85 (5%)

Query: 152 KLSKIWKSHNNRRYTNIEIRAF-----LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           KL    +          E         L+             W+ V   +  +T GSAEG
Sbjct: 281 KLDVARQRKPAWNTDATEAHRLKRVTELTVMLTADLADDRQTWLNVGFCLWQQTSGSAEG 340

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDS 231
            ++   + K     DE      W++
Sbjct: 341 YKVWLSFSKKSDKCDEDECWTIWNN 365


>gi|149012725|ref|ZP_01833701.1| phage protein [Streptococcus pneumoniae SP19-BS75]
 gi|147763325|gb|EDK70263.1| phage protein [Streptococcus pneumoniae SP19-BS75]
          Length = 270

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 44/149 (29%), Gaps = 19/149 (12%)

Query: 1   MVATDVDH----YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPI 53
           M A++++     Y      +         +  D+D   ++       +++          
Sbjct: 35  MTASEIERFWDGYPNANIALRT----TNFFVIDIDKHGKENGFESLKKWEHLNLIEPTLQ 90

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWS 111
           ++     K L+ F+  +  + +     K    ++  A       VA +        Y W 
Sbjct: 91  AKTASGGKHLLYFKRDDEPITQM---IKFLPGVDIKAHENNYIIVAPSA--TENGQYEWD 145

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTI 140
           +   A     +   + D +    + +   
Sbjct: 146 LEKSAEGGTIVTP-SRDLIRAIKKQYGKT 173


>gi|326778021|ref|ZP_08237286.1| Bifunctional DNA primase/polymerase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326658354|gb|EGE43200.1| Bifunctional DNA primase/polymerase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 327

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/148 (8%), Positives = 27/148 (18%), Gaps = 28/148 (18%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQV-------------------VDRFNNEF 45
            +D Y    F I  G     +   D+D                                 
Sbjct: 81  WIDRYPDLNFAISTGPA--GLVIVDLDTNKNGAPIPDKYANIHGVTDGYDVWALALERYG 138

Query: 46  QSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
                  +          +   +    +   KSE      ++  +     +      K  
Sbjct: 139 ARHPTDTMQVSTPNGGLHIWHSLP-PGVVVNKSEGAFGWLVDIRSTNSYIIGPTSVTKDG 197

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYF 133
                        V E  +     + + 
Sbjct: 198 EY------RRLGDVTEPTMAPDWLLHHL 219


>gi|145354015|ref|XP_001421292.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581529|gb|ABO99585.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 423

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 34/127 (26%), Gaps = 13/127 (10%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQV-VDRFNNEFQSCCGK--PISRVGQAPKTLMLF 66
               +G+L G   + V   D D    +   +          G         ++      F
Sbjct: 42  PGEMYGVLTG-RPNRVLVVDWDCYGGKCEFELTEEMLTRKVGGEGAYIVKTRSGGYHTYF 100

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
              E  +   K    I+G ++    G   V    H      Y          +  LP + 
Sbjct: 101 AWDEERVGDWKGTVGIEGFVDIRTTGNYVV--GAHAP---GYELLR----GDINNLPPMP 151

Query: 127 PDEVEYF 133
            D   +F
Sbjct: 152 NDLYSFF 158


>gi|322511112|gb|ADX06425.1| putative VV D5 family helicase [Organic Lake phycodnavirus 2]
          Length = 824

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 7/77 (9%)

Query: 161 NNRRYTNIEIRAFLSCFGEEFYNG-SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
           +       +   +     E +Y   S+++WI V MA+      S +      +      +
Sbjct: 234 SIEEEYIKDTHNYTMILDESYYGEGSYNKWIKVGMALKNT---SEKLFISWLKISSQSPS 290

Query: 220 YDEK---SFNAKWDSFD 233
           +D         KW+ FD
Sbjct: 291 FDWGNVSELFHKWNHFD 307


>gi|91217110|ref|ZP_01254072.1| hypothetical protein P700755_03918 [Psychroflexus torquis ATCC
           700755]
 gi|91184710|gb|EAS71091.1| hypothetical protein P700755_03918 [Psychroflexus torquis ATCC
           700755]
          Length = 424

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/189 (12%), Positives = 52/189 (27%), Gaps = 19/189 (10%)

Query: 5   DVDH--YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGK--PISRVGQAP 60
           D++   +  N  GI        +   D+D  ++    +      +       + + G   
Sbjct: 56  DLNRFNWP-NSVGIGTFTYWSDLVVIDIDGCNDINFLKQILRQLNLPSDYEWVVQSGSKN 114

Query: 61  KTLMLFRMQETN----------LKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
              + +   + +             +   E+    +EFL      V       +   Y++
Sbjct: 115 GFHIYYLGDQIDECGEDDVVSAFPPKSQFERYVDKIEFLWRTH-TVLPPSVHGSGNKYSF 173

Query: 111 SIAPHAL-KVEEL-PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI 168
                   K EE+      D ++ F +F +             K+S      N+      
Sbjct: 174 LNNEFPKNKPEEIDTETIYDFIDKFLDFNEIQVGTGYG-GVLNKISSKIDFVNDFSDDMD 232

Query: 169 EIRAFLSCF 177
             +  L   
Sbjct: 233 ITKHLLDDL 241


>gi|313668169|ref|YP_004048453.1| hypothetical protein NLA_8370 [Neisseria lactamica ST-640]
 gi|313005631|emb|CBN87071.1| hypothetical protein NLA_8370 [Neisseria lactamica 020-06]
          Length = 162

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 6/67 (8%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
              EIRA LS  G +      D WI +  A+  E     +G  +  EW + G +Y+ +  
Sbjct: 3   EYDEIRAALSHIGAD----DRDMWIRMGEAVKDEI--GEDGFHLWDEWSQTGGSYNARDA 56

Query: 226 NAKWDSF 232
            A W SF
Sbjct: 57  KAAWKSF 63


>gi|331694991|ref|YP_004331230.1| Bifunctional DNA primase/polymerase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326949680|gb|AEA23377.1| Bifunctional DNA primase/polymerase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 315

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 30/138 (21%), Gaps = 20/138 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL----------DEQVVDRFNNEFQSCCGK 51
           + T          G+  G     +   D D                     +      G 
Sbjct: 69  IHTAWAAGRAFNIGLATGPA--GLVVIDCDTDTDGAPRAQWAGAGGGLDVLHRLADQAGA 126

Query: 52  PISRVG---QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAY 108
             +       +  T   +R    +  +  +   +   ++  A+G   VA           
Sbjct: 127 LPATFTVATPSGGTHFYYRAPACDELRN-TAGLLGWKIDSRAHGGYVVAAGSTTPAGAY- 184

Query: 109 TWSIAPHALKVEELPLLT 126
                  A    ELP   
Sbjct: 185 ---TITDARDPVELPGWL 199


>gi|295396334|ref|ZP_06806501.1| N- superfamily bifunctional DNA primase/polymerase [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294970829|gb|EFG46737.1| N- superfamily bifunctional DNA primase/polymerase [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 208

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 27/102 (26%), Gaps = 6/102 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQ 58
           V     H      GI  G  +  + A DVD        +     +      G  +     
Sbjct: 61  VEMWWRHTPLASIGIPTGQPS-GMVAVDVDQHGRVDGYQAIRRARQAGLVAGWEMLVRTP 119

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
                  +        +Q+S +  +  ++F   G   +    
Sbjct: 120 TGGMHAYY--PAAPGLEQRSWQAARAGVDFRGDGGYVIVPPS 159


>gi|254196284|ref|ZP_04902708.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653027|gb|EDS85720.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 950

 Score = 56.0 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 18/50 (36%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               + W    MA+  E     EG  +  EW    + Y+ +     W SF
Sbjct: 16  ADDRNTWRQAGMALKAEF--GEEGFTLWNEWSLGAQNYNARDARDVWKSF 63


>gi|220926441|ref|YP_002501743.1| bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
 gi|219951048|gb|ACL61440.1| Bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
          Length = 201

 Score = 56.0 bits (133), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 26/102 (25%), Gaps = 8/102 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV----LDEQVVDRFNNEFQSC--CGKPISR 55
           +      +     G+  G      +A D DV     D   +  +              + 
Sbjct: 69  IRRLWRRWPKAMIGLRMGHDA-GTFALDPDVVKKPGDADGLAAWRQLAAEHGDVPATHTH 127

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVA 97
           V  +    +LFR  E        E  +   +     G    A
Sbjct: 128 VTPSGGRHLLFRYPEDRSITNA-EGDLPKGINVRGEGGYVAA 168


>gi|254555204|ref|YP_003061621.1| prophage Lp3 protein 7 [Lactobacillus plantarum JDM1]
 gi|254044131|gb|ACT60924.1| prophage Lp3 protein 7 [Lactobacillus plantarum JDM1]
          Length = 266

 Score = 55.6 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 43/181 (23%), Gaps = 17/181 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE-----QVVDRFNNEFQSCCGKPISRV 56
           +      +     G+        +   D+D+ D        + +   + Q+         
Sbjct: 47  IFAWFKKHPAYNLGLRL--DLSDLLVVDIDMHDPTKNGRASLAQLFKQGQTLPNDTYIER 104

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                     +      +K      +   ++ L+     +A +      + Y        
Sbjct: 105 TANGGVHYFLKYAGAKARKI----DVWPGIDLLSDFT-VIAPSEI--NGKPYQAIDGRTL 157

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
             ++  P      V+         T+        +K +           T     A+L+ 
Sbjct: 158 ADIKPAP---QWLVDKLAGQKVNWTSEHACNTRQKKYTGRLLDEMVTGTTQGNRNAWLTK 214

Query: 177 F 177
            
Sbjct: 215 I 215


>gi|301299425|ref|ZP_07205704.1| primase C-terminal domain protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852961|gb|EFK80566.1| primase C-terminal domain protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 752

 Score = 55.6 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 26/72 (36%), Gaps = 7/72 (9%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYD 221
                + +   L          ++ EW+ V MA+ YE    ++       W +     Y 
Sbjct: 1   MEEHKLNLLELLDYIDPS--MLNYQEWVNVGMALKYEGYSVSD----WDNWSQRDSTRYH 54

Query: 222 EKSFNAKWDSFD 233
           +     KW++FD
Sbjct: 55  DGETERKWNTFD 66


>gi|9632451|ref|NP_049423.1| hypothetical protein DT1p34 [Streptococcus phage DT1]
 gi|4530171|gb|AAD21911.1| unknown [Streptococcus phage DT1]
          Length = 271

 Score = 55.6 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 12/141 (8%), Positives = 33/141 (23%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N        K +  +  +
Sbjct: 42  IRRVWRDNPDANIALKT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPKTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|9632973|ref|NP_050001.1| putative replication protein [Streptococcus phage Sfi21]
 gi|5524054|gb|AAD44106.1|AF115103_36 orf271 gp [Streptococcus phage Sfi21]
 gi|2352439|gb|AAC72437.1| orf271 [Streptococcus phage Sfi21]
          Length = 271

 Score = 55.6 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 11/141 (7%), Positives = 32/141 (22%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N          +  +  +
Sbjct: 42  IRRVWRDNPDANIALKT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPPTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|323139963|ref|ZP_08074982.1| hypothetical protein Met49242DRAFT_4370 [Methylocystis sp. ATCC
           49242]
 gi|322394781|gb|EFX97363.1| hypothetical protein Met49242DRAFT_4370 [Methylocystis sp. ATCC
           49242]
          Length = 176

 Score = 55.6 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 46/132 (34%), Gaps = 18/132 (13%)

Query: 5   DVDHYVYNGFGILCG---IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS-RVGQAP 60
            +  + Y G G+L G        + A D+D       D +     +  G P   R G+  
Sbjct: 50  WLKSHCYLGIGLLMGSPFPDGTTLGALDID------HDAYTRVGHALLGDPPCCRFGRKG 103

Query: 61  KTLMLFRMQETNLK---KQKSEEKIQGH--LEFLAYGQQFVAYN-IHPKTQRAYTWSIAP 114
             + + R++        + K +   +     E L   +  V    IH +T R Y W    
Sbjct: 104 MVVFV-RVRGEPRNLEFRVKGDVGKRFGKVAECLFSKKLCVVPPTIHRETGRPYRWVGQS 162

Query: 115 -HALKVEELPLL 125
              +    LPL+
Sbjct: 163 LLDVDFNSLPLV 174


>gi|28379033|ref|NP_785925.1| prophage Lp3 protein 7 [Lactobacillus plantarum WCFS1]
 gi|28271871|emb|CAD64776.1| prophage Lp3 protein 7 [Lactobacillus plantarum WCFS1]
          Length = 266

 Score = 55.6 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 46/181 (25%), Gaps = 17/181 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLD-----EQVVDRFNNEFQSCCGKPISRV 56
           +    +++     G+        +   DVD+ D        + +   + Q+         
Sbjct: 47  IFAWFENHPNYNLGLRL--DLSDLLVVDVDMHDQTKNGRNSLAQLFKQGQTLPNDTYIER 104

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA 116
                     +     ++K      +   ++ L+     +A +      + Y        
Sbjct: 105 TANGGVHYFLKYAGAKVRKV----DVWPGIDLLSDFT-VIAPSEI--NGKPYEPLDDRTL 157

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
             ++  P      V+         T+        +K +           T     A+L+ 
Sbjct: 158 TDIKPAP---QWLVDKLAGQKVNWTSEHAYTTRQKKYTGRLLDEMVTGTTQGNRNAWLTK 214

Query: 177 F 177
            
Sbjct: 215 I 215


>gi|227544976|ref|ZP_03975025.1| Bifunctional DNA primase/polymerase [Lactobacillus reuteri CF48-3A]
 gi|300909991|ref|ZP_07127451.1| phage protein [Lactobacillus reuteri SD2112]
 gi|227185037|gb|EEI65108.1| Bifunctional DNA primase/polymerase [Lactobacillus reuteri CF48-3A]
 gi|300892639|gb|EFK85999.1| phage protein [Lactobacillus reuteri SD2112]
          Length = 259

 Score = 55.6 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 8/124 (6%), Positives = 34/124 (27%), Gaps = 12/124 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNN----EFQSCCGKPISRVG 57
           V      Y      +         +  D+D  +    D   +    +        ++++ 
Sbjct: 41  VKYYWSKYPDANIALRT----VDFFVLDIDTKEAHGKDGMKSYQTLKNTGLIAPTLAQLT 96

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHA 116
            +    + ++  +           ++  ++  A+     +       ++ +Y W      
Sbjct: 97  ASGGNQLFYKKPKN--IPVNQVIGLKQGIDIKAHINNYVIVPPS-TTSKGSYQWLNKLPM 153

Query: 117 LKVE 120
            + +
Sbjct: 154 REPK 157


>gi|220921973|ref|YP_002497274.1| bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
 gi|219946579|gb|ACL56971.1| Bifunctional DNA primase/polymerase [Methylobacterium nodulans ORS
           2060]
          Length = 201

 Score = 55.6 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 26/102 (25%), Gaps = 8/102 (7%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV----LDEQVVDRFNNEFQSC--CGKPISR 55
           +      +     G+  G      +A D DV     D   +  +              + 
Sbjct: 69  IRRLWRRWPKAMIGLRMGHDA-GTFALDPDVVKKPGDADGLAVWRRLAAEHGDVPATHTH 127

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVA 97
           V  +    +LFR  E        E  +   +     G    A
Sbjct: 128 VTPSGGRHLLFRYPEDRSITNA-EGDLPKGINVRGEGGYVAA 168


>gi|134103453|ref|YP_001109114.1| hypothetical protein SACE_7028 [Saccharopolyspora erythraea
           prophage pSE211]
 gi|291006005|ref|ZP_06563978.1| hypothetical protein SeryN2_15905 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133916076|emb|CAM06189.1| hypothetical protein SACE_7028 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 337

 Score = 55.6 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 17/189 (8%), Positives = 38/189 (20%), Gaps = 22/189 (11%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVD----------------VLDEQVVDRFNNEFQSC 48
                     GI            D+D                V D           +  
Sbjct: 69  WFTRMPAANVGIST--DLSDTVVLDLDRKPKAPAAAAHDVPILVADGLGALDAITTHEGA 126

Query: 49  -CGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYN---IHPKT 104
                ++    +    + FR          +  ++   ++  A G   VA       P  
Sbjct: 127 DWPDTLTIATPSEGRHLYFRRPAGLEVASDANGRVGHQIDIRAQGGYVVAPGCQITAPPE 186

Query: 105 QRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRR 164
               T++     + +  LP      V              +  +                
Sbjct: 187 DVFGTYTRVSTTVDIAPLPDWLRPRVTPPPATPTGPGKAPNLGRIRHGDGHEPGYWKTVW 246

Query: 165 YTNIEIRAF 173
            + ++   +
Sbjct: 247 KSVLDKVEY 255


>gi|23455860|ref|NP_695090.1| hypothetical protein O1205p12 [Streptococcus phage O1205]
 gi|2444092|gb|AAC79528.1| ORF12 [Streptococcus phage O1205]
          Length = 269

 Score = 55.2 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 11/141 (7%), Positives = 32/141 (22%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N          +  +  +
Sbjct: 40  IRRVWRDNPDANIALKT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPPTLQAITPS 95

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 96  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 152

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 153 GSITEAPLALIKVLQKMKPEP 173


>gi|329936166|ref|ZP_08285959.1| hypothetical protein SGM_1451 [Streptomyces griseoaurantiacus M045]
 gi|329304276|gb|EGG48156.1| hypothetical protein SGM_1451 [Streptomyces griseoaurantiacus M045]
          Length = 300

 Score = 55.2 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/184 (8%), Positives = 33/184 (17%), Gaps = 26/184 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL--------------DEQVVDRFNNEFQS 47
           +            GI  G     +   D+D+                             
Sbjct: 60  IRATWSRAP-YNVGIATGP--SGLVVVDLDLPKNDDKGKGSSDAPCGAASFGALCERAGH 116

Query: 48  CCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
                      +  T + F      ++   S   +   ++  A+G   VA          
Sbjct: 117 AVPDTYRTRTASGGTHLYFTAP-PGIRLGNSAGTVAPLVDTRAWGGYVVAAGS------- 168

Query: 108 YTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTN 167
            T     +      +    P  +                    +  S    +  N     
Sbjct: 169 -TTPAGAYEALCGSVAAPLPGWLLSILTPAQRPAERASVAVLVQSRSYADTALANESRNV 227

Query: 168 IEIR 171
               
Sbjct: 228 ASAV 231


>gi|228861234|ref|YP_002854256.1| putative D5 family NTPase/ATPase [Soft-shelled turtle iridovirus]
 gi|194307514|gb|ACF42244.1| putative D5 family NTPase/ATPase [Soft-shelled turtle iridovirus]
          Length = 975

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 26/85 (30%), Gaps = 5/85 (5%)

Query: 152 KLSKIWKSHNNRRYTNIEIRAF-----LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           KL    +          +         L+             W+ V   +  +T GSAEG
Sbjct: 281 KLDVARQRKPAWNTDATKAHRLKRVTDLTAMLTADLADDRQTWLNVGFCLWQQTSGSAEG 340

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDS 231
            ++   + K     DE      W++
Sbjct: 341 YKVWLSFSKKSDKCDEDECWTIWNN 365


>gi|273809763|ref|YP_003344883.1| hypothetical protein [Streptococcus phage ALQ13.2]
 gi|224812515|gb|ACN64908.1| unknown [Streptococcus phage ALQ13.2]
          Length = 271

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 12/141 (8%), Positives = 33/141 (23%), Gaps = 12/141 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQA 59
           +             +         +  DVD   D   +    N        K +  +  +
Sbjct: 42  IRRVWRDNPDANIALKT----DTFFVIDVDMHGDVDGLTNLRNWEHARLIPKTLQAITPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +           +   ++  A+     +    +  ++  Y W        
Sbjct: 98  GGRHIYLK--KDPNHPISQNIGMIEGVDIKAHVNNYILVPPSN-NSKGYYEWDTVHSPKD 154

Query: 119 --VEELPLLTPDEVEYFFEFF 137
             + E PL     ++      
Sbjct: 155 GSITEAPLALIKVLQKMKPEP 175


>gi|49237319|ref|YP_031600.1| putative D5 family NTPase/ATPase [Frog virus 3]
 gi|47060137|gb|AAT09681.1| putative D5 family NTPase/ATPase [Frog virus 3]
          Length = 973

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 26/85 (30%), Gaps = 5/85 (5%)

Query: 152 KLSKIWKSHNNRRYTNIEIRAF-----LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           KL    +          +         L+             W+ V   +  +T GSAEG
Sbjct: 281 KLDVARQRKPAWNTDATKAHRLKRVTDLTAMLTADLADDRQTWLNVGFCLWQQTSGSAEG 340

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDS 231
            ++   + K     DE      W++
Sbjct: 341 YKVWLSFSKKSDKCDEDECWTIWNN 365


>gi|292659055|gb|ADE34443.1| D5 family NTPase [Turbot reddish body iridovirus]
          Length = 920

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 8/77 (10%), Positives = 24/77 (31%), Gaps = 2/77 (2%)

Query: 155 KIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWC 214
            +  S      T  ++RA +            + W+ V   ++     + +G  +   + 
Sbjct: 278 PMDVSTAASTTTPADVRALVDML-PASAAADRNTWLKVGFCLYQVMDAAEDGLRLWISFS 336

Query: 215 KLGR-TYDEKSFNAKWD 230
                 ++    +  W+
Sbjct: 337 AKCPEKFNATVCHDMWE 353


>gi|289643690|ref|ZP_06475802.1| hypothetical protein FsymDgDRAFT_3060 [Frankia symbiont of Datisca
           glomerata]
 gi|289506523|gb|EFD27510.1| hypothetical protein FsymDgDRAFT_3060 [Frankia symbiont of Datisca
           glomerata]
          Length = 140

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 24/78 (30%), Gaps = 7/78 (8%)

Query: 51  KPISRV-GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAY 108
            P + V        + ++   T +  +         ++  A G    A    HP T R Y
Sbjct: 2   TPTATVATGGGGWHLYYQHPGTPVLSRPLPGH--VGIDIKADGGYVTAPPSTHPTTGRPY 59

Query: 109 TWSIAPHALKVEELPLLT 126
            W        V E+P   
Sbjct: 60  QWV---GTRPVNEMPPAL 74


>gi|82800076|gb|ABB92287.1| putative D5 family NTPase/ATPase [Tiger frog virus]
          Length = 975

 Score = 55.2 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 26/85 (30%), Gaps = 5/85 (5%)

Query: 152 KLSKIWKSHNNRRYTNIEIRAF-----LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           KL    +          +         L+             W+ V   +  +T GSAEG
Sbjct: 281 KLDVARQRKPAWNTDTTKAHRLKRVTELTAMLTADLADDRQTWLNVGFCLWQQTSGSAEG 340

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDS 231
            ++   + K     DE      W++
Sbjct: 341 YKVWLSFSKKSDKCDEDECWTIWNN 365


>gi|327396932|dbj|BAK14298.1| phage-related protein [Red sea bream iridovirus]
          Length = 920

 Score = 55.2 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 9/77 (11%), Positives = 24/77 (31%), Gaps = 2/77 (2%)

Query: 155 KIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWC 214
            +  S      T  ++RA +            + W+ V   ++     S +G  +   + 
Sbjct: 278 PMDVSTAASTTTPADVRALVDML-PASVAADRNTWLKVGFCLYQVMDASEDGLRLWMSFS 336

Query: 215 KLGR-TYDEKSFNAKWD 230
                 ++    +  W+
Sbjct: 337 AKCPEKFNATVCHDMWE 353


>gi|268608984|ref|ZP_06142711.1| Primase 2 [Ruminococcus flavefaciens FD-1]
          Length = 743

 Score = 55.2 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 20/72 (27%), Gaps = 7/72 (9%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYD 221
             Y N  +   L           + +W  + MA+            +   W       Y 
Sbjct: 1   MNYKNDNLEELLEYIDPSEL--DYQQWCGIGMALKDSGYDG----SVWDTWSMRDAARYH 54

Query: 222 EKSFNAKWDSFD 233
           +     KW SF+
Sbjct: 55  QGECEKKWRSFN 66


>gi|62421295|gb|AAX82415.1| D5 family NTPase [Orange-spotted grouper iridovirus]
          Length = 920

 Score = 54.8 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 8/77 (10%), Positives = 24/77 (31%), Gaps = 2/77 (2%)

Query: 155 KIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWC 214
            +  S      T  ++RA +            + W+ V   ++     + +G  +   + 
Sbjct: 278 PMDVSTAASTTTPADVRALVDML-PASVAADRNTWLKVGFCLYQVMDAAEDGLRLWMSFS 336

Query: 215 KLGR-TYDEKSFNAKWD 230
                 ++    +  W+
Sbjct: 337 AKCPEKFNATVCHDMWE 353


>gi|45686089|ref|YP_003852.1| D5 family NTPase [Ambystoma tigrinum virus]
 gi|37722513|gb|AAP33258.1| D5 family NTPase [Ambystoma tigrinum stebbensi virus]
          Length = 975

 Score = 54.8 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 26/85 (30%), Gaps = 5/85 (5%)

Query: 152 KLSKIWKSHNNRRYTNIEIRAF-----LSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
           KL    +          +         L+             W+ V   +  +T GSAEG
Sbjct: 281 KLDVARQRKPAWNIDATKAHRLKRVTELTAMLTADLADDRQTWLNVGFCLWQQTSGSAEG 340

Query: 207 KEIVREWCKLGRTYDEKSFNAKWDS 231
            ++   + K     DE      W++
Sbjct: 341 YKVWLSFSKKSDKCDEDECWTIWNN 365


>gi|90962626|ref|YP_536542.1| hypothetical protein LSL_1657 [Lactobacillus phage Sal3]
 gi|90821820|gb|ABE00459.1| Hypothetical protein, phage associated [Lactobacillus phage Sal3]
          Length = 256

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/204 (10%), Positives = 54/204 (26%), Gaps = 27/204 (13%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFN---NEFQSCCGKPISRVG 57
           ++            G+        +   D+D  +  +        N   +     + R  
Sbjct: 42  LIKRWFMDEPNINIGLNLAK--SNLIIVDIDNHNNDLQAPLQSLSNLGYNLPSDYVER-T 98

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
           ++      +R  +     +K++      ++ L+    FV  +  P T   Y      +  
Sbjct: 99  KSGGLHFYYRCSDGIPATRKTK--FIDGVDLLSD---FVVTS--PSTN--YK---ILNGA 146

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            ++++P      ++            +D    YR             Y   EI   +   
Sbjct: 147 TLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYR--------RYYTGYLIDEIVNGVDAG 198

Query: 178 GEEFYNGS-HDEWIPVVMAIHYET 200
               +  S   + +    +     
Sbjct: 199 NRNNWIASIFGKLLRAGASPKNAY 222


>gi|145354403|ref|XP_001421475.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581712|gb|ABO99768.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 724

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 31/127 (24%), Gaps = 19/127 (14%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQV-VDRFNNEFQSCCGK--PISRVGQAPKTLMLF 66
               +G+L G   + V   D D    +   +          G         ++      F
Sbjct: 33  PGEMYGVLTG-RPNRVLVIDWDCYGGKCEFELTEEMLTRKVGGEGAYIVKTRSGGYHTYF 91

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFV---AYNIHPKTQRAYTWSIAPHALKVEELP 123
              E      K    I+G ++    G   V   A          Y          +  LP
Sbjct: 92  AWDEERFGDWKGTVGIEGFVDIRTTGNYVVGADAPG--------YELLR----GDINNLP 139

Query: 124 LLTPDEV 130
            +  D  
Sbjct: 140 PMPNDLY 146


>gi|281357235|ref|ZP_06243724.1| Bifunctional DNA primase/polymerase [Victivallis vadensis ATCC
           BAA-548]
 gi|281316266|gb|EFB00291.1| Bifunctional DNA primase/polymerase [Victivallis vadensis ATCC
           BAA-548]
          Length = 660

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/104 (12%), Positives = 30/104 (28%), Gaps = 8/104 (7%)

Query: 5   DVDHY---VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           ++  +    ++   ++CG  +  +   D D   E          Q    K +     +  
Sbjct: 45  EIRAWFANRHDAICLICGKISGNLEILDFDNHGELFPKWKELIPQELYEKLVIEQTPSGG 104

Query: 62  TLMLFRMQETNLKKQKSEEKIQGH-----LEFLAYGQQFVAYNI 100
               +R  +      K  +  +       +E    G  F+ Y  
Sbjct: 105 FHAAYRCSDEICGNLKLAQGERDGKLVTLIETRGNGGLFLCYPT 148


>gi|118445168|ref|YP_879280.1| primase [Clostridium novyi NT]
 gi|118135624|gb|ABK62668.1| putative primase [Clostridium novyi NT]
          Length = 724

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/190 (11%), Positives = 55/190 (28%), Gaps = 18/190 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQ----VVDRFNNEFQSCCGK------ 51
           +  +       G+ +LCG  ++ +   D+DV         +  F    +    +      
Sbjct: 52  INGETKGGQLTGYSLLCGKTSN-IIVIDIDVNHGDSSIDGIQNFKEFIKEFSNEDKKRIL 110

Query: 52  -PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
                +       + F+ +E      K++      ++    G   V      K       
Sbjct: 111 NTFVVITPRGGMHLYFKYKEG----LKNKANYIPGVDVRTDGGLIVLPGSQVKVDGE-IL 165

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
               +   ++ +P +  D++    +      T +  +K ++               N  I
Sbjct: 166 EYKANGKDIQYMPQVLFDKLLKLDKPSQKKETSKKIQKDFKADKYYKPVKEGEGRDNTLI 225

Query: 171 RAFLSCFGEE 180
            ++L    + 
Sbjct: 226 -SWLGYMIKN 234


>gi|293402156|ref|ZP_06646294.1| RecA-family ATPase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304263|gb|EFE45514.1| RecA-family ATPase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 735

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 25/69 (36%), Gaps = 7/69 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG-RTYDEK 223
             + ++   L        +  +  W+ V MA+ +E   +A+       W       Y + 
Sbjct: 2   QHDTDLIELLKYIDPS--SLDYQSWVNVGMALKHEGYSAAD----WDAWSMKDASRYHKD 55

Query: 224 SFNAKWDSF 232
               KWD+F
Sbjct: 56  ECFKKWDTF 64


>gi|19881514|ref|NP_612331.1| ORF109L [Infectious spleen and kidney necrosis virus]
 gi|19773719|gb|AAL98833.1|AF371960_109 ORF109L [infectious spleen and kidney necrosis virus]
          Length = 921

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 8/77 (10%), Positives = 24/77 (31%), Gaps = 2/77 (2%)

Query: 155 KIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWC 214
            +  S      T  ++RA +            + W+ V   ++     + +G  +   + 
Sbjct: 279 PMDVSTAASTTTPADVRALVDML-PASAAADRNTWLKVGFCLYQVMDATEDGLRLWMSFS 337

Query: 215 KLGR-TYDEKSFNAKWD 230
                 ++    +  W+
Sbjct: 338 AKCPEKFNATVCHDMWE 354


>gi|91783159|ref|YP_558365.1| putative DNA replication primase protein [Burkholderia xenovorans
           LB400]
 gi|91687113|gb|ABE30313.1| Putative DNA replication primase protein [Burkholderia xenovorans
           LB400]
          Length = 620

 Score = 54.4 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 25/70 (35%), Gaps = 6/70 (8%)

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
                    RA L+    +     ++ W+ +  A+        EG EI   W +    YD
Sbjct: 4   PYVDEANRARAALAVIPAD----DYETWVDMAFALKQGF--GDEGFEIWDAWSRTAANYD 57

Query: 222 EKSFNAKWDS 231
           E++    W S
Sbjct: 58  ERAARTTWRS 67


>gi|255282238|ref|ZP_05346793.1| RecA-family ATPase [Bryantella formatexigens DSM 14469]
 gi|255267186|gb|EET60391.1| RecA-family ATPase [Bryantella formatexigens DSM 14469]
          Length = 744

 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 23/63 (36%), Gaps = 10/63 (15%)

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEI--VREWCKLGRTYDEKSFNAKW 229
           + L        + S+ EW  V MA+        EG ++     W +    Y +     KW
Sbjct: 10  SALDFLNP--ADLSYTEWCAVGMALK------EEGFDVSVWDGWSRNDSRYHKGECGRKW 61

Query: 230 DSF 232
           + F
Sbjct: 62  NGF 64


>gi|168229312|ref|YP_001686833.1| orf39 [Streptococcus phage 858]
 gi|155241707|gb|ABT18027.1| orf39 [Streptococcus phage 858]
          Length = 271

 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/140 (8%), Positives = 39/140 (27%), Gaps = 12/140 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV-LDEQVVDRFNNE-FQSCCGKPISRVGQA 59
           V      +      +         +  D+DV   E       +        K ++    +
Sbjct: 42  VKRLWHEHPNANIALRT----TDFFVIDIDVSESEDGFQSLEDWELSKYIPKTLTAKTPS 97

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLA-YGQQFVAYNIHPKTQRAYTWSIAPHALK 118
               +  +  +        + +++  ++  A      +    +  ++  Y+W+       
Sbjct: 98  GGRHIFLKKPKG--VNISQDIRVKPGIDIKANNNNYILVAPSN-SSKGRYSWNKDTDT-- 152

Query: 119 VEELPLLTPDEVEYFFEFFD 138
           + E P    D ++   +   
Sbjct: 153 IAEAPKEIIDILKSEQKHEP 172


>gi|134291212|ref|YP_001114981.1| putative DNA replication primase protein [Burkholderia
           vietnamiensis G4]
 gi|134134401|gb|ABO58726.1| putative DNA replication primase protein [Burkholderia
           vietnamiensis G4]
          Length = 620

 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 25/70 (35%), Gaps = 6/70 (8%)

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
              +     RA L+    +     +  W+ +  A+        EG EI   W +    Y+
Sbjct: 4   PYVHDVDRARAALAVIPAD----DYGTWVDMAFALKQGF--GDEGFEIWDAWSRTAPNYN 57

Query: 222 EKSFNAKWDS 231
           E++    W S
Sbjct: 58  ERAARTTWRS 67


>gi|296139150|ref|YP_003646393.1| Bifunctional DNA primase/polymerase [Tsukamurella paurometabola DSM
           20162]
 gi|296027284|gb|ADG78054.1| Bifunctional DNA primase/polymerase [Tsukamurella paurometabola DSM
           20162]
          Length = 808

 Score = 54.0 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 54/225 (24%), Gaps = 27/225 (12%)

Query: 2   VATDVD--HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG-----KPIS 54
           +A       +      +        V A DVD  D +         +   G        S
Sbjct: 58  IAAWARSPRFERGNLALRLPP---NVIALDVDNHDGKPAAETIAALERAAGVPLPQTWTS 114

Query: 55  RVGQAPKTLMLFRMQ--ETNLKKQKSEEKIQGHLEFLAYGQQF--VAYNIHPKT-QRAYT 109
                      +R+     +     S ++    ++ L  G ++  V  + +P      Y 
Sbjct: 115 TSRSDGSCHAFYRVSLLAGDRGWPGSLKQFGPGVDLLQTGHRYSLVWPSTNPANDGAHYR 174

Query: 110 WSIA----------PHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKS 159
           W             P    + ELP    D +           T  +      +L+     
Sbjct: 175 WYRPDGSPAAVGEIPRPEDLTELPQSFIDAITAPRSISGEKATEAEATALLDRLAAHPDY 234

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSA 204
                    E  A      +   +G           I Y   G A
Sbjct: 235 RAPMSERMAEAVA--DAIEQFPADGHGTMVAVQGKVIRYAELGDA 277


>gi|310831484|ref|YP_003970127.1| putative VV D5-type primase/helicase [Cafeteria roenbergensis virus
           BV-PW1]
 gi|309386668|gb|ADO67528.1| putative VV D5-type primase/helicase [Cafeteria roenbergensis virus
           BV-PW1]
          Length = 877

 Score = 54.0 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/98 (11%), Positives = 26/98 (26%), Gaps = 4/98 (4%)

Query: 136 FFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMA 195
             +      +K+      +     +      + EI   L          ++++WI V   
Sbjct: 257 NNNISMEDVNKQYQQVSYNLSSSLNLPSSSKDTEIAQHLIKMLSVDRASNYEDWIRVGYC 316

Query: 196 IHYETRGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSF 232
           ++   R           + KL    + +      W   
Sbjct: 317 LYNIDR---TLLNEWINFSKLCPSKFKKGECENLWKKM 351


>gi|284030144|ref|YP_003380075.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
 gi|283809437|gb|ADB31276.1| Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
          Length = 308

 Score = 54.0 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/172 (10%), Positives = 38/172 (22%), Gaps = 29/172 (16%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVL------------------DEQVVDRFNN 43
           +A           G+  G     +   D+D                       V+     
Sbjct: 61  IAQIWRRAP-YNIGVAAGR--SGLVVVDLDRPKGAGDTAPEPWHSRGAASGGDVLALLAA 117

Query: 44  EFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK 103
           +         +    +  + + FR  +       +  ++   ++   +G   VA      
Sbjct: 118 DAGQELPATYTVATASGGSHLYFRQPDGIRLGN-TAGRLGWKIDTRGHGGYVVAAGSVTF 176

Query: 104 TQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSK 155
                 W         + LP              D  T  R   +  +  S 
Sbjct: 177 AG----WYATTSLTAPQPLP---AWITGALTRSPDQPTAARTATQQLKDASA 221


>gi|307353570|ref|YP_003894621.1| hypothetical protein Mpet_1423 [Methanoplanus petrolearius DSM
           11571]
 gi|307156803|gb|ADN36183.1| hypothetical protein Mpet_1423 [Methanoplanus petrolearius DSM
           11571]
          Length = 256

 Score = 54.0 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 42/173 (24%), Gaps = 13/173 (7%)

Query: 21  GTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP-KTLMLFRMQETNLKKQ--K 77
               V   D D   E V     + F         R G    +    F+    + KK    
Sbjct: 2   PAGGVCILDADNATELVQLHALDIFSDTF---FVRTGGEGFRGHFYFKCDFPDHKKIILY 58

Query: 78  SEEKIQGHLEFLAYGQ--QFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFE 135
             E  +   +    G     +       + + YT     +   V E      + +E  F 
Sbjct: 59  HPETGKELGDIRPSGCKAYCLGPGSIHPSGKPYT---IGNDRPVREFTY--EEIMEKLFS 113

Query: 136 FFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
              T    ++K+ +                T  E    L+    +        
Sbjct: 114 KVGTSADKKEKQPAGDLNKNENNLVEELGLTVTEFLMPLNHTIRDSQIEGEHP 166


>gi|258543727|ref|YP_003189160.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01]
 gi|256634805|dbj|BAI00781.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01]
 gi|256637861|dbj|BAI03830.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-03]
 gi|256640915|dbj|BAI06877.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-07]
 gi|256643970|dbj|BAI09925.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-22]
 gi|256647025|dbj|BAI12973.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-26]
 gi|256650078|dbj|BAI16019.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-32]
 gi|256653068|dbj|BAI19002.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656122|dbj|BAI22049.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-12]
          Length = 288

 Score = 54.0 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 50/190 (26%), Gaps = 11/190 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V      Y     G+  G  +      D+D+      D +  E  +      +   +   
Sbjct: 73  VPLLWRTYPGTLIGVATGKAS-GFDVLDLDLYKPD-ADAWYQEHCARIPATRTHKTRKDG 130

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI----HPKTQRAYTWSIAPHAL 117
             +LFR +E     + S  KI   ++  A G   + +           RA  W      +
Sbjct: 131 LHLLFRHRE---NMRNSAGKIAPGVDVRADGGYIIWWPAAGYEIIDKSRAQPWPAWLVEM 187

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
               LP      +E+                     +        R          L+ F
Sbjct: 188 TQPPLPRKAD--LEHLDNKLKDADRYVQGAVRAAVQAVASAPEGRRNDILNGETYSLARF 245

Query: 178 GEEFYNGSHD 187
             E Y  + D
Sbjct: 246 IPEGYLTATD 255


>gi|313892469|ref|ZP_07826059.1| primase C-terminal domain protein [Dialister microaerophilus UPII
           345-E]
 gi|313119151|gb|EFR42353.1| primase C-terminal domain protein [Dialister microaerophilus UPII
           345-E]
          Length = 694

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 27/66 (40%), Gaps = 7/66 (10%)

Query: 168 IEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKL-GRTYDEKSFN 226
           I++R  L           + EW+ V MA+++E        E+   W       +++    
Sbjct: 4   IDLRPLLQYINPSIL--DYQEWLSVGMALNHEGYP----YEVWETWSSRDSARFNDGECE 57

Query: 227 AKWDSF 232
            K+++F
Sbjct: 58  KKYNTF 63


>gi|220930664|ref|YP_002507573.1| primase [Clostridium cellulolyticum H10]
 gi|220000992|gb|ACL77593.1| Primase 2 [Clostridium cellulolyticum H10]
          Length = 741

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 25/65 (38%), Gaps = 7/65 (10%)

Query: 169 EIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT-YDEKSFNA 227
           ++R  L        +  + EW+ V MA+  +   +A+       W +     Y       
Sbjct: 7   DLRELLQYIHP--ASLDYQEWLSVGMALKEDGYTAAD----WDTWSRQDTKRYHSGECFK 60

Query: 228 KWDSF 232
           KWD+F
Sbjct: 61  KWDTF 65


>gi|56418240|gb|AAV91054.1| D5 family NTPase [Grouper iridovirus]
          Length = 966

 Score = 53.3 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 44/174 (25%), Gaps = 22/174 (12%)

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL--KVEELPLLTPD 128
              K  K+       ++F                     W         +   L +   +
Sbjct: 187 EPWKIHKTLNADGKPIDFKTAFGDMTLPES---------WGRPTSDRHREAMILSIHPVE 237

Query: 129 EVEYFFEF------FDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF-----LSCF 177
             +YF  +         +           KL  + +     +    E         L+  
Sbjct: 238 RQKYFRRYDFTANNPGALLRLTKYSAVRAKLDMVRQRKTCWKTDLTEFHKLKRFRELTGM 297

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
                      W+ V   +  +T+GS EG +I   + K     DE      W++
Sbjct: 298 LTGDIADDRQSWLHVGFCLWQQTQGSLEGYKIWLNFSKKSEKCDEDECWRIWNN 351


>gi|56692689|ref|YP_164147.1| D5 family NTPase [Singapore grouper iridovirus]
 gi|42517401|gb|AAS18067.1| D5 family NTPase [Singapore grouper iridovirus]
          Length = 968

 Score = 53.3 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 44/174 (25%), Gaps = 22/174 (12%)

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL--KVEELPLLTPD 128
              K  K+       ++F                     W         +   L +   +
Sbjct: 187 EPWKIHKTLNADGKPIDFKTAFGDMALPES---------WGRPTSDRHREAMILSIHPVE 237

Query: 129 EVEYFFEF------FDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF-----LSCF 177
             +YF  +         +           KL  + +     +    E         L+  
Sbjct: 238 RQKYFRRYDFTANNPGALLRLTKYSAVRAKLDMVRQRKTCWKTDLTEFHKLKRFRELTGM 297

Query: 178 GEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
                      W+ V   +  +T+GS EG +I   + K     DE      W++
Sbjct: 298 LTGDIADDRQSWLHVGFCLWQQTQGSLEGYKIWLNFSKKSEKCDEDECWRIWNN 351


>gi|325284423|ref|YP_004256963.1| Bifunctional DNA primase/polymerase [Deinococcus proteolyticus MRP]
 gi|324316487|gb|ADY27600.1| Bifunctional DNA primase/polymerase [Deinococcus proteolyticus MRP]
          Length = 370

 Score = 53.3 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 45/186 (24%), Gaps = 17/186 (9%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETN 72
           G   + G  +  +   D D   E           S      + +  +    + F     +
Sbjct: 70  GLAAVTGAISS-LVVLDFDG--EAGWALLRKWGLS-----PNALSGSGSPHVYFEHPGWH 121

Query: 73  LKKQKSEEKIQG---HLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
           ++   S          L+  A G   V    H  +  AY   +      V+ LP      
Sbjct: 122 VRTVASGSLKNPPFPGLDVRADGGMIVLPPSH-LSNGAYR-MLDVSPQPVDTLPEAVALW 179

Query: 130 VEYF----FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
           V           +        +   R L     S + +   N           +      
Sbjct: 180 VGLLPTPAVTLPEAPLPEAGTDNDLRALLDEAVSRSAQGRNNAGYWLARQLAAQGLTRSD 239

Query: 186 HDEWIP 191
            + WI 
Sbjct: 240 AEPWIR 245


>gi|307546785|ref|YP_003899264.1| hypothetical protein HELO_4195 [Halomonas elongata DSM 2581]
 gi|307218809|emb|CBV44079.1| hypothetical protein HELO_4195 [Halomonas elongata DSM 2581]
          Length = 345

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 22/66 (33%), Gaps = 6/66 (9%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
           T  E+R  L     +      + W+ V  A   E     +G     EW +   +Y     
Sbjct: 7   TFDELRLALQYIPAD----DRETWVNVGNACKTEY--GDDGFAAWDEWSQQAESYKAADA 60

Query: 226 NAKWDS 231
            + W S
Sbjct: 61  KSVWRS 66


>gi|269974626|gb|ACZ55147.1| bifunctional DNA primase/polymerase [Streptomyces sp. 36R-2-1B]
          Length = 361

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/215 (10%), Positives = 42/215 (19%), Gaps = 50/215 (23%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-------FQSCCG---- 50
           +          G G+ CG     +   D+D     V  R             +  G    
Sbjct: 82  IDAWWTASPAAGVGVACGPA--DLVVIDIDAHAASVPHRSRLLPGIAIPDAVNLAGLASG 139

Query: 51  --------------------KPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQ-----GH 85
                                 +     +    + +       + + S            
Sbjct: 140 FDTLALLAAYRDQPNPADDETTLRVRTPSGGLHVWYSNPHRETRFRCSTGSSPKVALAWQ 199

Query: 86  LEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           ++  A G   +A       Q  Y              P   P+ + +          P  
Sbjct: 200 VDVRADGGYIIAPTT-RTNQGTYRAEGPVRR------PAPLPEWLHHELVRTGHAIEPPA 252

Query: 146 KEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           K    R  +   +S              L     +
Sbjct: 253 KPPLARSQAPGRRS-----RKPAAAHQILDHLISQ 282


>gi|90962176|ref|YP_536092.1| hypothetical protein LSL_1201 [Lactobacillus phage Sal4]
 gi|90821370|gb|ABE00009.1| Hypothetical protein, phage associated [Lactobacillus phage Sal4]
 gi|300214850|gb|ADJ79266.1| Putative uncharacterized protein [Lactobacillus salivarius CECT
           5713]
          Length = 256

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/145 (8%), Positives = 38/145 (26%), Gaps = 18/145 (12%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFN---NEFQSCCGKPISRVG 57
           ++            G+        +   D+D  +  +        N   +     + R  
Sbjct: 42  LIKRWFMDEPNINIGLNLAK--SNLIVVDIDNHNNDLQAPLQSLSNLGYNLPSDYVER-T 98

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
           Q+      FR  +     +K++      ++ L+     V+          Y      +  
Sbjct: 99  QSGGLHYYFRSNKPVKPTRKTK--FIDGVDLLSD--FVVSSPS-----NNYK---VLNGA 146

Query: 118 KVEELPLLTPDEVEYFFEFFDTITT 142
            ++++P      ++           
Sbjct: 147 TLDDIPQAPNWIIKALDNRAMPTDK 171


>gi|257076858|ref|ZP_05571219.1| virulence-associated protein E [Ferroplasma acidarmanus fer1]
          Length = 980

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/160 (12%), Positives = 44/160 (27%), Gaps = 28/160 (17%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ-------------SCCG---- 50
           H   +G  +  G  T+     D DV  ++       + +             +  G    
Sbjct: 54  HRPGDGIAMPTGASTY--IIIDPDVAKDENKKPIKKDGKVIRIGLDNLCKQFNLLGLEDS 111

Query: 51  --KPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHL---EFLAYGQQFVAYNIHPKTQ 105
             + +    Q+      FR  +     +K +      +   +  A G   V       T+
Sbjct: 112 KLQTLVTETQSGGDHFWFRNPKGKPPLKKMQGNENNGIDKVDIQAEGAYVVLPP----TE 167

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
             +        +  +E+P +  +   +F           D
Sbjct: 168 GKFGKYKFITDVPFDEIPEMPLEFYNFFAGTEKKSENDAD 207


>gi|238020410|ref|ZP_04600836.1| hypothetical protein GCWU000324_00291 [Kingella oralis ATCC 51147]
 gi|237867390|gb|EEP68396.1| hypothetical protein GCWU000324_00291 [Kingella oralis ATCC 51147]
          Length = 1444

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 5/66 (7%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
           T  E+R  LS         S+ +W P+  AI         GK++  +W + G  Y     
Sbjct: 9   TYDEVRTALSYIPTP---SSYADWYPMAYAIKDAL--GENGKDLWHDWSRQGDNYKASVA 63

Query: 226 NAKWDS 231
            A W S
Sbjct: 64  EATWKS 69


>gi|114319952|ref|YP_741635.1| ATPase-like protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226346|gb|ABI56145.1| plasmid and phage replicative helicase / plasmid and phage DNA
           primase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 667

 Score = 53.3 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/196 (12%), Positives = 45/196 (22%), Gaps = 28/196 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDR---FNNEFQSCCGKPISRVGQ 58
           V      +      +  G  +  + A DVD    +            Q            
Sbjct: 78  VRQWWRRWPKAIPAVPTGKAS-GIDALDVDPDGYEWAAEHSDSLMMAQRIHHT------- 129

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
                 LFR  +     + S  KI   ++    G   V +                    
Sbjct: 130 ERGKHYLFRHTD---GVRNSNGKISAGIDVRGEGGWIVWWPAK-------GLEAHGELAD 179

Query: 119 VEELPLLTPDEVEYFFEFFDTITTPRDKE-------KSYRKLSKIWKSHNNRRYTNIEIR 171
           V + P    D +       +  + P   +       +    L++         Y+  E+ 
Sbjct: 180 VSDAPEALADLMRGVRSSTERDSAPVAADGAVIPEGQRDSTLTREAGRLRRYGYSESEML 239

Query: 172 AFLSCFGEEFYNGSHD 187
           A L            D
Sbjct: 240 AALHAINSHRCQPPLD 255


>gi|209551736|ref|YP_002283653.1| hypothetical protein Rleg2_4165 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537492|gb|ACI57427.1| hypothetical protein Rleg2_4165 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 842

 Score = 52.9 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/223 (13%), Positives = 71/223 (31%), Gaps = 14/223 (6%)

Query: 20  IGTHPVYAFDVDV-LDEQVVDRFNNEFQ-----SCCGKPISRVGQ-APKTLMLFRM--QE 70
           +   PV + ++D   D  + +      +        G   S  G+   K    +R+    
Sbjct: 140 VACCPVLSVEIDARPDAALSELVTVLGEPTITIHSGGVWTSPDGRQENKIHAHWRLSFPA 199

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
           T   + +  + ++     L    +  +  +HP      +W     + ++ ++ +   D  
Sbjct: 200 TRPDELRKLKAVRRAAAMLVDADKSASPLVHPMR-WPGSWHTKTTSARMCKI-VAEDDFA 257

Query: 131 EYFFEFFDTITTPRDKEK---SYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           E   +           ++   +    +    +         EI    +       +   D
Sbjct: 258 EIDLDVAAEALQAALVDRGLQTPGSPAAPSANGFKTEKAWSEIALLDAARIIPNGDLGWD 317

Query: 188 EWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
           EW  + M  +  + G   G E    W +    +DE +  A+WD
Sbjct: 318 EWNRIGMIFYDASHGDVAGLEAFLSWSEKSAKHDEVAAEARWD 360


>gi|153835208|ref|ZP_01987875.1| primase C 2 (PriCT-2) family [Vibrio harveyi HY01]
 gi|148868318|gb|EDL67446.1| primase C 2 (PriCT-2) family [Vibrio harveyi HY01]
          Length = 1209

 Score = 52.9 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 25/67 (37%), Gaps = 5/67 (7%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
              E    LS       +  +  W  +  A+  E    A   +I   W   G +YD++ F
Sbjct: 9   ELYEAEEALSHISP---DLPYKRWSKIGRALVSEYGNDAR--DIFERWSATGNSYDKRGF 63

Query: 226 NAKWDSF 232
            + W +F
Sbjct: 64  KSWWKNF 70


>gi|145354411|ref|XP_001421479.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581716|gb|ABO99772.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 689

 Score = 52.9 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 30/122 (24%), Gaps = 19/122 (15%)

Query: 15  GILCGIGTHPVYAFDVDVLDEQV-VDRFNNEFQSCCGK--PISRVGQAPKTLMLFRMQET 71
           G+L G   + V   D D    +   +          G         ++      F   E 
Sbjct: 3   GVLTG-RPNRVLVIDWDCYGGKCEFELTEEMLTRKVGGEGAYIVKTRSGGYHTYFAWDEE 61

Query: 72  NLKKQKSEEKIQGHLEFLAYGQQFV---AYNIHPKTQRAYTWSIAPHALKVEELPLLTPD 128
                K    I+G ++    G   V   A          Y          +  LP +  D
Sbjct: 62  RFGDWKGTVGIEGFVDIRTTGNYVVGADAPG--------YELLR----GDINNLPPMPND 109

Query: 129 EV 130
             
Sbjct: 110 LY 111


>gi|325288511|ref|YP_004264692.1| Primase 2 [Syntrophobotulus glycolicus DSM 8271]
 gi|324963912|gb|ADY54691.1| Primase 2 [Syntrophobotulus glycolicus DSM 8271]
          Length = 748

 Score = 52.9 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 20/62 (32%), Gaps = 7/62 (11%)

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG-RTYDEKSFNAKWD 230
             L           +  W+ V MA+      +A+      EW +     Y       KWD
Sbjct: 9   DLLKHIDP--AQLDYATWLSVGMALKEAGYTAAD----WDEWSRRDIGRYHAGECFRKWD 62

Query: 231 SF 232
           SF
Sbjct: 63  SF 64


>gi|322510700|gb|ADX06014.1| putative VV D5 family helicase [Organic Lake phycodnavirus 1]
          Length = 891

 Score = 52.5 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 27/84 (32%), Gaps = 7/84 (8%)

Query: 153 LSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG-SHDEWIPVVMAIHYETRGSAEGKEIVR 211
           + +   +         +   +     + FY   S+++W+ V MA+   +    +      
Sbjct: 294 IKQFIDNILIDEQHIKDTHHYCLLLDDSFYGEGSYNKWVKVGMALKNTSP---KLFITWV 350

Query: 212 EWCKLGRTYDEK---SFNAKWDSF 232
           +       ++         KW SF
Sbjct: 351 KLSSKSAIFEWDSISDMYNKWSSF 374


>gi|302058867|ref|ZP_07250408.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv.
           tomato K40]
          Length = 897

 Score = 52.5 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 35/243 (14%), Positives = 59/243 (24%), Gaps = 63/243 (25%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP---ISRVGQAPKT 62
                 +  G++ G     V + DVD +    V  ++              + VG   + 
Sbjct: 55  WTKNPNHNLGVVLGP--SRVCSLDVDDVQWTRVVLYDLLGLDLDALALAFPTVVGNPLRF 112

Query: 63  LMLFRMQETN--------LKKQKSEEKIQGH----------------------------- 85
            +LFR+ E             +   +                                  
Sbjct: 113 RILFRVPEGLDLTRHALAWPNENDPDGSIHKSIMLKANAARDAGDTAREALYRADAEKYK 172

Query: 86  ----LEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEV---------- 130
                E  A   Q V     HP T + YTW   P       LP+L  D +          
Sbjct: 173 RLTVFELRAGLVQDVLPPSIHPGTGQPYTWRTPP---DASGLPVLIGDLLNVWNNWDVFK 229

Query: 131 ---EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
              E    +      P  K+K   K + +  +  +                   Y     
Sbjct: 230 RGAEAACPWLPKDAKPTAKQKPKPKRAPVAGNRPSVIDEFNNCHDVEEILRSHGYTKRGG 289

Query: 188 EWI 190
           +W+
Sbjct: 290 KWL 292


>gi|56708874|ref|YP_164917.1| hypothetical protein SPOA0086 [Ruegeria pomeroyi DSS-3]
 gi|56680559|gb|AAV97224.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 603

 Score = 52.5 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 10/124 (8%), Positives = 29/124 (23%), Gaps = 18/124 (14%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           +V   +  +      I        +   DVD    +                    G+  
Sbjct: 74  LVQKALRTHPRANLAISL----AGLTVVDVDGKAGKQAVE----GLDLPKTVKVFTGR-- 123

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFL-AYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
              + ++       +          ++ L    +  +       + + Y +S       +
Sbjct: 124 GYHLYYQ------GECSGGAFKGDEIDVLTGANRMVMVPPSTHPSGKRYRYSSQ-SPSGM 176

Query: 120 EELP 123
             +P
Sbjct: 177 AAMP 180


>gi|331703012|ref|YP_003358129.2| RepB [Streptomyces sp. Y27]
 gi|329331765|gb|ADA71989.2| RepB [Streptomyces sp. Y27]
          Length = 362

 Score = 52.5 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/141 (10%), Positives = 27/141 (19%), Gaps = 36/141 (25%)

Query: 4   TDVDHYVYNGFGILCGIG--------THPVYAFDVDVL-------------DEQVVDRFN 42
                Y     G+L G             +   D+D+                   D   
Sbjct: 87  AWSTKYARAHVGLLTGRVTQAAPAELGRGLVVIDLDMPKAGADLPTGRWAGCAGGTDVLE 146

Query: 43  NEFQSCCGKPISRVG---QAPKTLMLFRMQETNLK-----------KQKSEEKIQGHLEF 88
              +               +    + +R  E               +      I   ++ 
Sbjct: 147 LLMREAGADWPDTYTVLTPSGGMHLYYRQPEDGPLIGCATGAGGDLENPRPPHIGPMVDV 206

Query: 89  LAYGQQFVAYNIHPKT-QRAY 108
              G   +A   H     R Y
Sbjct: 207 RGIGGYVIAAGSHSAAQGRPY 227


>gi|330719218|ref|ZP_08313818.1| prophage DNA replication protein [Leuconostoc fallax KCTC 3537]
          Length = 272

 Score = 52.1 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/152 (11%), Positives = 37/152 (24%), Gaps = 16/152 (10%)

Query: 3   ATDVDH---YVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF------QSCCGKPI 53
              +     Y     GI        +   D+D  +   +      F              
Sbjct: 44  KDWIKRHSDYQNGNVGIDLSK--SNLVVVDIDKHEHNGMASILAWFKTHHIEPDTIQDTY 101

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIA 113
            +          + +    +K +     I+  ++ L+     VA ++  +    Y     
Sbjct: 102 IKRTPTGGLHAFYLIPNGQIKPKHVINAIK-GVDVLSETGVTVAPSMIDE--GQYR--QI 156

Query: 114 PHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
               K++ +P    D V          T    
Sbjct: 157 TAFDKIKPVPQWVYDLVNDLGTDRPNNTYKAK 188


>gi|254384015|ref|ZP_04999361.1| bifunctional DNA primase/polymerase [Streptomyces sp. Mg1]
 gi|194342906|gb|EDX23872.1| bifunctional DNA primase/polymerase [Streptomyces sp. Mg1]
          Length = 361

 Score = 52.1 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/187 (11%), Positives = 39/187 (20%), Gaps = 43/187 (22%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC-------------- 49
              +     G G+ CG     +   DVD    + +                         
Sbjct: 82  AWWETEPGFGIGVACGPA--GLVVIDVD-AHAEQLPDRQRLLPGIPIDDRVDLTGLQSGF 138

Query: 50  ------------------GKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQ-----GHL 86
                                +     +    + +R      + + S            +
Sbjct: 139 DTLALLAAYRSRPNPCEDTSTLRVRTPSGGMHIWYRAPRGGPRLRCSSGSSPKVALAWQV 198

Query: 87  EFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDK 146
           +  A G   VA            +   P A     LPL    E+       +    P D 
Sbjct: 199 DVRAVGGYIVAPTTRTAAG---VYEPLPGARVPAALPLWLIAELARTGHTVEAPVAPSDA 255

Query: 147 EKSYRKL 153
             +  + 
Sbjct: 256 PVTPSRP 262


>gi|297180892|gb|ADI17096.1| hypothetical protein [uncultured gamma proteobacterium
           HF0070_03O15]
          Length = 328

 Score = 52.1 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 19/61 (31%), Gaps = 7/61 (11%)

Query: 175 SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD------EKSFNAK 228
                         W  +   I+ E  G   G E+ REW K    Y+      E    A+
Sbjct: 8   WSVIGHKGPNQEHYWWEIGAMINNELPGIE-GLELWREWSKKDPDYEHCWEDGEDPCAAR 66

Query: 229 W 229
           W
Sbjct: 67  W 67


>gi|330445050|ref|ZP_08308703.1| primase C terminal 2 family protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489241|dbj|GAA03200.1| primase C terminal 2 family protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 1216

 Score = 52.1 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 27/67 (40%), Gaps = 5/67 (7%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
           +  +    L           +++W  +  +++ E     + +++   W     +YD+K F
Sbjct: 9   SLYDAENALQFIDS---AMPYNDWAKLGRSLYSEY--GDDARDMFELWSAQSSSYDKKEF 63

Query: 226 NAKWDSF 232
            + W SF
Sbjct: 64  QSHWRSF 70


>gi|301066074|ref|YP_003788097.1| prophage Lp3 protein 7-like protein [Lactobacillus casei str.
           Zhang]
 gi|300438481|gb|ADK18247.1| prophage Lp3 protein 7-like protein [Lactobacillus casei str.
           Zhang]
          Length = 278

 Score = 51.7 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/181 (8%), Positives = 41/181 (22%), Gaps = 29/181 (16%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ-------SCCGKPISR 55
                 +     G+        V  FD+D+  +   +   +  +                
Sbjct: 49  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSEANGNESLAKLSAEGRADQIPSTYIE 104

Query: 56  VGQAPKTLMLFRMQET----NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +     +     S+   +  L+++A G     +    +        
Sbjct: 105 TTPNGGLHIFFTYPKELQLTSRSDLFSKNGEKTGLDYIATG--VPVFPSIRENGMY---- 158

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
                 K+ +L  +    ++                      S +++          EI 
Sbjct: 159 QPLKGHKITKLAPVPQWLLDEIQ--------RVSHPNPQLGGSTVYRGKRWTGKLLDEIV 210

Query: 172 A 172
            
Sbjct: 211 N 211


>gi|170699160|ref|ZP_02890214.1| Primase 2 [Burkholderia ambifaria IOP40-10]
 gi|170135955|gb|EDT04229.1| Primase  2 [Burkholderia ambifaria IOP40-10]
          Length = 625

 Score = 51.7 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 27/72 (37%), Gaps = 6/72 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
             +       +RA L+    +     ++ W+ +  A+        EG EI   W +    
Sbjct: 2   TISNLDEADRVRAALAVIPAD----DYETWVDMAFALKQGF--GDEGFEIWDAWSRTAAN 55

Query: 220 YDEKSFNAKWDS 231
           Y+E++    W S
Sbjct: 56  YNERAARTTWRS 67


>gi|260462806|ref|ZP_05811011.1| Bifunctional DNA primase/polymerase [Mesorhizobium opportunistum
           WSM2075]
 gi|259031450|gb|EEW32721.1| Bifunctional DNA primase/polymerase [Mesorhizobium opportunistum
           WSM2075]
          Length = 226

 Score = 51.7 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 34/123 (27%), Gaps = 7/123 (5%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           +      +     GIL G     +   D D  D      ++++ ++   +          
Sbjct: 81  IRRWFRKF-AGNVGILGGF--SNLLILDFD--DAATYLSWSSKHEALLNRTPIAR-SPNG 134

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             +  R ++            +      A G   V      K   +Y+W        V+ 
Sbjct: 135 FHVYLRTRDPTASSSLYAGMRRIG-HVKALGGYVVGSPSMLKDGSSYSWLKDHSPFDVDP 193

Query: 122 LPL 124
            P+
Sbjct: 194 SPI 196


>gi|237735523|ref|ZP_04566004.1| recA-family ATPase [Mollicutes bacterium D7]
 gi|229381268|gb|EEO31359.1| recA-family ATPase [Coprobacillus sp. D7]
          Length = 738

 Score = 51.7 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 7/69 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT-YDEK 223
               ++   L+         ++ EW  V MA+ YE    +E       W +     Y +K
Sbjct: 2   EYTTDLIEILNYIDPSRL--NYQEWCCVGMALKYEGYSVSE----WDSWSRRDSKRYHDK 55

Query: 224 SFNAKWDSF 232
               KWD+F
Sbjct: 56  ECLKKWDTF 64


>gi|167620889|ref|ZP_02389520.1| DNA primase [Burkholderia thailandensis Bt4]
          Length = 205

 Score = 51.7 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
               D W    MA+  E     EG  +  EW +  ++Y+ K     W SF
Sbjct: 16  ADDRDTWRQAGMALKAEF--GEEGFALWNEWGQGAQSYNAKDARDVWKSF 63


>gi|296161904|ref|ZP_06844705.1| Primase 2 [Burkholderia sp. Ch1-1]
 gi|295887923|gb|EFG67740.1| Primase 2 [Burkholderia sp. Ch1-1]
          Length = 636

 Score = 51.7 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 24/70 (34%), Gaps = 6/70 (8%)

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
                    RA L+    E Y      W+ +  AI +       G +I  EW +    Y 
Sbjct: 4   RYLSEEERARAALAMVPAEDYAT----WVDMAFAIKHGF--GEAGFDIWDEWSRTAHNYS 57

Query: 222 EKSFNAKWDS 231
           E++    W S
Sbjct: 58  ERAARVTWRS 67


>gi|188588977|ref|YP_001919584.1| putative primase [Clostridium botulinum E3 str. Alaska E43]
 gi|188499258|gb|ACD52394.1| putative primase [Clostridium botulinum E3 str. Alaska E43]
          Length = 712

 Score = 51.7 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 44/178 (24%), Gaps = 19/178 (10%)

Query: 7   DHYVYNGF-G--ILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC-----------GKP 52
           + Y      G  ++CG     +   D+D             F                  
Sbjct: 47  EKYSNKNITGFSLICGEP-GGIMVIDIDRNHGDGSIDGQKSFDDLIKKLSTEDKQQISST 105

Query: 53  ISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSI 112
            +       T + F+ +E      KS+      ++    G   V  N   K         
Sbjct: 106 FAVKTPNGGTHIYFKYREG----LKSKANYVPGVDIRTDGGLIVLPNSSVKIGEETREYK 161

Query: 113 APHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
             +   + E+P    D+     +     +    + K      +  ++    +     I
Sbjct: 162 IFNNTNINEIPQTLFDKFLELDKPNKKKSKKVSEAKPSTIYKEGSRNQELFKEVIKII 219


>gi|300215226|gb|ADJ79642.1| Putative uncharacterized protein [Lactobacillus salivarius CECT
           5713]
          Length = 209

 Score = 51.3 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/195 (10%), Positives = 51/195 (26%), Gaps = 27/195 (13%)

Query: 10  VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFN---NEFQSCCGKPISRVGQAPKTLMLF 66
                G+        +   D+D  +  +        N   +     + R  ++      +
Sbjct: 4   PNINIGLNLAK--SNLIVVDIDNHNNDLQAPLQSLSNLGYNLPSDYVER-TKSGGLHFYY 60

Query: 67  RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLT 126
           R  +     +K++      ++ L+    FV  +  P T   Y      +   + ++P   
Sbjct: 61  RCSDGIPATRKTK--FIDGVDLLSD---FVVTS--PSTN--YK---ILNGATLNDIPQTP 108

Query: 127 PDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS- 185
              ++            +D    YR             Y   EI   +       +  S 
Sbjct: 109 NWIIKALDNRVMPTDKMQDNPTPYR--------RYYTGYLIDEIVNGVDAGNRNNWIASI 160

Query: 186 HDEWIPVVMAIHYET 200
             + +    +     
Sbjct: 161 FGKLLRAGASPKNAY 175


>gi|15078896|ref|NP_149647.1| 184R [Invertebrate iridescent virus 6]
 gi|82013411|sp|O55768|VF184_IIV6 RecName: Full=Putative helicase 184R
 gi|2738452|gb|AAB94479.1| 184R [Invertebrate iridescent virus 6]
          Length = 971

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 36/117 (30%), Gaps = 7/117 (5%)

Query: 121 ELPLL----TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
           ELP+L        +     F+      +  +     ++   +         IE    L+ 
Sbjct: 256 ELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTS 315

Query: 177 FGEEFYNGSHDEWIPVVMAIHYETRGSA---EGKEIVREWCKLGRTYDEKSFNAKWD 230
           F        +++W  V + +     G     E  E  + +      YDE   + +W 
Sbjct: 316 FLSVSRADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWA 372


>gi|291442771|ref|ZP_06582161.1| bifunctional DNA primase/polymerase [Streptomyces ghanaensis ATCC
           14672]
 gi|291345666|gb|EFE72622.1| bifunctional DNA primase/polymerase [Streptomyces ghanaensis ATCC
           14672]
          Length = 354

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 34/147 (23%), Gaps = 27/147 (18%)

Query: 8   HYVYNGFGILCGIGTH-PVYAFDVDVLDE------------QVVDRFNNEFQSCCGKPIS 54
            +     GIL G G    +   D+DV  E              VD               
Sbjct: 96  RFRRAHVGILTGRGAGRGLLVIDLDVRKEGTDLPPEYAYAYSGVDILERMATEAGEPWPD 155

Query: 55  R---VGQAPKTLMLFRMQETNL------KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
               +  +    + FR  E             +   +   ++    G   +A   +   Q
Sbjct: 156 TYSVITPSGGVHLYFRQPEEGPLIGCATGAGPTAPHLGPLIDVRGVGGLVIAAGSYSAAQ 215

Query: 106 R-AYTWSIAPHALKVEELPLLTPDEVE 131
             AY                L    +E
Sbjct: 216 GIAYRRMSDSGDRPQP----LPGWLLE 238


>gi|299135474|ref|ZP_07028664.1| Primase 1 [Afipia sp. 1NLS2]
 gi|298589882|gb|EFI50087.1| Primase 1 [Afipia sp. 1NLS2]
          Length = 332

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 45/161 (27%), Gaps = 22/161 (13%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETN 72
            FG++CG  T  +   DVD  DE       +        P      +      +R +   
Sbjct: 57  AFGLVCGRVT-GLTVLDVDSKDE---QVLADALARHGETPFVVRTGSGNFQAWYRHRGE- 111

Query: 73  LKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEY 132
            K+Q         ++ L  G   VA      T+ AY   +      + +LP         
Sbjct: 112 -KRQVRPWGKDLPIDQLGDG-YVVAPPSK-GTRMAYE-IVHGTLDDLPDLP--------- 158

Query: 133 FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
               F         +   R   +  ++     +   +    
Sbjct: 159 ----FMQNAWRSGDQARPRTAHEGERNKALWWHCMHDAHDC 195


>gi|187921139|ref|YP_001890171.1| Primase 2 [Burkholderia phytofirmans PsJN]
 gi|187719577|gb|ACD20800.1| Primase 2 [Burkholderia phytofirmans PsJN]
          Length = 621

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 27/72 (37%), Gaps = 6/72 (8%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
              +      +RA L+    E     +  W+ +  A+ +       G EI  EW +    
Sbjct: 2   SMPQTDETARVRAALALIPAE----DYGTWVDMAFALKHGL--GDAGFEIWDEWSRTAGN 55

Query: 220 YDEKSFNAKWDS 231
           YDE++    W S
Sbjct: 56  YDERAARTTWCS 67


>gi|297566004|ref|YP_003684976.1| Bifunctional DNA primase/polymerase [Meiothermus silvanus DSM 9946]
 gi|296850453|gb|ADH63468.1| Bifunctional DNA primase/polymerase [Meiothermus silvanus DSM 9946]
          Length = 1006

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 27/107 (25%), Gaps = 6/107 (5%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
                   G GIL         A D DV                 G+   +        +
Sbjct: 55  WWQAAPGAGVGIL---PPAETLALDCDVPSAWGALLAE---YPELGEAPRQRTPRGGVHV 108

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
             R+    +    S  +    ++    G+ ++A         AY W 
Sbjct: 109 FLRLPAGLVGSLTSSARKLPGVDLRGLGKAYLAAAPTTLPNGAYVWE 155


>gi|300172882|ref|YP_003772047.1| prophage DNA replication protein [Leuconostoc gasicomitatum LMG
           18811]
 gi|299887260|emb|CBL91228.1| prophage Lp4 protein 7, DNA replication [Leuconostoc gasicomitatum
           LMG 18811]
          Length = 272

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/150 (9%), Positives = 28/150 (18%), Gaps = 16/150 (10%)

Query: 5   DVDHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF------QSCCGKPISR 55
            +  Y        GI        +   D+D   +  +      F                
Sbjct: 46  WITQYQAYRFGNIGIDLSK--SNLVVVDIDKHGQNGMASILAWFKSHNVNPDTLQDTYVE 103

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
                     + +      K K        ++ L+      A +        Y       
Sbjct: 104 QTPTGGLHAFYLIPSGQ-DKPKHIINAIKGVDVLSNTAVMTAPST--MNGGQYR--QITP 158

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
             K++ +P    D                 
Sbjct: 159 FDKIKPVPTWVYDLANGLGTDRPNNVYRAK 188


>gi|91780506|ref|YP_555713.1| putative DNA replication primase [Burkholderia xenovorans LB400]
 gi|91693166|gb|ABE36363.1| Putative DNA replication primase [Burkholderia xenovorans LB400]
          Length = 644

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 23/70 (32%), Gaps = 6/70 (8%)

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
                    RA L+    E Y      W+ +  A+         G +I  EW +    Y 
Sbjct: 4   RYLSEEERARAALAMIPAEDYAT----WVDMAFALKQGF--GEAGFDIWDEWSRTAHNYS 57

Query: 222 EKSFNAKWDS 231
           E++    W S
Sbjct: 58  ERAARVTWRS 67


>gi|157310960|ref|YP_001468956.1| putative DNA primase [Corynebacterium phage P1201]
 gi|95832108|gb|ABF57508.1| putative DNA primase [Corynebacterium phage P1201]
          Length = 881

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 54/187 (28%), Gaps = 22/187 (11%)

Query: 12  NGFGILCG---IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKP----ISRVGQAP---- 60
              G+       G+  + + D+D    +  D    E +S  G      + R  +      
Sbjct: 80  ANLGLRLQSDVEGSQEIISIDIDHYGTKRGDDHLRELESQLGSLNRDSVWRSTRRGIRNP 139

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQ-QFVAYNIHPKTQRAYTWSIAPH---- 115
              + FR+        K E K   +++ +  G    V +         Y W         
Sbjct: 140 SGQIFFRVPPG----LKWESKACINVDIVQMGHRYSVVWPSV-SGDSQYKWISPEGVFAD 194

Query: 116 -ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL 174
               V++LP +    V +               +S    S   K      +  + +  ++
Sbjct: 195 SPPYVKDLPEMPEAWVTHLTNGVKRGAFTAKSSRSTFTGSGGDKYRAAIDWLRLNLPGWV 254

Query: 175 SCFGEEF 181
           S   E+ 
Sbjct: 255 SKVSEDG 261


>gi|225870194|ref|YP_002746141.1| phage protein [Streptococcus equi subsp. equi 4047]
 gi|225699598|emb|CAW93236.1| hypothetical phage protein [Streptococcus equi subsp. equi 4047]
          Length = 275

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/142 (9%), Positives = 37/142 (26%), Gaps = 15/142 (10%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC---CGKPISRVGQAPKT 62
              Y  +   +         +  D+D+  +         ++          ++     K 
Sbjct: 46  WTQYPDSNIAVRT----DKFFVIDIDLHGKANGFESLANWEHLDLITPTLQAKTASGGKH 101

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
           +  F+  + ++ +          ++  A       VA +  PK    Y W          
Sbjct: 102 IFYFKHPDVSMTQM---IGFLPGVDVKAHLNNYVLVAPSKTPK--GVYAWDKDKSKEDGT 156

Query: 121 ELPLLTPDEVEYFFEFFDTITT 142
            +   +   V    + ++    
Sbjct: 157 MVT-ASRKLVMAIKQEYNKKNP 177


>gi|196885459|gb|ACG80592.1| primase/helicase [Acanthamoeba castellanii mamavirus]
          Length = 960

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 20/71 (28%), Gaps = 5/71 (7%)

Query: 164 RYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDE 222
             T +E +  +  F  +     +  W  V   +           E    + K     + +
Sbjct: 358 EETLVEAKNLVKLFSVQR-ATDYHTWYQVGRCLSNI---DHRLLEDWITFSKKCPSKFKK 413

Query: 223 KSFNAKWDSFD 233
           +     W + +
Sbjct: 414 EECERLWRNMN 424


>gi|311977583|ref|YP_003986703.1| putative helicase [Acanthamoeba polyphaga mimivirus]
 gi|160369783|sp|Q5UQ22|YL207_MIMIV RecName: Full=Putative helicase L207/L206
 gi|308204253|gb|ADO18054.1| putative helicase [Acanthamoeba polyphaga mimivirus]
          Length = 960

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 20/71 (28%), Gaps = 5/71 (7%)

Query: 164 RYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDE 222
             T +E +  +  F  +     +  W  V   +           E    + K     + +
Sbjct: 358 EETLVEAKNLVKLFSVQR-ATDYHTWYQVGRCLSNI---DHRLLEDWITFSKKCPSKFKK 413

Query: 223 KSFNAKWDSFD 233
           +     W + +
Sbjct: 414 EECERLWRNMN 424


>gi|55416830|gb|AAV50480.1| helicase III/ VV D5-type ATPase (N-term) [Acanthamoeba polyphaga
           mimivirus]
          Length = 582

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 20/71 (28%), Gaps = 5/71 (7%)

Query: 164 RYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-TYDE 222
             T +E +  +  F  +     +  W  V   +           E    + K     + +
Sbjct: 358 EETLVEAKNLVKLFSVQR-ATDYHTWYQVGRCLSNI---DHRLLEDWITFSKKCPSKFKK 413

Query: 223 KSFNAKWDSFD 233
           +     W + +
Sbjct: 414 EECERLWRNMN 424


>gi|312873799|ref|ZP_07733843.1| bifunctional DNA primase/polymerase, N-terminal domain protein
           [Lactobacillus iners LEAF 2052A-d]
 gi|311090680|gb|EFQ49080.1| bifunctional DNA primase/polymerase, N-terminal domain protein
           [Lactobacillus iners LEAF 2052A-d]
          Length = 264

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/178 (8%), Positives = 39/178 (21%), Gaps = 12/178 (6%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-FQSCCGKPISRVGQAP 60
           +      Y      +            D+D  +    +              +S      
Sbjct: 44  ITALWCKYPTANIALKT----DKFIVLDIDRHEIDGFESIKALHRPDWFLNTLSEKTAHN 99

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                +R  +    K      I   ++  A      V           Y W      L +
Sbjct: 100 GLHFFYRKPKNM--KMTQVIGILPGVDLKANKNNYVVVAPSVFGYG-YYKWLNH---LPM 153

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
           +++P    + ++      + +           K  +   +  N      +    L+  
Sbjct: 154 KDVPKDMLEWIKSKKGVVNRVKISTVFNNGLTKAGEKINTIYNGLGDTGKRNDTLASL 211


>gi|291301676|ref|YP_003512954.1| Bifunctional DNA primase/polymerase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570896|gb|ADD43861.1| Bifunctional DNA primase/polymerase [Stackebrandtia nassauensis DSM
           44728]
          Length = 304

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 33/123 (26%), Gaps = 4/123 (3%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V   V  +      +  G  +  V    VD  ++                 ++    +  
Sbjct: 73  VVAMVTGHPRGVLALRTGASSGVVVVD-VDPRNDGTHTFVRLLADGVLPATVTANTGSRG 131

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
             + +         +    ++   ++  A G   V         +AYTW        +E 
Sbjct: 132 LHLYYAHPGG--TVKSGGNRLGPGVDVKADGAYVVLPPS-TVNGKAYTWRPGTDPTSLEL 188

Query: 122 LPL 124
            P+
Sbjct: 189 SPI 191


>gi|296135617|ref|YP_003642859.1| Primase 2 [Thiomonas intermedia K12]
 gi|295795739|gb|ADG30529.1| Primase 2 [Thiomonas intermedia K12]
          Length = 751

 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 20/71 (28%), Gaps = 8/71 (11%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD- 221
             +     RA L        +   ++W    MA            E   +W   G  Y  
Sbjct: 3   NGHDTERARAALQAIPP---DLPREDWTRAGMAAKAAGL----ALEDFTDWSANGGNYAG 55

Query: 222 EKSFNAKWDSF 232
            K   + W SF
Sbjct: 56  PKDCASVWQSF 66


>gi|148261291|ref|YP_001235418.1| hypothetical protein Acry_2304 [Acidiphilium cryptum JF-5]
 gi|146402972|gb|ABQ31499.1| hypothetical protein Acry_2304 [Acidiphilium cryptum JF-5]
          Length = 158

 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/83 (12%), Positives = 26/83 (31%), Gaps = 6/83 (7%)

Query: 14  FGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNL 73
            G+  G  +  + A D+D  ++     +    +       +   ++    + F+      
Sbjct: 55  VGVATGERS-GIAALDID--NKPGGLDWFEANRDKLPATRTHRTRSGGLHLWFKH---RA 108

Query: 74  KKQKSEEKIQGHLEFLAYGQQFV 96
             + S   I   ++  A G    
Sbjct: 109 GLRSSVSAIAPGIDIRADGGSCA 131


>gi|206562201|ref|YP_002232964.1| hypothetical protein BCAM0337 [Burkholderia cenocepacia J2315]
 gi|198038241|emb|CAR54195.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 615

 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 25/69 (36%), Gaps = 6/69 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
                  +RA L+        G +  W+ +  A+ +       G ++   W +    YD 
Sbjct: 5   YISEADRVRAALAAIP----AGDYSTWVDMAFAVKHGL--GEAGFDLWDAWSQTAPNYDA 58

Query: 223 KSFNAKWDS 231
           +S  A W S
Sbjct: 59  RSARATWRS 67


>gi|116691425|ref|YP_836958.1| hypothetical protein Bcen2424_3324 [Burkholderia cenocepacia
           HI2424]
 gi|116649425|gb|ABK10065.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 615

 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 24/69 (34%), Gaps = 6/69 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
                  +R  L+    +     +  W+ +  A+ +       G E+   W +    YD 
Sbjct: 5   YISEADRVRTALATIPAD----DYTTWVDMAFAVKHGL--GEAGFELWDAWSQTAPNYDA 58

Query: 223 KSFNAKWDS 231
           +S  A W S
Sbjct: 59  RSARATWRS 67


>gi|239934320|ref|ZP_04691273.1| hypothetical protein SghaA1_39360 [Streptomyces ghanaensis ATCC
           14672]
          Length = 308

 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 34/147 (23%), Gaps = 27/147 (18%)

Query: 8   HYVYNGFGILCGIGTH-PVYAFDVDVLDE------------QVVDRFNNEFQSCCGKPIS 54
            +     GIL G G    +   D+DV  E              VD               
Sbjct: 50  RFRRAHVGILTGRGAGRGLLVIDLDVRKEGTDLPPEYAYAYSGVDILERMATEAGEPWPD 109

Query: 55  R---VGQAPKTLMLFRMQETNL------KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ 105
               +  +    + FR  E             +   +   ++    G   +A   +   Q
Sbjct: 110 TYSVITPSGGVHLYFRQPEEGPLIGCATGAGPTAPHLGPLIDVRGVGGLVIAAGSYSAAQ 169

Query: 106 R-AYTWSIAPHALKVEELPLLTPDEVE 131
             AY                L    +E
Sbjct: 170 GIAYRRMSDSGDRPQP----LPGWLLE 192


>gi|170736572|ref|YP_001777832.1| primase 2 [Burkholderia cenocepacia MC0-3]
 gi|169818760|gb|ACA93342.1| Primase 2 [Burkholderia cenocepacia MC0-3]
          Length = 615

 Score = 50.2 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 24/69 (34%), Gaps = 6/69 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
                  +R  L+    +     +  W+ +  A+ +       G E+   W +    YD 
Sbjct: 5   YISEADRVRTALATIPAD----DYTTWVDMAFAVKHGL--GEAGFELWDAWSQTAPNYDA 58

Query: 223 KSFNAKWDS 231
           +S  A W S
Sbjct: 59  RSARATWRS 67


>gi|190151436|ref|YP_001974347.1| putative replication protein [Streptococcus phage PH15]
 gi|190014430|emb|CAQ57816.1| hypothetical protein [Streptococcus phage PH15]
          Length = 273

 Score = 50.2 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/183 (7%), Positives = 46/183 (25%), Gaps = 19/183 (10%)

Query: 1   MVATDVDHY----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPI 53
           M A++++++          +         +  D+D   +         ++          
Sbjct: 38  MSASEIENFWDGFPNANIALRT----TNFFVIDIDKHGKSNGFESLKNWEHLDLIEPTLQ 93

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSI 112
           ++     K L  F+  +  + +          ++  A+     +         + Y W +
Sbjct: 94  AKTASGGKHLFYFKRDDEPITQM---IGFLAGVDIKAHENNYVLVAPSATDKGQ-YEWDL 149

Query: 113 APHALKVEELPLLTPDEVEYFFEFFDTI--TTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
                    +   + D +      +           +       + ++    +     E 
Sbjct: 150 EKSKEGGTIVTP-SRDLIRAIKRQYGETHGYKYDGTDGLRSLARRSYQRDRTQTTDLFET 208

Query: 171 RAF 173
            A 
Sbjct: 209 IAL 211


>gi|191639829|ref|YP_001988995.1| hypothetical protein LCABL_30870 [Lactobacillus casei BL23]
 gi|190714131|emb|CAQ68137.1| Putative uncharacterized protein ps609 [Lactobacillus casei BL23]
          Length = 273

 Score = 50.2 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/150 (8%), Positives = 32/150 (21%), Gaps = 21/150 (14%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV---DRFNNEFQS----CCGKPISR 55
                 +     G+        V  FD+D+  +      +                    
Sbjct: 49  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSGANGNETLAKLCADGRAGQIPSTYIE 104

Query: 56  VGQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +    S+   +  L+++A G     +    +        
Sbjct: 105 TTPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYVATG--VPVFPSIRENGMY---- 158

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
                 K+ +L       ++          
Sbjct: 159 QPLKGHKITKLAPAPQWLLDEIQRQCHPNM 188


>gi|327383939|gb|AEA55415.1| Bifunctional DNA primase/polymerase [Lactobacillus casei LC2W]
 gi|327387121|gb|AEA58595.1| Bifunctional DNA primase/polymerase [Lactobacillus casei BD-II]
          Length = 270

 Score = 50.2 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/150 (8%), Positives = 32/150 (21%), Gaps = 21/150 (14%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVV---DRFNNEFQS----CCGKPISR 55
                 +     G+        V  FD+D+  +      +                    
Sbjct: 46  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSGANGNETLAKLCADGRAGQIPSTYIE 101

Query: 56  VGQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +    S+   +  L+++A G     +    +        
Sbjct: 102 TTPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYVATG--VPVFPSIRENGMY---- 155

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
                 K+ +L       ++          
Sbjct: 156 QPLKGHKITKLAPAPQWLLDEIQRQCHPNM 185


>gi|206561307|ref|YP_002232072.1| hypothetical protein BCAL2966 [Burkholderia cenocepacia J2315]
 gi|198037349|emb|CAR53279.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 934

 Score = 50.2 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 23/72 (31%), Gaps = 5/72 (6%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            +        + A L+C      + S + W  +  A+ +E      G ++   W +    
Sbjct: 1   MSAVYDEQQRVEAALACIPP---DVSRETWYRIAAALKHEM--GDAGFDLFDGWSRGHDG 55

Query: 220 YDEKSFNAKWDS 231
           Y        W S
Sbjct: 56  YAASDARDTWRS 67


>gi|302538857|ref|ZP_07291199.1| bifunctional DNA primase/polymerase [Streptomyces sp. C]
 gi|302447752|gb|EFL19568.1| bifunctional DNA primase/polymerase [Streptomyces sp. C]
          Length = 347

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 37/167 (22%), Gaps = 41/167 (24%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ-------SCCG--- 50
           ++          G  + CG     +   DVD    ++ +R                G   
Sbjct: 60  VIRDWWRQEPGFGVAVSCGPA--GLVVIDVDTHPAELPERGRLLPGIPIDDRVDLTGLRS 117

Query: 51  ---------------------KPISRVGQAPKTLMLFRMQETNLKKQKSEEKI-----QG 84
                                  +     +    + +R        + S           
Sbjct: 118 GYDTLALLAAVRRRPDPAQDTATLRVRTPSGGLHIWYRAPLGGPAIRSSTGTGSRTALAW 177

Query: 85  HLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVE 131
            ++  A G   VA           T+   P +     LPL    E+ 
Sbjct: 178 QVDVRATGGYIVAPGT---RTAHGTYEALPGSRTPAPLPLWLGAELA 221


>gi|187922194|ref|YP_001893836.1| Primase 2 [Burkholderia phytofirmans PsJN]
 gi|187713388|gb|ACD14612.1| Primase 2 [Burkholderia phytofirmans PsJN]
          Length = 637

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 24/70 (34%), Gaps = 6/70 (8%)

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
                    RA L+       +G +  W+ +  A+         G +I  EW +    Y 
Sbjct: 4   RYLSEEERARAALAMIP----SGDYATWVDMAFALKQGF--GEAGFDIWDEWSRTAHNYS 57

Query: 222 EKSFNAKWDS 231
           E++    W S
Sbjct: 58  ERAARVTWRS 67


>gi|330939433|gb|EGH42789.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 897

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 46/176 (26%), Gaps = 50/176 (28%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG---KPISRVGQAPKT 62
                 +  G++ G     V + DVD +       +               + VG   + 
Sbjct: 55  WTKNPNHNLGVVLGP--SRVCSLDVDDVQWTRFVLYELLGVDLDALALTFPTVVGNPLRF 112

Query: 63  LMLFRMQET--------NLKKQKSEEKIQGH----------------------------- 85
            +LF++ E         +   +   +  +                               
Sbjct: 113 RVLFQVPEGLELTRHSLSWPNENDPDGSKHKSIMLKANAARDAGDTAREALYRADAENYK 172

Query: 86  ----LEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEF 136
                E  A   Q V     HP T + YTW   P       LP+L  D +  +  +
Sbjct: 173 RFTVFELRAGLVQDVLPPSIHPGTGKPYTWRTPP---DASGLPILISDLLNVWNNW 225


>gi|119953768|ref|YP_950573.1| replication protein [Streptococcus phage SMP]
 gi|118430580|gb|ABK91904.1| replication protein [Streptococcus phage SMP]
          Length = 275

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/115 (9%), Positives = 32/115 (27%), Gaps = 14/115 (12%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC---CGKPISRVGQAPKT 62
              Y  +   +         +  D+D+  +        +++          ++     K 
Sbjct: 46  WSQYPDSNIAVRT----DKFFVIDIDLHGKHNGYESLAKWEHLNLITPTLQAKTASGGKH 101

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSIAPH 115
           +  F+  + ++ +          ++  A       VA +  P     Y W +   
Sbjct: 102 IFYFKHPDVSMTQM---IGFLPGVDVKAHPNNYVVVAPSKTP--NGEYAWDLEKS 151


>gi|258509888|ref|YP_003172639.1| phage-related DNA replication protein [Lactobacillus rhamnosus GG]
 gi|257149815|emb|CAR88788.1| Phage-related protein, DNA replication [Lactobacillus rhamnosus GG]
 gi|259651150|dbj|BAI43312.1| hypothetical phage protein [Lactobacillus rhamnosus GG]
          Length = 275

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/140 (10%), Positives = 37/140 (26%), Gaps = 18/140 (12%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ-------SCCGKPISR 55
                 +     G+        V  FD+D+  +   +  +   +                
Sbjct: 46  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSGANGNDTLAKLSAEGRADQIPSTYIE 101

Query: 56  VGQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +    S+   +  L+++A G     +    +    Y   
Sbjct: 102 TTPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYIATG--VPVFPSIRENGM-YQPL 158

Query: 112 IAPHALKVEELPLLTPDEVE 131
                 K+  +P    DE++
Sbjct: 159 KGHKITKLAPVPQWLLDEIQ 178


>gi|301386003|ref|ZP_07234421.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv.
           tomato Max13]
          Length = 811

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 41/139 (29%), Gaps = 22/139 (15%)

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L+R      K+    E   G +      Q  +  +IHP T + YTW   P       LP+
Sbjct: 77  LYRADAEKYKRLTVFELRAGLV------QDVLPPSIHPGTGQPYTWRTPP---DASGLPV 127

Query: 125 LTPDEV-------------EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
           L  D +             E    +      P  K+K   K + +  +  +         
Sbjct: 128 LIGDLLNVWNNWDVFKRGAEAACPWLPKDAKPTAKQKPKPKRAPVAGNRPSVIDEFNNCH 187

Query: 172 AFLSCFGEEFYNGSHDEWI 190
                     Y     +W+
Sbjct: 188 DVEEILRSHGYTKRGGKWL 206


>gi|331019769|gb|EGH99825.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 897

 Score = 49.8 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 46/176 (26%), Gaps = 50/176 (28%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCG---KPISRVGQAPKT 62
                 +  G++ G     V + DVD +       +               + VG   + 
Sbjct: 55  WTKNPNHNLGVVLGP--SRVCSLDVDDVQWTRFVLYELLGVDLDALALTFPTVVGNPLRF 112

Query: 63  LMLFRMQET--------NLKKQKSEEKIQGH----------------------------- 85
            +LF++ E         +   +   +  +                               
Sbjct: 113 RVLFQVPEGLELTRHSLSWPNENDPDGSKHKSIMLKANAAREAGDTAREALYRADAEQYK 172

Query: 86  ----LEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEF 136
                E  A   Q V     HP T + YTW   P       LP+L  D +  +  +
Sbjct: 173 RFTVFELRAGLVQDVLPPSIHPGTGQPYTWRTPP---DASGLPVLIGDLLNVWNNW 225


>gi|170694124|ref|ZP_02885279.1| Primase 2 [Burkholderia graminis C4D1M]
 gi|170140864|gb|EDT09037.1| Primase  2 [Burkholderia graminis C4D1M]
          Length = 632

 Score = 49.4 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 21/71 (29%), Gaps = 6/71 (8%)

Query: 161 NNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY 220
                     RA L+    E Y      W+ +  A+         G  I  +W +    Y
Sbjct: 3   RRYLTEEERARAALATIPAEDYMT----WVDMAFALKQGF--GEAGFPIWDDWSRTAHNY 56

Query: 221 DEKSFNAKWDS 231
            E +    W S
Sbjct: 57  SESAARVTWRS 67


>gi|325003514|ref|ZP_08124626.1| hypothetical protein PseP1_32321 [Pseudonocardia sp. P1]
          Length = 310

 Score = 49.4 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/174 (9%), Positives = 38/174 (21%), Gaps = 34/174 (19%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV----- 56
           +          G  I CG     +   D+D   E       +   +  G  +        
Sbjct: 57  IRRWWSRTP-FGVAIACGP--SRLVVIDLDTGTE----PLPDWGGATTGWEVLTRAATAH 109

Query: 57  -----------GQAPKTLMLFRMQETNLKKQKSEEKI---QGHLEFLAYGQQFVAYNIHP 102
                        +    + +R  +    +             ++  A G   V      
Sbjct: 110 GHTITDTYTVATPSGGHHLYYRAPQGPELRNTQGGTGHSIGPLVDTRAGGGYIVGAG--- 166

Query: 103 KTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
            T R            + +LP    + +         +   + ++       + 
Sbjct: 167 -TTRPEGTYTVTCHRPIADLP----EWLTIMLTPPPPLLRDQPEQPLDLGPRQA 215


>gi|313159248|gb|EFR58617.1| VirE N-terminal domain protein [Alistipes sp. HGB5]
          Length = 314

 Score = 49.4 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 53/218 (24%), Gaps = 38/218 (17%)

Query: 24  PVYAFDVDVLDEQVVD--------RFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKK 75
                D+D  D  V               F S     +S  G      ++FR+   ++  
Sbjct: 99  GFICIDIDHKDNGVFGPEWFDKKRLVAKTFDSLLCASMSISG--NGLYLIFRIAHPDMHL 156

Query: 76  QKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFE 135
            + +  ++   E               KT              V  L   + D   Y   
Sbjct: 157 AQFDALVREIYE---------------KTG----LVADQGCCDVCRLRGASYDAYPYINP 197

Query: 136 FFDT---ITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPV 192
                  +   R      R   +             +IR              + +W  +
Sbjct: 198 HAKPYRGVLKERTARAKVRTAREKKLLDEKVYKLIQKIREEKKDI-----TDDYHDWYCI 252

Query: 193 VMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
             A+ +E  G  EG  +        + Y     + ++ 
Sbjct: 253 GCALAHEY-GKEEGLRLFHLVSMHSKKYYPTDCDEQFA 289


>gi|91784038|ref|YP_559244.1| putative DNA replication primase [Burkholderia xenovorans LB400]
 gi|91687992|gb|ABE31192.1| Putative DNA replication primase [Burkholderia xenovorans LB400]
          Length = 621

 Score = 49.4 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 183 NGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
              +  W+ +  A+ +      EG EI   W +    Y++++    W S
Sbjct: 21  ADDYATWVDMAFALKHGF--GDEGFEIWDAWSRTAANYNDRAARTTWRS 67


>gi|258538879|ref|YP_003173378.1| phage-related DNA replication protein [Lactobacillus rhamnosus Lc
           705]
 gi|257150555|emb|CAR89527.1| Phage-related protein, DNA replication [Lactobacillus rhamnosus Lc
           705]
          Length = 278

 Score = 49.4 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/140 (10%), Positives = 33/140 (23%), Gaps = 18/140 (12%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVD---VLDEQVVDRFNNEFQS----CCGKPISR 55
                 +     G+        V  FD+D     +    +                    
Sbjct: 49  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSEANGNESLAKLCADGRAGQIPSSYIE 104

Query: 56  VGQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +    S+   +  L+++A G     +    +    Y   
Sbjct: 105 TTPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYVATG--VPVFPSIRENGM-YQPL 161

Query: 112 IAPHALKVEELPLLTPDEVE 131
                 K+   P    DE++
Sbjct: 162 KGHKITKLAPAPQWLLDEIQ 181


>gi|325963608|ref|YP_004241514.1| DNA primase/polymerase-like protein [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323469695|gb|ADX73380.1| DNA primase/polymerase-like protein [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 310

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 27/108 (25%), Gaps = 18/108 (16%)

Query: 2   VATDVDHYVYNGFGILCGIGTH---------PVYAFDVDVLDEQVVDRFNNEFQSCCGKP 52
           VA           GI  G  +                    D +   +   +     G  
Sbjct: 60  VAAWWSRTPNANIGIPTGAPSGVVVVDVDVHG-------PHDGRAAFQRATDAGLVDGAG 112

Query: 53  ISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
           +          + F    T  ++Q+S +     ++F   G   +A   
Sbjct: 113 LLVRTPTGGAHVYF--PATPGREQRSWQAATAGVDFRGDGGYIIAPPS 158


>gi|167032204|ref|YP_001667435.1| bifunctional DNA primase/polymerase [Pseudomonas putida GB-1]
 gi|166858692|gb|ABY97099.1| Bifunctional DNA primase/polymerase [Pseudomonas putida GB-1]
          Length = 920

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 53/193 (27%), Gaps = 50/193 (25%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQAPKTLM 64
               +  G++ G     V + DVD ++   +                  + VG   +  +
Sbjct: 58  ANPSHNLGVVLGP--SRVCSLDVDDVEFTRLVLQQTHGIDVDALAESYPTSVGNPARFRI 115

Query: 65  LFRMQETN--------LKKQKSEEKIQGH------------------------------- 85
           +FR+ +             +   + I                                  
Sbjct: 116 MFRVPDGVELKRHALVWPNKNDPDGIIHKGLMAQVRAAVDAKDEAREAALRMAAEPFKKL 175

Query: 86  --LEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELP--LLTPDE-VEYFFEFFDT 139
              E  A   Q V     HP T + YTW  AP A  + +LP  LL   +  E F    + 
Sbjct: 176 TVFELRAGLVQDVLPPSIHPGTGKPYTWRKAPDANGLPDLPGELLAIWQGWEEFKPNGEA 235

Query: 140 ITTPRDKEKSYRK 152
           +   R +      
Sbjct: 236 LCPWRPQPAVPVS 248


>gi|320013061|gb|ADW07910.1| Bifunctional DNA primase/polymerase [Streptomyces flavogriseus ATCC
           33331]
          Length = 346

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 35/165 (21%), Gaps = 41/165 (24%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-----VLDEQ-------------------- 36
           V          G G+ CG     +   DVD     V D                      
Sbjct: 69  VEDWWSREPRAGVGVSCGPA--HLVVLDVDAHAAPVPDRNRLLPGIPIPEQVDLAGLASG 126

Query: 37  ------VVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQ-----GH 85
                 +         +     +     +    + +   E  ++ + S            
Sbjct: 127 FDTLALLAAYRKEANPAEDETTLRVRTPSGGLHIWYVNTEPAVRYRSSTGSSPRTALAWQ 186

Query: 86  LEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
           ++  A+G   VA             +          LP     E+
Sbjct: 187 VDVRAHGGYIVAPTTRTSAGAY---TPLGAVRDPAPLPAWLAAEL 228


>gi|327198749|emb|CCA61450.1| unnamed protein product [Diadromus pulchellus ascovirus 4a]
          Length = 849

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 28/96 (29%), Gaps = 7/96 (7%)

Query: 139 TITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHY 198
                     ++          N       +I   + C   E     +  W+ V M +  
Sbjct: 236 ENMPEAKANNAHLMNEPAAVHVNISDE---KIGNLVMCLKSER-AEDYGNWLKVGMILAS 291

Query: 199 ETRGSAEG---KEIVREWCKLGRTYDEKSFNAKWDS 231
             R   +    + +   + +    Y++    AK+DS
Sbjct: 292 LARSRKDAAYFRNLFHIFSRQSPKYNDVECEAKFDS 327


>gi|333024418|ref|ZP_08452482.1| hypothetical protein STTU_1922 [Streptomyces sp. Tu6071]
 gi|332744270|gb|EGJ74711.1| hypothetical protein STTU_1922 [Streptomyces sp. Tu6071]
          Length = 210

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 9/102 (8%), Positives = 23/102 (22%), Gaps = 8/102 (7%)

Query: 32  VLDEQVVDRFNNEFQSC---CGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEF 88
                         +          +    +  T + F        +  +   +   ++ 
Sbjct: 6   TEGPDGAAHLRALAEQHGQPVPSTRTVRTPSGGTHLYFPAPAAARLRN-TAGTLAPLVDT 64

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
            A+G   VA      T +      +     +  LP      +
Sbjct: 65  RAWGGYVVAPGSILPTGQY----ESVAPFALRPLPPWLRGLL 102


>gi|227495251|ref|ZP_03925567.1| conserved hypothetical protein [Actinomyces coleocanis DSM 15436]
 gi|226831703|gb|EEH64086.1| conserved hypothetical protein [Actinomyces coleocanis DSM 15436]
          Length = 737

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/268 (8%), Positives = 56/268 (20%), Gaps = 45/268 (16%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE--------------QVVDRFNNEFQS 47
           V    +     G  ++ G  +  +   +++   +               +   FN     
Sbjct: 68  VKAWFNSPNNLGVAVITGAVSGNLEMLEIEGAGKHNPNAEPKPAIPLNDIYTAFNARGAG 127

Query: 48  CCGK-------PISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGH---LEFLAYGQQFVA 97
                        S    +      +R+Q T + K             +E    G   + 
Sbjct: 128 ELFTKVFIGNEVWSEYTPSGGRHFYYRVQGTPVLKNTKLACNAEGEVVIETRGEGGYSIV 187

Query: 98  YNIHPKTQRAYT-----WSIAPH-ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYR 151
                +           W +          +P +  +E +              + +   
Sbjct: 188 APTPKECHNQPELITSGWELTSTSPTPWAHIPTVNAEEYQ-MIHKIMQSFNQMPEPEKTV 246

Query: 152 KLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPV----VMAIHYETRGSA--- 204
             + +             I              +   W  +        +Y+  G     
Sbjct: 247 APASV-----LMVGQQALIEDDRWIVRPGDDFNNKASWSEIIEPYGWQFNYQANGQEFWT 301

Query: 205 -EGKEIVREWCKLGRTYDEKSFNAKWDS 231
             GK++          Y        + S
Sbjct: 302 RPGKDVREGASATI-NYAGNGCLWVFSS 328


>gi|168697886|ref|ZP_02730163.1| hypothetical protein GobsU_00080 [Gemmata obscuriglobus UQM 2246]
          Length = 1454

 Score = 49.0 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 29/126 (23%), Gaps = 22/126 (17%)

Query: 7   DHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK-TLML 65
           +H+     G+  G  +  +   D+D  +  V                S  G+  + T  L
Sbjct: 58  EHFAGRNVGVKLGPNSAGLADVDLDCGEAAVA------GPHLLPATNSAFGRGGETTHRL 111

Query: 66  FRM---------------QETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTW 110
           + +                       +         E      Q V       +     W
Sbjct: 112 YAVTDRTAAFAKLLDPVRSGDRATIVELRWPEWDEAEGRFKHLQTVFPPSLHASGEGLEW 171

Query: 111 SIAPHA 116
           + A   
Sbjct: 172 ARAGEP 177


>gi|258539258|ref|YP_003173757.1| phage-related DNA replication protein [Lactobacillus rhamnosus Lc
           705]
 gi|257150934|emb|CAR89906.1| Phage-related protein, DNA replication [Lactobacillus rhamnosus Lc
           705]
          Length = 276

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/144 (9%), Positives = 36/144 (25%), Gaps = 21/144 (14%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE----FQSCCGKPISRV-- 56
                 +     G+        V  FD+D+  +   +              G+  S    
Sbjct: 47  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSGANGNETLAKLSADGRAGQIPSTYIE 102

Query: 57  -GQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +    S+   +  L+++A G     +    +        
Sbjct: 103 ATPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYIATG--VPVFPSIRENGMY---- 156

Query: 112 IAPHALKVEELPLLTPDEVEYFFE 135
                 K+ +L  +    ++    
Sbjct: 157 QPLKGHKITKLAPVPQWLLDEIQR 180


>gi|212712327|ref|ZP_03320455.1| hypothetical protein PROVALCAL_03415 [Providencia alcalifaciens DSM
           30120]
 gi|212685073|gb|EEB44601.1| hypothetical protein PROVALCAL_03415 [Providencia alcalifaciens DSM
           30120]
          Length = 752

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 33/104 (31%), Gaps = 2/104 (1%)

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
                    +          S   LS++    N   +T  +IR+ L          ++  
Sbjct: 198 LASELVLHSNAADISDFDVVSDDDLSRLVDLDNINSHTFDDIRSALWHPQVLRLAENYPT 257

Query: 189 WIPVV--MAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
           W+ +   +A    T    + K +  EW       DE++   KW 
Sbjct: 258 WVDMGNRLAWFKNTDYEDKAKSLWVEWSAKAEKGDEEAAINKWS 301


>gi|291297141|ref|YP_003508539.1| Bifunctional DNA primase/polymerase [Meiothermus ruber DSM 1279]
 gi|290472100|gb|ADD29519.1| Bifunctional DNA primase/polymerase [Meiothermus ruber DSM 1279]
          Length = 1002

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 34/107 (31%), Gaps = 6/107 (5%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
                   G GIL       V   D D    +V ++   E+      P  R  +     +
Sbjct: 50  WWQAVPTAGVGIL---PPEQVLVLDFDA--PEVWEQLRAEYPELATAPRQRSPR-GGVHV 103

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
             ++ ++ +    +  +    L+    G+ ++A          Y+W 
Sbjct: 104 FLKLPKSLIGSLTTTARKMPGLDLRGLGKAYLAAAPTELPNGGYSWE 150


>gi|189043238|ref|YP_001936177.1| gp86 [Mycobacterium phage Adjutor]
 gi|188090889|gb|ACD49671.1| gp86 [Mycobacterium phage Adjutor]
          Length = 983

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 43/171 (25%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDEQV----VDRFNNEFQS 47
           +A+ +    Y      +  G             +   DVD  +E        +     ++
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 48  CCGKPISRVGQAPK----TLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
             G        + +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYTSSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|206599705|ref|YP_002241584.1| gp86 [Mycobacterium phage Butterscotch]
 gi|206282887|gb|ACI06374.1| gp86 [Mycobacterium phage Butterscotch]
          Length = 983

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 43/171 (25%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDEQV----VDRFNNEFQS 47
           +A+ +    Y      +  G             +   DVD  +E        +     ++
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 48  CCGKPISRVGQAPK----TLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
             G        + +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYTSSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|206599794|ref|YP_002241983.1| gp90 [Mycobacterium phage Gumball]
 gi|206283008|gb|ACI06462.1| gp88 [Mycobacterium phage Gumball]
          Length = 977

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 43/171 (25%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDEQV----VDRFNNEFQS 47
           +A+ +    Y      +  G             +   DVD  +E        +     ++
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 48  CCGKPISRVGQAPK----TLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
             G        + +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYTSSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|109522857|ref|YP_655277.1| gp81 [Mycobacterium phage PBI1]
 gi|88910570|gb|ABD58497.1| gp81 [Mycobacterium phage PBI1]
          Length = 983

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 43/171 (25%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDEQV----VDRFNNEFQS 47
           +A+ +    Y      +  G             +   DVD  +E        +     ++
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 48  CCGKPISRVGQAPK----TLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
             G        + +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYTSSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|330970611|gb|EGH70677.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 823

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 40/139 (28%), Gaps = 22/139 (15%)

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L+R      K+    E   G +      Q  +  +IHP T + YTW   P       LP+
Sbjct: 89  LYRADAEQYKRFTVFELRAGLV------QDVLPPSIHPGTGQPYTWRTPP---DASGLPV 139

Query: 125 LTPDEV-------------EYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
           L  D +             E    +      P  K+K   K + +     +         
Sbjct: 140 LISDLLNVWNNWDVFKRGAEAACPWLPKDAKPTGKQKPKPKPALVGGRRPSVIDEFNNCH 199

Query: 172 AFLSCFGEEFYNGSHDEWI 190
                     Y     +W+
Sbjct: 200 DVEEILRSHGYTKRGGKWL 218


>gi|149022008|ref|ZP_01835970.1| phage protein [Streptococcus pneumoniae SP23-BS72]
 gi|147929852|gb|EDK80841.1| phage protein [Streptococcus pneumoniae SP23-BS72]
          Length = 273

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 10/114 (8%), Positives = 30/114 (26%), Gaps = 12/114 (10%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPISRVGQAPKT 62
            D Y      +         +  D+D   +        +++          ++     K 
Sbjct: 47  WDGYPNANIALKT----TNFFVIDIDKHGKSNGFESLKKWKHLNLIEPTLQAKTASGGKH 102

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPH 115
           L  F+ ++  + +          ++  A+     +         + Y W +   
Sbjct: 103 LFYFKREDEPITQM---IGFLPGVDIKAHENNYVLVAPSATDKGQ-YEWDLEKS 152


>gi|260664091|ref|ZP_05864944.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           SJ-7A-US]
 gi|260561977|gb|EEX27946.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           SJ-7A-US]
          Length = 261

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 11/135 (8%), Positives = 31/135 (22%), Gaps = 18/135 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD--VLDEQVVDRFNNEFQSC-CGKPISRVGQ 58
           +      Y +    +         +  DVD    +   ++   +          ++ +  
Sbjct: 42  IEAIWKRYPFAKIALKT----EQFFVVDVDRHHSEADGLESIKDLNHDEWFKDTLTEITA 97

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHAL 117
                  FR  +    +          ++  A+     V           Y W       
Sbjct: 98  HGGYHFYFRKPKNE--EITQNIGWLPGVDIKAHVNNYVVCAPS-----AGYKWLNHK--- 147

Query: 118 KVEELPLLTPDEVEY 132
            +++ P      +  
Sbjct: 148 PMKDAPEELIKAINK 162


>gi|321157016|emb|CBW39004.1| Putative phage bifunctional primase/polymerase protein
           [Streptococcus phage 040922]
          Length = 270

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 10/114 (8%), Positives = 30/114 (26%), Gaps = 12/114 (10%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPISRVGQAPKT 62
            D Y      +         +  D+D   +        +++          ++     K 
Sbjct: 44  WDGYPNANIALKT----TNFFVIDIDKHGKSNGFESLKKWKHLNLIEPTLQAKTASGGKH 99

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPH 115
           L  F+ ++  + +          ++  A+     +         + Y W +   
Sbjct: 100 LFYFKREDEPITQM---IGFLPGVDIKAHENNYVLVAPSATDKGQ-YEWDLEKS 149


>gi|239630758|ref|ZP_04673789.1| prophage Lp3 protein 7 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|239527041|gb|EEQ66042.1| prophage Lp3 protein 7 [Lactobacillus paracasei subsp. paracasei
           8700:2]
          Length = 275

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 38/181 (20%), Gaps = 29/181 (16%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVD-------VLDEQVVDRFNNEFQSCCGKPISR 55
                 +     G+        V  FD+D         +E +                  
Sbjct: 46  KKWWGEHPNYNIGLGL----DGVLVFDIDMGHKSEVNGNESLAKLSVEGRAGQIPSSYVE 101

Query: 56  VGQAPKTLMLFRMQETNLKKQKSE----EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
                   + F   +      +S+       +  L+++A G     +    +        
Sbjct: 102 TTPNGGLHIFFTYPKELKLTSRSDLFSNNGEKTGLDYIATG--VPVFPSIRENGMY---- 155

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
                 K+ +L       ++                      S +++          EI 
Sbjct: 156 QPLKGHKITKLAPAPQWLLDEIQ--------RVSHPNPGFGGSTVYRGKRWTGRLLDEIV 207

Query: 172 A 172
            
Sbjct: 208 N 208


>gi|125622912|ref|YP_001031395.1| phage DNA replication [Lactococcus lactis subsp. cremoris MG1363]
 gi|124491720|emb|CAL96639.1| phage dna replication [Lactococcus lactis subsp. cremoris MG1363]
 gi|300069650|gb|ADJ59050.1| phage DNA replication [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 264

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/242 (8%), Positives = 50/242 (20%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D     +     F+  +            + 
Sbjct: 44  VSAWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRAVFSRLWNEHSEAEILSTYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +     Q    ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKELFS-QPIVSELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                +    + L       +E            R + ++                 N  
Sbjct: 156 NTETNEPLTFDNLSDCPDWLLE---------MIQRPQARAKSMTGSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  +      +     +         +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIG----IDNNSCMDLLRTFNN--RTSPPLPDDELETIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|116696318|ref|YP_841894.1| putative helicase [Ralstonia eutropha H16]
 gi|113530817|emb|CAJ97164.1| putative helicase [Ralstonia eutropha H16]
          Length = 668

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 22/65 (33%), Gaps = 8/65 (12%)

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD-EKSFNAK 228
            R  LSC        S  EWI + MA            E    W +    Y  E+     
Sbjct: 11  ARDALSCLDAGC---SRGEWIRLGMAAKAAGLS----FEDFHLWSQNAPNYKGERDCLTA 63

Query: 229 WDSFD 233
           W+SFD
Sbjct: 64  WNSFD 68


>gi|15789518|ref|NP_279342.1| hypothetical protein VNG0215C [Halobacterium sp. NRC-1]
 gi|10579860|gb|AAG18822.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
          Length = 857

 Score = 48.2 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 34/90 (37%), Gaps = 7/90 (7%)

Query: 145 DKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSA 204
           +         K      +      +I   LS    +     +DEW+ +  A+H +    +
Sbjct: 199 EAPSLSSSTGKSGDYDGDEWLDKSDIEDALSHVNPDC---GYDEWLKLGFAVH-DWDSGS 254

Query: 205 EGKEIVREWCKLGRTYD---EKSFNAKWDS 231
            GK +  +W K G  +D   E++    WDS
Sbjct: 255 TGKRLFEQWSKGGSKWDNQAERNIQDIWDS 284


>gi|256851386|ref|ZP_05556775.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           27-2-CHN]
 gi|260660810|ref|ZP_05861725.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           115-3-CHN]
 gi|282933165|ref|ZP_06338552.1| phage protein [Lactobacillus jensenii 208-1]
 gi|256616448|gb|EEU21636.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           27-2-CHN]
 gi|260548532|gb|EEX24507.1| bifunctional DNA primase/polymerase [Lactobacillus jensenii
           115-3-CHN]
 gi|281302669|gb|EFA94884.1| phage protein [Lactobacillus jensenii 208-1]
          Length = 261

 Score = 48.2 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 11/135 (8%), Positives = 31/135 (22%), Gaps = 18/135 (13%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD--VLDEQVVDRFNNEFQSC-CGKPISRVGQ 58
           +      Y +    +         +  DVD    +   ++   +          ++ +  
Sbjct: 42  IEAIWKRYPFAKIALKT----EQFFVVDVDRHHSEADGLESIKDLNHDEWFKDTLTEITA 97

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHAL 117
                  FR  +    +          ++  A+     V           Y W       
Sbjct: 98  HGGYHFYFRKPKNE--EITQNIGWLPGVDIKAHVNNYVVCAPS-----AGYKWLNHK--- 147

Query: 118 KVEELPLLTPDEVEY 132
            +++ P      +  
Sbjct: 148 PMKDAPEELIKAINK 162


>gi|148990199|ref|ZP_01821430.1| phage protein [Streptococcus pneumoniae SP6-BS73]
 gi|147924466|gb|EDK75555.1| phage protein [Streptococcus pneumoniae SP6-BS73]
          Length = 270

 Score = 48.2 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/114 (8%), Positives = 30/114 (26%), Gaps = 12/114 (10%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPISRVGQAPKT 62
            D Y      +         +  D+D   +        +++          ++     K 
Sbjct: 44  WDGYPNANIALKT----TNFFVIDIDKHGKSNGFESLKKWKHLNLIEPTLQAKTASGGKH 99

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPH 115
           L  F+ ++  + +          ++  A+     +         + Y W +   
Sbjct: 100 LFYFKREDEPITQM---IGFLPGVDIKAHENNYVLVAPSATDKGQ-YEWDLEKS 149


>gi|167908939|ref|ZP_02496030.1| hypothetical protein Bpse112_00480 [Burkholderia pseudomallei 112]
          Length = 232

 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 17/39 (43%), Gaps = 2/39 (5%)

Query: 194 MAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           MA+  E     EG  +  EW +  + Y+ K     W SF
Sbjct: 1   MALKAEF--GEEGFTLWNEWSQGAQNYNGKDARDVWKSF 37


>gi|326407786|gb|ADZ64857.1| prophage protein [Lactococcus lactis subsp. lactis CV56]
          Length = 264

 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/242 (8%), Positives = 51/242 (21%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE--QVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D  +        F+  +            + 
Sbjct: 44  VSEWFDEIPNRNI--MINLRNSGLICIDLDQHENGQNGRAVFSRLWNEHSEGEILSTYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +     Q    ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKELFN-QPIVNELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                +    + L       +E            R +++    L             N  
Sbjct: 156 DTETNEPLTFDNLSDCPDWLLE---------MIQRPQKRQNPTLGSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  + +  +                 +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIGI-DNNHCMDLLRTFNT-----RTSPPLPDDELATIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|323140297|ref|ZP_08075240.1| hypothetical protein Met49242DRAFT_4628 [Methylocystis sp. ATCC
           49242]
 gi|322394447|gb|EFX97105.1| hypothetical protein Met49242DRAFT_4628 [Methylocystis sp. ATCC
           49242]
          Length = 201

 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/121 (9%), Positives = 27/121 (22%), Gaps = 19/121 (15%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT--LMLFRMQ 69
              G++ G  +  +   D+D  +      +         K  +  G+        L+   
Sbjct: 29  ANIGVVLGQNSSGLSDVDLDCPEAIAAAPY------FLPKTAAIFGRETARASHWLYYTN 82

Query: 70  ETNLKK----------QKSEEKIQGHLEFL-AYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
             ++             K        ++       Q V      ++     W        
Sbjct: 83  AASVNLPGNLAFDDPIAKEGGAKARLVDLRLGPKVQTVFPGSTHESGEPIAWEPGCDGEP 142

Query: 119 V 119
            
Sbjct: 143 A 143


>gi|330832274|ref|YP_004401099.1| replication protein [Streptococcus suis ST3]
 gi|329306497|gb|AEB80913.1| replication protein [Streptococcus suis ST3]
          Length = 275

 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/115 (10%), Positives = 32/115 (27%), Gaps = 14/115 (12%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC---CGKPISRVGQAPKT 62
              Y  +   +         +  D+D+  +         ++          ++     K 
Sbjct: 46  WSQYPDSNIAVRT----DKFFVIDIDLHGKHNGYESLANWEHLNLITPTLQAKTASGGKH 101

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSIAPH 115
           +  F+  + ++ +          ++  A       VA +  PK    Y W +   
Sbjct: 102 IFYFKHPDVSMTQM---IGFLPGVDVKAHPNNYVLVAPSKTPK--GEYAWDLEKS 151


>gi|227523363|ref|ZP_03953412.1| bifunctional DNA primase/polymerase [Lactobacillus hilgardii ATCC
           8290]
 gi|227089469|gb|EEI24781.1| bifunctional DNA primase/polymerase [Lactobacillus hilgardii ATCC
           8290]
          Length = 226

 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/169 (8%), Positives = 44/169 (26%), Gaps = 15/169 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVD----VLDEQVVDRFNNEFQSCCGKPISRVGQA 59
              D+      G+        +   D+D    +   +V+ ++  +  +   +   +    
Sbjct: 18  EWFDNDRQYNLGLRL--ADTGIVVVDIDHHTQIDGRKVLKQWQAKGMTLIPQYAEQ-TPH 74

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                 F+  +    K          +E      Q +         + Y         ++
Sbjct: 75  DGLHYFFKTNQKLPDKVIVPS-----IELKTK--QIMMAPSQLD-GKPYQTIKGTDLTRL 126

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI 168
             LP    + +        T+     K  + + L ++    +  +    
Sbjct: 127 SPLPAWLVNLLTSQQTAHKTLQHRLYKSWTGKLLDQLVTGTDQGQRNIY 175


>gi|307149666|ref|YP_003891036.1| hypothetical protein Cyan7822_6660 [Cyanothece sp. PCC 7822]
 gi|306986795|gb|ADN18671.1| hypothetical protein Cyan7822_6660 [Cyanothece sp. PCC 7822]
          Length = 1328

 Score = 47.5 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 65/223 (29%), Gaps = 28/223 (12%)

Query: 3   ATDVDHY---VYNGFGILCGIGTHPVYAFDVD-------VLDEQVVDRFNNEFQSCCGKP 52
           A D+  +     NG G L G   + V+  D+D          EQ          +     
Sbjct: 116 AIDLKKWFAHPDNGIGTLGGH--NGVHWIDLDLHQFPNQAECEQAFWSILERQPALQNTL 173

Query: 53  ISRVGQAPKTLMLFRMQE-TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
           +  + Q+    +  R+++          +      E L  G+  V       + + Y   
Sbjct: 174 LE-ITQSDGYRIGVRVKKNPGFTNFSLTQGGTHVGECLGEGRFTVLSPTIGPSGKPYRNL 232

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIR 171
             P         L+  DE+++ +      T+   +       S    S+N      +E  
Sbjct: 233 NLPDK-------LVEIDEIDFIYSTKKDNTSSLAESSPKLLFSPQSTSNNIPGSIPLE-- 283

Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWC 214
             L+  G +      D +       H  T    E       WC
Sbjct: 284 -MLAHNGVQQIINGVDLYDDRS---HSLTATIKELFG-WENWC 321


>gi|13541532|ref|NP_111220.1| hypothetical protein TVN0701 [Thermoplasma volcanium GSS1]
          Length = 180

 Score = 47.5 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 25/84 (29%), Gaps = 4/84 (4%)

Query: 43  NEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHP 102
              +   G P  R  +       FR  +    +  +++   G  EF    +  +      
Sbjct: 13  EWARERFGPPNVRSVR--GAHWYFRNTKNLPNE-SNKQTAVGIFEFHTTNKYALIPPSDH 69

Query: 103 KTQRAYTWSIA-PHALKVEELPLL 125
            +   Y W    P    + + P L
Sbjct: 70  PSGTKYEWEKPLPTIGDLPDAPDL 93


>gi|326692266|ref|ZP_08229271.1| prophage DNA replication protein [Leuconostoc argentinum KCTC 3773]
          Length = 203

 Score = 47.5 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/155 (8%), Positives = 32/155 (20%), Gaps = 16/155 (10%)

Query: 5   DVDHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEF------QSCCGKPISR 55
            +  +        GI        +   D+D  ++  +      F                
Sbjct: 46  WITQHPEYQNGNVGIDLSK--SNLVVVDIDQHEQNGMASILAWFKSHNVNPDTLQDTYVE 103

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
                     + +      K K        ++ L+      A ++       Y       
Sbjct: 104 QTPTGGLHAFYLIPSGQ-DKPKHVINAIKGVDVLSNTAVMTAPSVMKD--GEYR--QITP 158

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
             +++E P        Y             +  + 
Sbjct: 159 FDQIQEAPEWVYQLANYQGSTNTPSNQKTTRYSNK 193


>gi|325525457|gb|EGD03275.1| inner membrane protein [Burkholderia sp. TJI49]
          Length = 327

 Score = 47.5 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 2/39 (5%)

Query: 194 MAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           MA+  E     EG  +  EW +  + Y  K     W SF
Sbjct: 1   MALKAEF--GEEGFALWNEWSQGAQNYKGKDARDVWKSF 37


>gi|254555657|ref|YP_003062074.1| prophage Lp3 protein 7 [Lactobacillus plantarum JDM1]
 gi|254044584|gb|ACT61377.1| prophage Lp3 protein 7 [Lactobacillus plantarum JDM1]
          Length = 264

 Score = 47.5 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/136 (8%), Positives = 35/136 (25%), Gaps = 17/136 (12%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQ----SCCGKPISRVG 57
           + +    + Y    +         +  D+D       D F +             +S+  
Sbjct: 41  IQSYWRSHPYAQLALRT----TNFFVIDID-EHPGGADGFKSIADYPNPEYLRDTLSQAT 95

Query: 58  QAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
                 + +  ++    +Q+        ++        VA +   +  + Y W       
Sbjct: 96  AGGGRQLFYLKRDDCAIQQRIGWLPGVDIKAHVNNYVMVAPSE--RNGKLYQWENH---- 149

Query: 118 KVEELPLLTPDEVEYF 133
               +     + V+  
Sbjct: 150 --NPIVTAPRELVQAI 163


>gi|268319301|ref|YP_003292957.1| hypothetical protein FI9785_817 [Lactobacillus johnsonii FI9785]
 gi|262397676|emb|CAX66690.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 266

 Score = 47.5 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/153 (12%), Positives = 35/153 (22%), Gaps = 30/153 (19%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-----VLDEQVVDRFN--NEFQSCCGKPIS 54
           +      Y      +         +  DVD     V   + + + N    F+        
Sbjct: 43  IREIWKKYPLANIALKT----DKFFVIDVDRHGGEVDGMESIKKLNHDEWFED---TLTE 95

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSI 112
           R          F   +    K      I   ++  A       VA +      + Y W  
Sbjct: 96  R-TAHNGFHFFFTKPKDM--KISQNIGILPSVDLKAHENNYVVVAPSSLGD--KKYQW-- 148

Query: 113 APHALKVEELPL-LTPDEVEYFFEFFDTITTPR 144
                 +   P+   P  +    +       P 
Sbjct: 149 ------LNNAPMKAPPQGLLDLIKDKQKDMPPT 175


>gi|160941777|ref|ZP_02089104.1| hypothetical protein CLOBOL_06673 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435274|gb|EDP13041.1| hypothetical protein CLOBOL_06673 [Clostridium bolteae ATCC
           BAA-613]
          Length = 102

 Score = 47.1 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 6/56 (10%), Positives = 17/56 (30%), Gaps = 2/56 (3%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAF--DVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +            GI  G  +  +     D+D    +  +    ++++  G+    
Sbjct: 47  IDKWWMKNPNYNIGIATGQVSGGLIVIDLDIDKEKGKHGNETLRDWEAEQGQLPDT 102


>gi|170016447|ref|YP_001727366.1| prophage Lp3 protein 7-like protein [Leuconostoc citreum KM20]
 gi|169803304|gb|ACA81922.1| prophage Lp3 protein 7-like protein [Leuconostoc citreum KM20]
          Length = 256

 Score = 47.1 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/159 (9%), Positives = 35/159 (22%), Gaps = 18/159 (11%)

Query: 5   DVDHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE--FQSCCGKPI----SR 55
            ++ +        GI        +   D+D      +   +          + I      
Sbjct: 28  WINSHPEYQDRNVGIDLSR--SNLIVVDIDKHKHNGMKSISAWFKSHDINPETIQDTYVE 85

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
              +      + + E   K  +    +   ++ L      +        Q+ Y       
Sbjct: 86  RTASGGLHAFYLIPEGKTKPAEKVSAL-QGVDLLTNKHGVIVAPSV-INQQPYR-----A 138

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLS 154
               E +        +       T T    K   Y  + 
Sbjct: 139 ITPFETIQQAPEWVYQIANNRGSTNTPSNHKATRYSNID 177


>gi|284162058|ref|YP_003400681.1| Bifunctional DNA primase/polymerase [Archaeoglobus profundus DSM
           5631]
 gi|284012055|gb|ADB58008.1| Bifunctional DNA primase/polymerase [Archaeoglobus profundus DSM
           5631]
          Length = 309

 Score = 47.1 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 60/210 (28%), Gaps = 34/210 (16%)

Query: 13  GFGILCGIGTHPVYAFDVD-----VLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLF- 66
             GI+ G  +  +   DVD       + +   +      +        V      ++ F 
Sbjct: 67  NVGIVTGSLSK-ILRIDVDQPKILGWNPEPAIKKGGLAHTTSRGVALVVRSENPEVLAFS 125

Query: 67  -----RMQETNLKKQKSEEKIQ----GHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHA 116
                R +E +       E         LE L  G+QFVA    HP  +  Y W      
Sbjct: 126 KKLVKRKEEIDQSLLFYPEDAGKETVTILEILGDGRQFVAPPSIHPDKRTRYEWLTPLPN 185

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
              + L + + +E+              ++           KS  +      +    L  
Sbjct: 186 SPDQILTINSIEELYSLLLECCANKELINELFEDY---FKEKSRADTGEEGKKADDLL-- 240

Query: 177 FGEEFYNGSHDEWIPVVMAIHYETRGSAEG 206
                     ++W+ ++  + +      +G
Sbjct: 241 ----------EKWLEIL--LKHLDVADDKG 258


>gi|255928278|gb|ACU41895.1| gp58 [Mycobacterium phage Puhltonio]
          Length = 935

 Score = 47.1 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/209 (5%), Positives = 40/209 (19%), Gaps = 41/209 (19%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----FQSCCGKPISRVGQ 58
           + Y         +  G     +   D D   +                      +   G 
Sbjct: 127 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGIDDVPPPTVVTPGH 184

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  +              +     L   +  +  
Sbjct: 185 AGKDGDLADPSSWAHSDGGHFYFTVPDEIIPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 244

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                        +      + + P      ++   E         ++     +  ++ +
Sbjct: 245 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHRDSEAGELSE 297

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           + +       E   + +      +  +  
Sbjct: 298 AIDGW----AEATPWSAILEPLGWTPAPR 322


>gi|115298601|ref|YP_762453.1| 94.9 kDa DNA primase/Poxvirus D5 family [Spodoptera frugiperda
           ascovirus 1a]
 gi|114416868|emb|CAL44699.1| 94.9 kDa DNA primase/Poxvirus D5 family [Spodoptera frugiperda
           ascovirus 1a]
          Length = 826

 Score = 46.7 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/105 (14%), Positives = 32/105 (30%), Gaps = 9/105 (8%)

Query: 133 FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFL----SCFGEEFYNGSHDE 188
           F +   +  T R+++      S   +            RA+L    S    E  +   ++
Sbjct: 94  FVKGTPSNDTARNEQARSVCKSPGREVDTYGPEELKSFRAYLKKCISILNPER-SIDRNQ 152

Query: 189 WIPVVMAIHYETRGS----AEGKEIVREWCKLGRTYDEKSFNAKW 229
           W+ V  A+   ++       E       +      Y+ +     W
Sbjct: 153 WMRVYWALKDCSKRGLLEYDEAFVCFDNFSSQWTHYNPQEIRDMW 197


>gi|109522656|ref|YP_655468.1| gp89 [Mycobacterium phage PLot]
 gi|88910763|gb|ABD58688.1| gp89 [Mycobacterium phage PLot]
          Length = 983

 Score = 46.7 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 41/171 (23%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDE-----QVVDRFNNEFQ 46
           +A+ +    Y      +  G             +   DVD  +E     +   +      
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 47  SC--CGKPISRVGQAP-KTLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
                 K      +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYISSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|327309875|ref|YP_004336773.1| Bifunctional DNA primase/polymerase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326955210|gb|AEA28906.1| Bifunctional DNA primase/polymerase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 376

 Score = 46.7 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/156 (10%), Positives = 29/156 (18%), Gaps = 21/156 (13%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDE-----QVVDRFNNEFQSC-------CGKPISRVGQAP 60
             GI CG     +   D+D   E                              S +    
Sbjct: 119 NVGIACGP--SGIVVIDLDTSTEPLDGCGGATTGREVLDQLTARHGETLPDTYSTMTPTD 176

Query: 61  KTLMLFRMQETNLKKQKSEEKI---QGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHAL 117
              + +RM E    +             ++    G   V               +     
Sbjct: 177 GEHLYYRMPEGVELRNTHGGHGHSLGPLIDTRGGGGFIVGAGSIRPEGAY----MVAEHG 232

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKL 153
           ++ ELP      +            P          
Sbjct: 233 QIAELPDWLATLLTPPPPPEPRQGEPMALPTRRANA 268


>gi|300772203|ref|ZP_07082073.1| N- superfamily bifunctional DNA primase/polymerase
           [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760506|gb|EFK57332.1| N- superfamily bifunctional DNA primase/polymerase
           [Sphingobacterium spiritivorum ATCC 33861]
          Length = 859

 Score = 46.7 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/114 (7%), Positives = 35/114 (30%), Gaps = 26/114 (22%)

Query: 13  GFGILCGIGTHPVYAFDVD-----VLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
              ++ G  +  +   D+D      ++  V+      +             +    +++R
Sbjct: 69  AVAVVTGEVSGRLELIDIDSKYEPGIEALVLKDIEKLYPDLYPILRIHATPSGGRHIIYR 128

Query: 68  MQETNLK------------------KQKSEEKIQGHL---EFLAYGQQFVAYNI 100
           +++ +++                  ++K  +++   +   E    G  F+    
Sbjct: 129 IEDGDVEGNQKLAGREATEAELQDQRKKGRKRLSTQVNFLETRGEGGYFLYPPS 182


>gi|209808767|gb|ACI88730.1| gp88 [Mycobacterium phage Troll4]
          Length = 982

 Score = 46.7 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 41/171 (23%), Gaps = 43/171 (25%)

Query: 2   VATDVD--HYVYNGFGILCGIGTH--------PVYAFDVDVLDE-----QVVDRFNNEFQ 46
           +A+ +    Y      +  G             +   DVD  +E     +   +      
Sbjct: 56  IASWLRMPKYAQGNICLHLGPVETRGPDGERLELIGIDVDDYEEGGKVKEGGKQLAALEA 115

Query: 47  SC--CGKPISRVGQAP-KTLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVAYNIH 101
                 K      +     +  F +   +        K   H++ +        V  + H
Sbjct: 116 ELGPLPKTYISSSRTGVSGIRFFLVPAQH----AWMGKAAPHIDIVCKTYRYAIVFPSWH 171

Query: 102 P-----------KTQRAYTWSIAPHAL--------KVEELPLLTPDEVEYF 133
           P                Y W      L         V +LPLL    VE  
Sbjct: 172 PGEVDEETGKVITEGGQYKWRDPQGQLLDGLEDIPDVNDLPLLPDAWVERL 222


>gi|255928519|gb|ACU42134.1| gp57 [Mycobacterium phage UncleHowie]
          Length = 935

 Score = 46.7 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/209 (5%), Positives = 40/209 (19%), Gaps = 41/209 (19%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----FQSCCGKPISRVGQ 58
           + Y         +  G     +   D D   +                      +   G 
Sbjct: 127 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGIDDVPPPTVVTPGH 184

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  +              +     L   +  +  
Sbjct: 185 AGKDGDLADPSSWAHSDGGHFYFTVPDEIIPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 244

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                        +      + + P      ++   E         ++     +  ++ +
Sbjct: 245 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHRDSEDGELSE 297

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           + +       E   + +      +  +  
Sbjct: 298 AIDGW----AEATPWSAILEPLGWTPAPR 322


>gi|206600350|ref|YP_002241370.1| gp60 [Mycobacterium phage Chah]
 gi|206287438|gb|ACI12780.1| gp60 [Mycobacterium phage Chah]
 gi|282721541|gb|ADA83988.1| gp59 [Mycobacterium phage Scoot17C]
          Length = 935

 Score = 46.7 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/209 (6%), Positives = 40/209 (19%), Gaps = 41/209 (19%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----FQSCCGKPISRVGQ 58
           + Y         +  G     +   D D   +                      +   G 
Sbjct: 127 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGIDDVPPPTVVTPGH 184

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  L              +     L   +  +  
Sbjct: 185 AGKDGDLADPSSWAHSDGGHFYFTVPDEILPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 244

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                        +      + + P      ++   E         ++     +  ++ +
Sbjct: 245 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHRDSEAGELSE 297

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           + +       E   + +      +  +  
Sbjct: 298 AIDGW----AEATPWSAILEPLGWTPAPR 322


>gi|107027183|ref|YP_624694.1| hypothetical protein Bcen_4842 [Burkholderia cenocepacia AU 1054]
 gi|105896557|gb|ABF79721.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
          Length = 615

 Score = 46.7 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 23/69 (33%), Gaps = 6/69 (8%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE 222
                  +R  L+    +     +  W+ +  A+ +       G E+   W +     D 
Sbjct: 5   YISEADRVRTALATIPAD----DYTTWVDMAFAVKHGL--GEAGFELWDAWSQTAPNCDA 58

Query: 223 KSFNAKWDS 231
           +S  A W S
Sbjct: 59  RSARATWRS 67


>gi|317969941|ref|ZP_07971331.1| hypothetical protein SCB02_10414 [Synechococcus sp. CB0205]
          Length = 287

 Score = 46.7 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 36/161 (22%), Gaps = 24/161 (14%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
              G+     +  ++A D D                     ISR G   +   L+R    
Sbjct: 40  TAIGLRT---SEALFALDFDGHSTHGYALACGIDPFALTWTISRTGNEWRLKQLWRTTPE 96

Query: 72  N----------LKKQKSEE---------KIQGHLEFLAYG-QQFVAYNIHPKTQRAYTWS 111
                       K               K    LE  A   +Q +    HP     Y W 
Sbjct: 97  QRAQLPYGPFSWKHVTQAALKDDNGKVLKKGEALEVFASSSRQVIVLGRHPD-GDDYYWR 155

Query: 112 IAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRK 152
                  +   P    + V               ++ S  +
Sbjct: 156 EGKGPEALAVAPDALWNWVLTMAAAAGERRPSERRQASTTR 196


>gi|38638462|ref|NP_943837.1| gp59 [Mycobacterium phage PG1]
 gi|109391905|ref|YP_655155.1| gp59 [Mycobacterium phage Orion]
 gi|33334077|gb|AAQ12136.1| gp59 [Mycobacterium phage PG1]
 gi|88910447|gb|ABD58375.1| gp59 [Mycobacterium phage Orion]
          Length = 915

 Score = 46.3 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/209 (6%), Positives = 40/209 (19%), Gaps = 41/209 (19%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----FQSCCGKPISRVGQ 58
           + Y         +  G     +   D D   +                      +   G 
Sbjct: 107 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGIDDVPPPTVVTPGH 164

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  L              +     L   +  +  
Sbjct: 165 AGKDGDLADPSSWAHSDGGHFYFTVPDEILPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 224

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                        +      + + P      ++   E         ++     +  ++ +
Sbjct: 225 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHRDSEAGELSE 277

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           + +       E   + +      +  +  
Sbjct: 278 AIDGW----AEATPWSAILEPLGWTPAPR 302


>gi|147919628|ref|YP_686631.1| phage-like protein [uncultured methanogenic archaeon RC-I]
 gi|110622027|emb|CAJ37305.1| hypothetical phage-like protein [uncultured methanogenic archaeon
           RC-I]
          Length = 867

 Score = 46.3 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/190 (10%), Positives = 43/190 (22%), Gaps = 27/190 (14%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV---GQAPKT 62
            + + Y   G++ G  +  +   D D     +     N       +         ++   
Sbjct: 102 WEKFPYALIGVMTGK-SGYIVW-DFDKKHGGLETY--NLMCQLYPELKESYIEETRSGGL 157

Query: 63  LMLFRMQE---------------TNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRA 107
            + F   +                  K  K  +K    ++  A G   VA          
Sbjct: 158 HVYFTCGDLTVKKGVDIFMKKLADGKKVPKWADKNWPGVDICANGSIAVAAPSVDVKGEY 217

Query: 108 YTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTN 167
                  +   ++ +     D +       D     + +           +   NR Y  
Sbjct: 218 ----KVLNNKPIQPISQGLIDLLRLTGRVMDAEAFEKAEADPAYS-KVEAQPIPNRYYKE 272

Query: 168 IEIRAFLSCF 177
                 +   
Sbjct: 273 QFAPICIKGI 282


>gi|293369975|ref|ZP_06616542.1| VirE N-terminal domain protein [Bacteroides ovatus SD CMC 3f]
 gi|292634893|gb|EFF53415.1| VirE N-terminal domain protein [Bacteroides ovatus SD CMC 3f]
          Length = 325

 Score = 46.3 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 65/239 (27%), Gaps = 37/239 (15%)

Query: 20  IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS------RVGQA----------PKTL 63
           I    +   D+D  D   +       +     P          G+            K  
Sbjct: 75  IRPSNLICIDIDGKDNPSISDMEKFKKRLAELPYVMYCGLSASGKGAFCIIPYDDFGKHK 134

Query: 64  MLF----RMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQ---RAYTWSIAPHA 116
           + F    R  +       S       L F +       Y+ HP        YT ++    
Sbjct: 135 LYFNALQREFKEMEIIIDSSCSDICRLRFYS-------YDEHPYVNWDAEVYTHTMEKTN 187

Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSC 176
           +   +   +            +        E++  + S +  +         E    L+ 
Sbjct: 188 IAHLKSKEVFSKRSSDIQISNE-NPRALSIEEALLQPSNLDFASATPLSKTEEAERLLNL 246

Query: 177 FGEEFYNGSH--DEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
             E   + +   ++WI + + I        +G ++  +       Y ++   +K+  F+
Sbjct: 247 VIERQIDITPIFNDWIKIGLVIKNLF--GDKGLDLFLKVSSFHPKYSQEEAESKY--FE 301


>gi|109521897|ref|YP_655334.1| gp57 [Mycobacterium phage Pipefish]
 gi|88910628|gb|ABD58554.1| gp57 [Mycobacterium phage Pipefish]
          Length = 871

 Score = 46.3 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/209 (7%), Positives = 44/209 (21%), Gaps = 33/209 (15%)

Query: 1   MVATDVDHY-----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +V   +D Y           +   +G   +   D D  ++       ++  +     +  
Sbjct: 96  VVLKYLDRYIKVHGPDVPVNLAIEVGASRLVVVDCDTPEQYAKFLEVSKAPAGTPATVMT 155

Query: 56  VGQAPKT--------------LMLFRMQET---NLKKQKSEEKIQGHLEFLAYGQQFVAY 98
            GQ  K                  F + E               +     L   +  +  
Sbjct: 156 PGQVGKGDSDDPDTWTHRDGGHFYFTLPEGVELPDSIGALTWGGEDGFAVLWNRRYVLIP 215

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                    Y  +   +         +    +E   +  +       ++++         
Sbjct: 216 PSTRPEGA-YELTGRDY--------EIPGWLLEKIVDAGNRRAERMAEQRTR--SGDDED 264

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
              +      E   + +      +     
Sbjct: 265 DLASAIDEWAETVPWSAILEPLGWTPHPR 293


>gi|282721437|gb|ADA83885.1| gp59 [Mycobacterium phage Fang]
          Length = 935

 Score = 46.3 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/220 (7%), Positives = 35/220 (15%), Gaps = 44/220 (20%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE-----FQSCCGKPISRVGQ 58
           + Y         +  G     +   D D   +                      +   G 
Sbjct: 127 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGIDDVPPPTVVTPGH 184

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  L              +     L   +  +  
Sbjct: 185 AGKDGDLADQSSWAHSDGGHFYFTVPDEILPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 244

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTP-----RDKEKSYRKL 153
                        +      + + P      ++   E              D E      
Sbjct: 245 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHHDGEDGELSE 297

Query: 154 SKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV 193
           +    +        +E   +               W    
Sbjct: 298 AIDGWAEATPWSAILEPLGWTPA--PRADACGCPVWTAPG 335


>gi|312891663|ref|ZP_07751173.1| Bifunctional DNA primase/polymerase [Mucilaginibacter paludis DSM
           18603]
 gi|311295847|gb|EFQ73006.1| Bifunctional DNA primase/polymerase [Mucilaginibacter paludis DSM
           18603]
          Length = 827

 Score = 46.3 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/190 (13%), Positives = 56/190 (29%), Gaps = 40/190 (21%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVDVL-----DEQVVDRFNNEFQSCCGKPISRVGQAP 60
           ++ Y  +   I+CG  +  +   DVDV      D  +++   N +     +       + 
Sbjct: 49  IEFYGTSSLAIICGKVSGNIEVIDVDVKYKPGIDAILMNDIRNFYPDLFSRLRIHKTPSG 108

Query: 61  KTLMLFRM---------------------QETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
              +++R+                     +    K  K   K    LE    G   ++  
Sbjct: 109 GFHIIYRVGGHEVPGNLKLAGRPTLEAEIELQKAKGVKRPNKEVNFLETRGEGGYILS-- 166

Query: 100 IHPKTQRAYTWSIAPHALKVEELPLLTPDE---VEYFFEFFDTITTPRDKEKSYRKLSKI 156
                             K   +P++T +E   +    + ++ I     K K  +    I
Sbjct: 167 ---------DLCNGYTLHKDNPIPVITWEERCSLITLCQTYNEIIKEAPKPKPNKSQESI 217

Query: 157 WKSHNNRRYT 166
           +  +    Y 
Sbjct: 218 YDENPFEHYN 227


>gi|255927580|gb|ACU41202.1| gp56 [Mycobacterium phage Colbert]
          Length = 950

 Score = 46.3 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/209 (6%), Positives = 41/209 (19%), Gaps = 41/209 (19%)

Query: 7   DHYVYN---GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC-----CGKPISRVGQ 58
           + Y         +  G     +   D D   +          +           +   G 
Sbjct: 142 ERYPEGVPVNVAVEVG--GSALVVVDCDTAAQLQRFYEAALPEDIGPDDVPPPTVVTPGH 199

Query: 59  APK---------------TLMLFRMQETNLKKQKS-----EEKIQGHLEFLAYGQQFVAY 98
           A K                   F + +  L              +     L   +  +  
Sbjct: 200 AGKDGDLADQSSWAHSDGGHFYFTVPDEILPTLPRNLGAMTWGGEDGFAVLWDKRYVLIP 259

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                        +      + + P      ++   E         ++     +  ++ +
Sbjct: 260 PSTRPEGAY---EVVGRDYPITDAP----WLLDAIREAAARRAERTERAHRDSEDGELSE 312

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
           + +       E   + +      +  +  
Sbjct: 313 AIDGW----AEATPWSAILEPLGWTPAPR 337


>gi|194303249|ref|YP_002014663.1| gp52 [Mycobacterium phage Phaedrus]
 gi|194150981|gb|ACF34016.1| gp52 [Mycobacterium phage Phaedrus]
          Length = 868

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/209 (6%), Positives = 44/209 (21%), Gaps = 33/209 (15%)

Query: 1   MVATDVDHY-----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +V   +D Y           +   +G   +   D D  ++       ++  +     +  
Sbjct: 93  VVLKYLDRYIEVHGPDVPVNLAIEVGASRLVVVDCDTPEQYAKFLEVSKAPAGTPATVMT 152

Query: 56  VGQAPKT--------------LMLFRMQET---NLKKQKSEEKIQGHLEFLAYGQQFVAY 98
            GQ  K                  F + E               +     L   +  +  
Sbjct: 153 PGQVGKGDSDDPDTWTHRDGGHFYFTLPEGVELPDSIGALTWGGEDGFAVLWNRRYVLIP 212

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                    Y  +   +         +    ++   +  +       ++++         
Sbjct: 213 PSTRPEGA-YELTGRDY--------EIPGWLLDKIVDAGNRRAERMAEQRTR--SGDDED 261

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
              +      E   + +      +     
Sbjct: 262 DLASAIDEWAETVPWSAILEPLGWTPHPR 290


>gi|313158753|gb|EFR58140.1| VirE N-terminal domain protein [Alistipes sp. HGB5]
          Length = 310

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/216 (9%), Positives = 58/216 (26%), Gaps = 29/216 (13%)

Query: 24  PVYAFDVDVLDE---QVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEE 80
            +   D+D  D    +  DR  ++            G++      + +           +
Sbjct: 79  GLICMDIDRKDNLQVEGYDRLKDQLGRLPYVAFC--GRSVGGEGYYAI-------VPIAQ 129

Query: 81  KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE---LPLLTPDEVEYFFEFF 137
             +  L F +   +F A  I          +I P    +     +       +    E +
Sbjct: 130 PNKLLLHFRSLQTKFSAMGI----------TIDPSCCDISRKRFVSYDPEPYINQEAEIY 179

Query: 138 DTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYN--GSHDEWIPVVMA 195
           + +             +      ++      E+  ++    ++  +    +  W+ +  A
Sbjct: 180 EGLGLADGAAVPDITGNATLPGTDSEDEPLKEVLKYIQIIEQKKVDITAGYANWLRIGYA 239

Query: 196 IHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
           +H        G+E+          Y     +  +  
Sbjct: 240 LHNAF--GDFGRELFHRVSSFHPRYSYVETDRLFSG 273


>gi|331700426|ref|YP_004397385.1| bifunctional DNA primase/polymerase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329127769|gb|AEB72322.1| Bifunctional DNA primase/polymerase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 254

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 12/126 (9%), Positives = 32/126 (25%), Gaps = 15/126 (11%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVD----VLDEQVVDRFNNEFQSCCGKPISRVGQA 59
              D+      G+        +   D+D    +   +V+ ++  +  +   +   +    
Sbjct: 46  EWFDNDRQYNLGLRL--ADTGIVVVDIDHHTQIDGRKVLKQWQTKGMTLIPQYAEQ-TPH 102

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
                 F+  +    K          +E      Q +         + Y          +
Sbjct: 103 DGLHYFFKTNQKLPDKVIVPS-----IELKTK--QIMIAPSQLD-GKPYQTIKGTDLTHL 154

Query: 120 EELPLL 125
             LP+ 
Sbjct: 155 SPLPVW 160


>gi|183603143|ref|ZP_02712937.2| replication protein [Streptococcus pneumoniae SP195]
 gi|183572617|gb|EDT93145.1| replication protein [Streptococcus pneumoniae SP195]
 gi|332072389|gb|EGI82872.1| primase family protein [Streptococcus pneumoniae GA17570]
          Length = 273

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 31/115 (26%), Gaps = 14/115 (12%)

Query: 6   VDHYVYNGFGI-LCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPISRVGQAPK 61
            D Y      + +        +  D+D   +        +++          ++     K
Sbjct: 47  WDGYPNANIALKIT-----NFFVIDIDKHGKSNGFESLKKWKHLNLIEPTLQAKTASGGK 101

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPH 115
            L  F+ ++  + +          ++  A+     +         + Y W +   
Sbjct: 102 HLFYFKREDEPITQM---IGFLPGVDIKAHENNYVLVAPSATDKGQ-YEWDLEKS 152


>gi|320013131|gb|ADW07979.1| Bifunctional DNA primase/polymerase [Streptomyces flavogriseus ATCC
           33331]
          Length = 370

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/211 (10%), Positives = 51/211 (24%), Gaps = 41/211 (19%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-------VLDEQVVDRFNNEFQSCCG---- 50
           +          G G+ CG     +   D+D         D  +     ++  +  G    
Sbjct: 88  IDRWWGQNPQFGIGVACGPA--GLVVVDIDAHATKSPGRDRILPGIPISDQVNLAGLTNG 145

Query: 51  --------------------KPISRVGQAPKTLMLFRMQETNL----KKQKSEEKIQGHL 86
                                 +     +    + +R+ ++              +   +
Sbjct: 146 FHTIAVLAALRDMPSPADDASTLRVRTPSGGLHVWYRVGDSRSWQCSSGSSPGRALAWQV 205

Query: 87  EFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDK 146
           +  A G   VA             +      +   LP     E+E           P  +
Sbjct: 206 DVRANGGYIVAPGTTTAAGTY---TPLGSVRRPAVLPDWLAQELER-TGHLPAFDVPAPR 261

Query: 147 EKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
               R    +  +   R +T+  + + L+  
Sbjct: 262 AVPPRAQQAVIAAGGGRNHTHNILASVLAPV 292


>gi|323138608|ref|ZP_08073675.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
 gi|322396096|gb|EFX98630.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
          Length = 721

 Score = 45.9 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 29/121 (23%), Gaps = 18/121 (14%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVD-RFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
              G+  G  +  +   D+D  +       F  +  +  G+  +R      +  L+    
Sbjct: 74  CNIGVALGEVSGGLVDVDLDCREAIAAAPYFLQKTAAIFGRETAR-----ASHWLYYTNS 128

Query: 71  TNLKK----------QKSEEKIQGHLEFL-AYGQQFVAYNI-HPKTQRAYTWSIAPHALK 118
            ++             K        ++       Q V     H  T     W        
Sbjct: 129 ASVNLSANVYFDDPIAKERGAKARLVDLRLGPKVQTVFPGSAHEDTSEPIAWEPGCDGEP 188

Query: 119 V 119
            
Sbjct: 189 A 189


>gi|29566247|ref|NP_817815.1| gp54 [Mycobacterium phage Rosebush]
 gi|29424972|gb|AAN01896.1| gp54 [Mycobacterium phage Rosebush]
          Length = 920

 Score = 45.9 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/174 (8%), Positives = 35/174 (20%), Gaps = 21/174 (12%)

Query: 25  VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--------APKTLMLFRMQET---NL 73
           +   D D   +       ++  +     +   GQ        +      FR+ +      
Sbjct: 147 LVVVDCDTKAQLDRFLAWSQAPATLPPTVRTPGQIVDGVPVHSDGGHFYFRVPDGVELPS 206

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYF 133
                          L   +  +                       E +P L  +     
Sbjct: 207 NLGAITMSGDDGFAILWNRRYVLIPPSSRPEG-----PYVMAGEDYELIPALLEE----- 256

Query: 134 FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
                 +   R  E   R   ++  + +       E   +        +  +  
Sbjct: 257 ITRAGALRAERAAEFERRAAERVPGALDTVIAEWAESTPWSVLLEPLGWTPASR 310


>gi|257793137|ref|YP_003186534.1| phage/plasmid primase, P4 family [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479829|gb|ACV60145.1| phage/plasmid primase, P4 family [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 1061

 Score = 45.6 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/201 (10%), Positives = 45/201 (22%), Gaps = 23/201 (11%)

Query: 49  CGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-------- 100
               + + G      + +R          +  +I   L  L      VA           
Sbjct: 192 FPSAVVQSGGGRGRHVYYRF--KRSADVATVRRIAAKLAVLLGSDASVAEPARIMRLPGS 249

Query: 101 -HPKTQR--AYTWSIAPHA--LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSK 155
            H K+ +     W         +   +     +  +      D         +       
Sbjct: 250 MHTKSGQIVQVAWVERRDEARYEPTAIETAIEEVAKALGIDLDAPEPTSPSNREESMGDW 309

Query: 156 IWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCK 215
                +  +     I      +  E    S   W  +   +      S+    +  EW +
Sbjct: 310 APVPLDFVKEQLPTICPRFEAYVREPNMVSEPVWYRMGCVLKALNPASS---SLFHEWSQ 366

Query: 216 L-----GRTYDEKSFNAKWDS 231
                 G+ Y+      K+  
Sbjct: 367 AYDAGPGKRYNWSEAEKKFRG 387


>gi|148993435|ref|ZP_01822952.1| phage protein [Streptococcus pneumoniae SP9-BS68]
 gi|147927990|gb|EDK79010.1| phage protein [Streptococcus pneumoniae SP9-BS68]
          Length = 270

 Score = 45.6 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 31/115 (26%), Gaps = 14/115 (12%)

Query: 6   VDHYVYNGFGI-LCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCC---GKPISRVGQAPK 61
            D Y      + +        +  D+D   +        +++          ++     K
Sbjct: 44  WDGYPNANIALKIT-----NFFVIDIDKHGKSNGFESLKKWKHLNLIEPTLQAKTASGGK 98

Query: 62  TLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPH 115
            L  F+ ++  + +          ++  A+     +         + Y W +   
Sbjct: 99  HLFYFKREDEPITQM---IGFLPGVDIKAHENNYVLVAPSATDKGQ-YEWDLEKS 149


>gi|222435726|ref|YP_002564154.1| gp56 [Mycobacterium phage Phlyer]
 gi|222088279|gb|ACM42220.1| gp56 [Mycobacterium phage Phlyer]
          Length = 867

 Score = 45.6 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/209 (7%), Positives = 44/209 (21%), Gaps = 33/209 (15%)

Query: 1   MVATDVDHY-----VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR 55
           +V   +D Y           +   +G   +   D D  ++       ++  +     +  
Sbjct: 93  VVLKYLDRYIEVHGPDVPVNLAIEVGASRLVVVDCDTPEQYAKFLEVSKAPAGTPATVMT 152

Query: 56  VGQAPKT--------------LMLFRMQET---NLKKQKSEEKIQGHLEFLAYGQQFVAY 98
            GQ  K                  F + E               +     L   +  +  
Sbjct: 153 PGQVGKGDSDDPDTWTHRDGGHFYFTLPEGVELPDSIGALTWGGEDGFAVLWNRRYVLIP 212

Query: 99  NIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK 158
                    Y  +   +         +    +E   +  +       ++++         
Sbjct: 213 PSTRPEGA-YELTGRDY--------EIPGWLLETIVDAGNRRAERMAEQRTR--SGDDED 261

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
              +      E   + +      +     
Sbjct: 262 DLASAIDEWAETVPWSAILEPLGWTPHPR 290


>gi|320166048|gb|EFW42947.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
          Length = 766

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/107 (14%), Positives = 39/107 (36%), Gaps = 5/107 (4%)

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
           TP + +            R ++++ R++++  +      +   E    +   G E Y   
Sbjct: 214 TPLQSDTIDALTAEAAEKRAQQRAARQIARGSERQLKHWFEEAE-EILMDHLGPE-YYND 271

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           + +W  V+  I      +AE  ++ + +       +      K+D F
Sbjct: 272 YQKWFNVLAVIKTVFGDTAEAYDLCKRFSAQAGNKEWDE---KFDGF 315


>gi|191637875|ref|YP_001987041.1| Orf271 gp (Gp271) [Lactobacillus casei BL23]
 gi|190712177|emb|CAQ66183.1| Orf271 gp (Gp271) [Lactobacillus casei BL23]
 gi|327381944|gb|AEA53420.1| Phage protein [Lactobacillus casei LC2W]
 gi|327385104|gb|AEA56578.1| Phage protein [Lactobacillus casei BD-II]
          Length = 265

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/156 (9%), Positives = 40/156 (25%), Gaps = 15/156 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ--SCCGKPISRVGQ 58
           +      +      +         +  D+D   D        N F+        +S+   
Sbjct: 41  IKRFWTTHPQAQIALRTVHH----FVVDIDQHDDGADGFLSFNTFEHPEYFEDTLSQTTA 96

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSIAPHA 116
                + +   +    +          ++  A       VA +     +  Y W      
Sbjct: 97  GGGMQIFYLKPDG--VEIPQIIGWLPGVDIKAHTNNYTMVAPS--RTEKGQYKWDCKHSI 152

Query: 117 LKVEE--LPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
           ++  +  +  LT  +        + ++ P  K  + 
Sbjct: 153 VEASDGLIAELTKQKFTESRYQPEALSAPVKKSATA 188


>gi|163803932|ref|ZP_02197766.1| hypothetical protein 1103602000458_AND4_04253 [Vibrio sp. AND4]
 gi|159172269|gb|EDP57163.1| hypothetical protein AND4_04253 [Vibrio sp. AND4]
          Length = 80

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 166 TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSF 225
              E    L        +  + +W  +  A++ E       ++I  +W + G TYD++SF
Sbjct: 8   ELHEAEEALGYISP---DLPYIDWSKIGRALYSEY--GDAARDIFEDWSEAGSTYDKRSF 62

Query: 226 NAKWDSF 232
           N+ W +F
Sbjct: 63  NSWWKNF 69


>gi|222530720|ref|YP_002574609.1| hypothetical protein Athe_2776 [Caldicellulosiruptor bescii DSM
           6725]
 gi|222457567|gb|ACM61828.1| hypothetical protein Athe_2776 [Caldicellulosiruptor bescii DSM
           6725]
          Length = 718

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 47/144 (32%), Gaps = 19/144 (13%)

Query: 6   VDHY-VYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK--T 62
           ++++      G   G  +  +   D+D      +                + G+A K  +
Sbjct: 43  LEYWAQGYNIGGKMGEKSCWMVDIDIDHPAANKIVDL------YLPIDTLKFGRATKPLS 96

Query: 63  LMLFRMQETNLKKQ----KSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHAL 117
            +L+  +     K+     ++ +    +E  + GQQ +     HP T+    +       
Sbjct: 97  HLLYFSENCKSLKRDFKFSNQTEKTTIVEIRSTGQQTMIPPSIHPDTKEELRFV-----G 151

Query: 118 KVEELPLLTPDEVEYFFEFFDTIT 141
           +++E   +  D +          T
Sbjct: 152 ELKEPLKIEADLLTAAVNKIAAAT 175


>gi|323138104|ref|ZP_08073177.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
 gi|322396566|gb|EFX99094.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
          Length = 708

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 27/122 (22%), Gaps = 20/122 (16%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT--LMLFRMQ 69
              G++ G  +  +   D+D  +      +         K  +  G+        L+   
Sbjct: 74  ANIGVVLGQNSSGLSDVDLDCPEAIAAAPY------FLPKTAAIFGRETARASHWLYYTN 127

Query: 70  ETNLKK----------QKSEEKIQGHLEFL-AYGQQFVAYNI-HPKTQRAYTWSIAPHAL 117
             ++             K        ++       Q V     H  T     W       
Sbjct: 128 SASVNLSANVYFDDPIAKERGAKARIVDLRLGPKVQTVFPGSAHEDTSEPIAWEPGCDGE 187

Query: 118 KV 119
             
Sbjct: 188 PA 189


>gi|229551170|ref|ZP_04439895.1| bifunctional DNA primase/polymerase [Lactobacillus rhamnosus
           LMS2-1]
 gi|229315462|gb|EEN81435.1| bifunctional DNA primase/polymerase [Lactobacillus rhamnosus
           LMS2-1]
          Length = 278

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 37/140 (26%), Gaps = 18/140 (12%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDE---QVVDRFNNEFQS----CCGKPISR 55
                 +     G+        V  FD+DV  +      D                  + 
Sbjct: 49  KKWWGEHPNYNIGLGL----DGVLVFDIDVGHKSGTNGSDTLAKLCADGRAGQISSSYAE 104

Query: 56  VGQAPKTLMLFRMQETNLKKQK----SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWS 111
           +       + F   +      +    S+   +  L+++A G     +    +    Y   
Sbjct: 105 ISPNGGLHIFFTYPKELKLTSRSDLFSKNGEKTGLDYVATG--VPVFPSIRENG-IYQPL 161

Query: 112 IAPHALKVEELPLLTPDEVE 131
                 K+  +P    DE++
Sbjct: 162 RGRKITKLAPVPQWLLDEIQ 181


>gi|69245155|ref|ZP_00603279.1| prophage Lp4 protein 7, DNA replication [Enterococcus faecium DO]
 gi|257879626|ref|ZP_05659279.1| prophage Lp4 protein 7 [Enterococcus faecium 1,230,933]
 gi|257890293|ref|ZP_05669946.1| prophage Lp4 protein 7 [Enterococcus faecium 1,231,410]
 gi|260559711|ref|ZP_05831891.1| prophage Lp4 protein 7 [Enterococcus faecium C68]
 gi|293560113|ref|ZP_06676617.1| prophage Lp4 protein 7, DNA replication [Enterococcus faecium
           E1162]
 gi|314938177|ref|ZP_07845482.1| DNA primase/polymerase [Enterococcus faecium TX0133a04]
 gi|314943779|ref|ZP_07850514.1| DNA primase/polymerase [Enterococcus faecium TX0133C]
 gi|314951148|ref|ZP_07854206.1| DNA primase/polymerase [Enterococcus faecium TX0133A]
 gi|314994614|ref|ZP_07859874.1| DNA primase/polymerase [Enterococcus faecium TX0133B]
 gi|314995576|ref|ZP_07860670.1| DNA primase/polymerase [Enterococcus faecium TX0133a01]
 gi|68195998|gb|EAN10431.1| prophage Lp4 protein 7, DNA replication [Enterococcus faecium DO]
 gi|257813854|gb|EEV42612.1| prophage Lp4 protein 7 [Enterococcus faecium 1,230,933]
 gi|257826653|gb|EEV53279.1| prophage Lp4 protein 7 [Enterococcus faecium 1,231,410]
 gi|260074379|gb|EEW62701.1| prophage Lp4 protein 7 [Enterococcus faecium C68]
 gi|291605980|gb|EFF35410.1| prophage Lp4 protein 7, DNA replication [Enterococcus faecium
           E1162]
 gi|313590164|gb|EFR69009.1| DNA primase/polymerase [Enterococcus faecium TX0133a01]
 gi|313591019|gb|EFR69864.1| DNA primase/polymerase [Enterococcus faecium TX0133B]
 gi|313596627|gb|EFR75472.1| DNA primase/polymerase [Enterococcus faecium TX0133A]
 gi|313597503|gb|EFR76348.1| DNA primase/polymerase [Enterococcus faecium TX0133C]
 gi|313642524|gb|EFS07104.1| DNA primase/polymerase [Enterococcus faecium TX0133a04]
          Length = 282

 Score = 45.6 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 52/192 (27%), Gaps = 20/192 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD----VLDEQVVDRFNNEFQSCCGKPISRVG 57
           +            G++     H +   D+D      +     +             + + 
Sbjct: 45  INEWWTEDATRNIGLML--EDHQMVVVDLDQHSETRNGVENYKKLASMYDPFPSTYTEIT 102

Query: 58  QAPKTLMLFRMQETNLKKQKS-----------EEKIQGHLEFLAYGQQFVA-YNIHPKTQ 105
                   F++ +  + +Q++           + K    ++ +  G        I     
Sbjct: 103 PGKGIHFFFKIPDGVIIQQETGAFADIFGRDDKGKSLSGIDIITKGVPIAPTMIISRSVG 162

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK--SHNNR 163
           RAY          +   P    + +    +   T   P  K  + +KL  I +     +R
Sbjct: 163 RAYEPIENVSLNNIAPAPDWLVNLLLKKPQEIKTQYRPVAKTGTAKKLDMIVQGAGEGSR 222

Query: 164 RYTNIEIRAFLS 175
                ++  +L 
Sbjct: 223 NDHLTKLCGWLL 234


>gi|323139022|ref|ZP_08074081.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
 gi|322395682|gb|EFX98224.1| Bifunctional DNA primase/polymerase [Methylocystis sp. ATCC 49242]
          Length = 713

 Score = 45.2 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 27/122 (22%), Gaps = 20/122 (16%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT--LMLFRMQ 69
              G++ G  +  +   D+D  +      +         K  +  G+        L+   
Sbjct: 75  ANIGVVLGQNSSGLSDVDLDCPEAIAAAPY------FLPKTAAIFGRETARASHWLYYTN 128

Query: 70  ETNLKK----------QKSEEKIQGHLEFL-AYGQQFVAYNI-HPKTQRAYTWSIAPHAL 117
             ++             K        ++       Q V     H  T     W       
Sbjct: 129 SASVNLSANVYFDDPIAKERGAKARLVDLRLGPKVQTVFPGSAHEDTSEPIAWEPGCDGE 188

Query: 118 KV 119
             
Sbjct: 189 PA 190


>gi|257051194|ref|YP_003129027.1| hypothetical protein Huta_0105 [Halorhabdus utahensis DSM 12940]
 gi|256689957|gb|ACV10294.1| hypothetical protein Huta_0105 [Halorhabdus utahensis DSM 12940]
          Length = 382

 Score = 45.2 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 41/193 (21%), Gaps = 25/193 (12%)

Query: 3   ATDVDHYVYNGF-GILCG------------IGTHPVYAFDVDVLDEQVVDRFNNEFQSCC 49
           A ++          I  G             GT  +   D D +     +          
Sbjct: 23  AKELLRPPDEAVEAIRSGSRGFVLYAGRPEHGTEELVFTDHDDVGLWPPN-------ETP 75

Query: 50  GKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYT 109
              + R G        +R   + +     + ++ G  E  A     VA      +   Y 
Sbjct: 76  RTLLVRSGSGTGYHQTYRNSGS-VDNAHGKGELAGAGEIRAKNWYVVAPGSIHPSGGIYH 134

Query: 110 WSIAPHALKVEE---LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH-NNRRY 165
               P    + E    P L P                   +           +  N    
Sbjct: 135 QVQNPGIGTIREEHIPPELRPSNGASKGSSHGDPKPLEPDDIEDLGKDFDPDAVTNEWGA 194

Query: 166 TNIEIRAFLSCFG 178
           T  E R       
Sbjct: 195 TVQEARIVSKKLD 207


>gi|296170214|ref|ZP_06851807.1| gp54 protein [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295895090|gb|EFG74808.1| gp54 protein [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 890

 Score = 45.2 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/196 (8%), Positives = 37/196 (18%), Gaps = 24/196 (12%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP----------KT 62
              +  G     +   D D  ++      + E        +   G               
Sbjct: 159 NVAVSLGR--SRLVVVDCDTTEQLAAFLADAEADPDTAPTVRTPGMLGPDGVTLVHRDGG 216

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-----HPKTQRAYTWSIAPHAL 117
              F + +      +      G ++        V + +      P + R      A    
Sbjct: 217 HYYFAVPDG----VELPPGPPGAMKVGGDDGYSVMWGVGNYVLTPPSVRP-EGVYAATGE 271

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
            V ELP    + +      +                              +E   +    
Sbjct: 272 NVYELPDWLAETIAAHGRTYAEHARRSLARADTAAEPVARWGAAVPWAAILEPAGWTPVG 331

Query: 178 GEEFYNGSHDEWIPVV 193
             +        W    
Sbjct: 332 KADGC--GCPMWTAPG 345


>gi|281492873|ref|YP_003354853.1| phage bifunctional DNA primase/polymerase [Lactococcus lactis
           subsp. lactis KF147]
 gi|281376525|gb|ADA66011.1| Phage protein, bifunctional DNA primase/polymerase [Lactococcus
           lactis subsp. lactis KF147]
          Length = 264

 Score = 45.2 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/243 (7%), Positives = 54/243 (22%), Gaps = 38/243 (15%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPI 53
           +V+   D         +  +    +   D+D     +     F+  +            +
Sbjct: 43  IVSEWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRSVFSRLWNEHSEGEILSTYV 100

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWS 111
            +        + F++ +     Q    ++   +E   +        I+P   T   Y   
Sbjct: 101 EKTPTGNGLHVFFKVPKELFN-QPIVSELADGVEIKTH-----FTPIYPSKRTDGDYMPL 154

Query: 112 IAPHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI 168
                 +    + L       +E                    ++ +++     +   N 
Sbjct: 155 NDTETNEPLTFDSLCDCPDWLLEMIQRPQKRHNPTLGSRTYGAEMWELFNQGARKGNRNN 214

Query: 169 EIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAK 228
           +    L              W  +      +     +         +      +      
Sbjct: 215 DTNRIL------------HYWRKIG----IDNNSCMDLLRTFNN--RTSPPLPDDELATI 256

Query: 229 WDS 231
           W S
Sbjct: 257 WKS 259


>gi|72392575|ref|XP_847088.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|62175592|gb|AAX69725.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|70803118|gb|AAZ13022.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
 gi|261330271|emb|CBH13255.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 629

 Score = 45.2 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 22/85 (25%), Gaps = 12/85 (14%)

Query: 161 NNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVM-----------AIHYETRGSAEGKEI 209
              R        +L     E        WI + +           A+  +     E  + 
Sbjct: 500 RTEREAVENASRWLREGTREADVDEWRSWIRLGINAYRVAYHFRDAMTLQRPALEELLDA 559

Query: 210 VREWCKLGR-TYDEKSFNAKWDSFD 233
             E  K     +      A+W +FD
Sbjct: 560 WVEASKKCPAKFKPGVCEARWATFD 584


>gi|124378240|ref|YP_001029431.1| GfV-D3-ORF1 [Glypta fumiferanae ichnovirus]
 gi|124270647|dbj|BAF45568.1| GfV-D3-ORF1 [Glypta fumiferanae ichnovirus]
          Length = 493

 Score = 45.2 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 37/93 (39%), Gaps = 3/93 (3%)

Query: 143 PRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRG 202
                +   K  K+ ++  N  YT   ++A +    E  ++  +D W  V+ A++     
Sbjct: 125 NESNNEPPSKKMKMDENIGNLSYTKQSLKALVMDL-ESRHSEKYDLWRNVLWALNTCGLE 183

Query: 203 -SAEGKEIVREWCKLGRTY-DEKSFNAKWDSFD 233
              +  +I  E+ K    Y D +     ++S D
Sbjct: 184 NGYDTLDIANEFSKRSSKYKDFEDVKKTFESSD 216


>gi|109521835|ref|YP_655731.1| gp51 [Mycobacterium phage Qyrzula]
 gi|91980779|gb|ABE67497.1| gp51 [Mycobacterium phage Qyrzula]
          Length = 916

 Score = 45.2 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/174 (8%), Positives = 35/174 (20%), Gaps = 21/174 (12%)

Query: 25  VYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--------APKTLMLFRMQET---NL 73
           +   D D   +       ++  +     +   GQ        +      FR+ +      
Sbjct: 147 LVVVDCDTKAQLDRFLAWSQAPATLPPTVRTPGQIVDGVPVHSDGGHFYFRVPDGVELPS 206

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYF 133
                          L   +  +                       E +P L  +     
Sbjct: 207 NLGAITMSGDDGFAILWNRRYVLIPPSSRPEG-----PYVMAGEDYELIPALLEE----- 256

Query: 134 FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHD 187
                 +   R  E   R   ++  + +       E   +        +  +  
Sbjct: 257 ITRSGALRAERAAEFERRAAERVPGALDTVIAEWAESTPWSVLLEPLGWTPASR 310


>gi|329849611|ref|ZP_08264457.1| DNA primase/polymerase [Asticcacaulis biprosthecum C19]
 gi|328841522|gb|EGF91092.1| DNA primase/polymerase [Asticcacaulis biprosthecum C19]
          Length = 284

 Score = 44.8 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 55/205 (26%), Gaps = 22/205 (10%)

Query: 5   DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLM 64
            ++ +  +   +  G     +   +++  D  ++   N         P    G+      
Sbjct: 46  WLERHAGDNIALALGP-CAGIEVLNINTHDVSILSILNKV---LPKSPWKCFGRRG---- 97

Query: 65  LFRMQETNLKKQKS---EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHA--LKV 119
            F +       +     +   Q  +E  + G+  +           YT     +     +
Sbjct: 98  -FNIAFKFAGHRPGQLLDRDRQTVVEVQSSGRFLLLPPSVHPDGGIYTSRHNLYDSTKTL 156

Query: 120 EELPLLTPDEVE-YFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG 178
           + +P    D++E  F      I   R  +K+        +          +     S   
Sbjct: 157 KPMPKNVLDKLETAFQGAGLDIAQRRPAKKAMNGDYLAAQLKTFAAARATDFCNGRSSL- 215

Query: 179 EEFYNGSHDEWIPVVMAIHYETRGS 203
            +    + + W      +H+     
Sbjct: 216 ADALRLTCEWW------LHHTAEDD 234


>gi|21223967|ref|NP_629746.1| ATP binding protein [Streptomyces coelicolor A3(2)]
 gi|3192005|emb|CAA19404.1| putative ATP binding protein [Streptomyces coelicolor A3(2)]
          Length = 756

 Score = 44.8 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 15/132 (11%), Positives = 29/132 (21%), Gaps = 11/132 (8%)

Query: 27  AFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP--KTLMLFRMQETNLKKQKSEEKIQG 84
             DVD  +           +       +    +       ++R       K         
Sbjct: 88  VVDVDPKNGGTASLEKLTAEYELPVTRTHHTASGPDSLHFIYRADPDRPIKSGPLSSRYP 147

Query: 85  HLEFL-AYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTP 143
            ++     G   VA        R Y    A         P + P  +            P
Sbjct: 148 GIDIKTGRGSLIVAPGSV-INGRRYEVVSAAE-------PAVAPSWLSEIRGDAQYPVVP 199

Query: 144 RDKEKSYRKLSK 155
             + ++  + S 
Sbjct: 200 SARSRTPSRASA 211


>gi|257883931|ref|ZP_05663584.1| prophage Lp4 protein 7 [Enterococcus faecium 1,231,501]
 gi|257819769|gb|EEV46917.1| prophage Lp4 protein 7 [Enterococcus faecium 1,231,501]
          Length = 274

 Score = 44.8 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 53/192 (27%), Gaps = 20/192 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD----VLDEQVVDRFNNEFQSCCGKPISRVG 57
           +            G++     H +   D+D      +     +             + + 
Sbjct: 37  INEWWTEDATRNIGLML--EDHQMMVVDLDRHSETRNGVENYKKLASMYDPFPSTYTEIT 94

Query: 58  QAPKTLMLFRMQETNLKKQKS-----------EEKIQGHLEFLAYGQQFVAYNIHPKT-Q 105
                   F++ +  + +Q++           + K    ++ +  G       I   +  
Sbjct: 95  PGKGIHFFFKIPDGVIIQQETGAFADIFGRDDKGKSLSGIDIITKGVPIAPTMIISGSVG 154

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK--SHNNR 163
           RAY          +   P    + +    +   T   P  K  + +KL  I +     +R
Sbjct: 155 RAYEPIENVSLNNIAPAPDWLVNLLLKKTQEIKTQYRPVAKTGTAKKLDMIVQGAGEGSR 214

Query: 164 RYTNIEIRAFLS 175
                ++  +L 
Sbjct: 215 NDHLTKLCGWLL 226


>gi|315503064|ref|YP_004081951.1| bifunctional DNA primase/polymerase [Micromonospora sp. L5]
 gi|315409683|gb|ADU07800.1| Bifunctional DNA primase/polymerase [Micromonospora sp. L5]
          Length = 691

 Score = 44.8 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/145 (11%), Positives = 36/145 (24%), Gaps = 6/145 (4%)

Query: 33  LDEQVVDRFNNEFQSCCGKPISRVGQAPK-TLMLFRMQETNLKKQKSEEKIQGHLEFLAY 91
              + + +   E       P+S      K  +  FR+      +          L    +
Sbjct: 84  RGAETLGKLEAELGPLPVGPMSTARGYGKSGIRFFRVPAGFSTENLPNVGKDVDLIRHGW 143

Query: 92  GQQFVAYNIHPKTQRAYTW-----SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDK 146
               V  +I+PKT   Y W            +  + P L    + +        T    +
Sbjct: 144 RWARVWPSINPKTGTQYRWFGASGQTLSSPPRPTDFPELPEAWLAWLESRRAANTADATE 203

Query: 147 EKSYRKLSKIWKSHNNRRYTNIEIR 171
                  +    +       + +  
Sbjct: 204 LGEPEAFNVDAYTWLVELLADDQAA 228


>gi|258616764|ref|ZP_05714534.1| prophage Lp4 protein 7, DNA replication [Enterococcus faecium DO]
          Length = 241

 Score = 44.8 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 52/192 (27%), Gaps = 20/192 (10%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD----VLDEQVVDRFNNEFQSCCGKPISRVG 57
           +            G++     H +   D+D      +     +             + + 
Sbjct: 45  INEWWTEDATRNIGLML--EDHQMVVVDLDQHSETRNGVENYKKLASMYDPFPSTYTEIT 102

Query: 58  QAPKTLMLFRMQETNLKKQKS-----------EEKIQGHLEFLAYGQQFVA-YNIHPKTQ 105
                   F++ +  + +Q++           + K    ++ +  G        I     
Sbjct: 103 PGKGIHFFFKIPDGVIIQQETGAFADIFGRDDKGKSLSGIDIITKGVPIAPTMIISRSVG 162

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWK--SHNNR 163
           RAY          +   P    + +    +   T   P  K  + +KL  I +     +R
Sbjct: 163 RAYEPIENVSLNNIAPAPDWLVNLLLKKPQEIKTQYRPVAKTGTAKKLDMIVQGAGEGSR 222

Query: 164 RYTNIEIRAFLS 175
                ++  +L 
Sbjct: 223 NDHLTKLCGWLL 234


>gi|300361362|ref|ZP_07057539.1| phage protein [Lactobacillus gasseri JV-V03]
 gi|300353981|gb|EFJ69852.1| phage protein [Lactobacillus gasseri JV-V03]
          Length = 269

 Score = 44.4 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/153 (10%), Positives = 31/153 (20%), Gaps = 22/153 (14%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQSC--CGKPISRVGQ 58
           +      Y      +         +  DVD    E                   ++    
Sbjct: 43  IRKIWQKYPLANIALKT----DKFFVIDVDRHSGEVDGMESIKNLHHDEWFKDTLTEKTA 98

Query: 59  APKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQQFVAYNIHPKTQRAYTWSIAPHA 116
                  F   +    K      I   ++  A       VA +      + Y W      
Sbjct: 99  HDGFHFFFTKPKDM--KISQNIGILPSVDLKAHENNYVVVAPSSLGD--KKYRW------ 148

Query: 117 LKVEELPL-LTPDEVEYFFEFFDTITTPRDKEK 148
             +   P+   P  +    +       P    +
Sbjct: 149 --LNNAPMKAPPQGLLDLIKEKQKDIPPTKVAE 179


>gi|116512921|ref|YP_811828.1| hypothetical protein LACR_2259 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116108575|gb|ABJ73715.1| hypothetical protein LACR_2259 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 264

 Score = 44.4 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 22/242 (9%), Positives = 51/242 (21%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D     +     F+  +            + 
Sbjct: 44  VSAWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRTVFSRLWNEHSEGEILSTYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +     Q    ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKELFN-QPIVNELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                K    + L       +E            R + ++    S            N  
Sbjct: 156 DTETNKPLTFDSLCDCPDWLLE---------MIQRPQARATTGTSSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  +      +     +         +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIG----IDNNSCMDLLRTFNN--RTSPPLPDDELATIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|322827263|gb|EFZ31520.1| hypothetical protein TCSYLVIO_2169 [Trypanosoma cruzi]
          Length = 623

 Score = 44.4 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 22/73 (30%), Gaps = 12/73 (16%)

Query: 173 FLSCFGEEFYNGSHDEWIPVVM-----AIHYET------RGSAEGKEIVREWCKLGR-TY 220
           +L     E   G    WI + +     A H+            E  +   E  K     Y
Sbjct: 505 WLRTGTREVDVGDWRSWIKLGINTFRIAYHFRDAQTLRRPAMEELLDAWVEASKKCPMKY 564

Query: 221 DEKSFNAKWDSFD 233
                 AKW SFD
Sbjct: 565 RPGVCEAKWSSFD 577


>gi|218131557|ref|ZP_03460361.1| hypothetical protein BACEGG_03177 [Bacteroides eggerthii DSM 20697]
 gi|217986489|gb|EEC52826.1| hypothetical protein BACEGG_03177 [Bacteroides eggerthii DSM 20697]
          Length = 334

 Score = 44.4 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 22/227 (9%), Positives = 63/227 (27%), Gaps = 24/227 (10%)

Query: 24  PVYAFDVDVLDEQVVDRFNNEFQSCCGKPIS-------RVGQAPKTLMLFRMQETN---L 73
            +   D+D  D   +    +  +   G+            G     ++ +     +    
Sbjct: 87  NLICIDIDGKDNPSISNIEDL-KIKLGELPYIMYCGLSASGNGLFCIIPYADPTNHKNVF 145

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYF 133
           +  K++ +  G +   + G       +   T + Y        + + E      + +   
Sbjct: 146 ESIKNDFEEMGIIIDKSCGDICRLRFLSHDT-QPY--VNKHAEVYMSEPKSKAVEYIYKP 202

Query: 134 FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYT------NIEIRAFLSCFGEEFYNGS-- 185
            +   T             +    +  N    +        ++   LS       + +  
Sbjct: 203 KQRSKTKPPKPQTILIPSVIETFLRPSNLVLESATPLTKKQKVERLLSEITRNQVDITYY 262

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
           +++WI +   I        EG+ +  +       YD    + ++ + 
Sbjct: 263 YNDWIAIGNIIKNMF--GEEGRALFHKVSSFYPNYDYDETDREYSAM 307


>gi|240142756|ref|YP_002967269.1| hypothetical protein MexAM1_META2p1160 [Methylobacterium extorquens
           AM1]
 gi|240012703|gb|ACS43928.1| Hypothetical protein MexAM1_META2p1160 [Methylobacterium extorquens
           AM1]
          Length = 1370

 Score = 44.4 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 40/138 (28%), Gaps = 13/138 (9%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISR--VGQAPKTLMLFRM 68
                 +     + V+  DVDV +  + D      +   G P  R       K  +++  
Sbjct: 122 AQNVATVT-SAQNRVFVVDVDVQNVAITDAIIRLARRMLGVPFIREYTQSRGKASLIYST 180

Query: 69  QE-------TNLKKQKSEEKIQ--GHLEFLAYGQQFVAYNIHPKTQRAYTWSI-APHALK 118
                           S +       +E L+    F     H KT  ++ +    P   +
Sbjct: 181 DPANDPVALKRSYPVLSRDGKPTSQAVEILSNNAAFTILGRHWKTGSSFQYRGLHPLRDR 240

Query: 119 VEELPLLTPDEVEYFFEF 136
                 +T  ++  F E 
Sbjct: 241 PTAAASVTQTQLRAFLER 258


>gi|71651122|ref|XP_814245.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70879201|gb|EAN92394.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 623

 Score = 44.0 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 22/73 (30%), Gaps = 12/73 (16%)

Query: 173 FLSCFGEEFYNGSHDEWIPVVM-----AIHYET------RGSAEGKEIVREWCKLGR-TY 220
           +L     E   G    WI + +     A H+            E  +   E  K     Y
Sbjct: 505 WLRTGTREVDVGDWRSWIKLGINTFRIAYHFRDAQTLRRPAMEELLDAWVEASKKCPMKY 564

Query: 221 DEKSFNAKWDSFD 233
                 AKW SFD
Sbjct: 565 RPGVCEAKWSSFD 577


>gi|260063427|ref|YP_003196507.1| hypothetical protein RB2501_01425 [Robiginitalea biformata
           HTCC2501]
 gi|88782871|gb|EAR14045.1| hypothetical protein RB2501_01425 [Robiginitalea biformata
           HTCC2501]
          Length = 754

 Score = 44.0 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/211 (9%), Positives = 51/211 (24%), Gaps = 29/211 (13%)

Query: 23  HPVYAFDVDVLDEQVVDRFNNEFQSCCG-KPISRVGQAPKTLMLFRMQETNLKKQKSEEK 81
             +   D+D  D   +       +            +    +   ++      +      
Sbjct: 72  SGIIGIDLDAEDNADLLANRARLEQDPHCYACHTSIRGFGLVWYVKVSPEKHLEA----- 126

Query: 82  IQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
               +E     Q  V               + P    V  L  ++ D       + +  +
Sbjct: 127 -FQAIERYLANQYGVV--------------VDPSGKDVSRLRFISYD----PHLYLNRGS 167

Query: 142 TPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY--NGSHDEWIPVVMAIHYE 199
               K  + ++            Y + +IR  L             +  W+    A+  E
Sbjct: 168 KKWSKYLNKKQREFREAPARAIAYHDEDIRHILEQIQNRGVNIAEDYHSWLHTSFALASE 227

Query: 200 TRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
                 G++           Y+    + ++D
Sbjct: 228 F--GEGGRDYFHIVSAQSSKYERGKCDKQYD 256


>gi|291335539|gb|ADD95150.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C491]
 gi|291335653|gb|ADD95260.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C846]
          Length = 295

 Score = 44.0 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 10/44 (22%), Positives = 12/44 (27%), Gaps = 6/44 (13%)

Query: 194 MAIHYETRGSAEGKEIVREWCKLGRTY-----DEKSFNAKWDSF 232
           MAIH        G  +   W      Y     +       W SF
Sbjct: 1   MAIHSALPT-DMGLHLWASWSCEDPDYASEWENSNPCEEVWYSF 43


>gi|326425079|ref|YP_004286302.1| primase [Tsukamurella phage TPA2]
 gi|323145731|gb|ADX31975.1| primase [Tsukamurella phage TPA2]
          Length = 869

 Score = 44.0 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 38/198 (19%), Gaps = 29/198 (14%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQ--------APKTLM 64
            FGI  G     V   D D   E      +          ++  G+              
Sbjct: 127 NFGIEVGR--SRVIVVDCDTKAEVTAFLTDFGAPLDMPPTVTTPGKVVDGEWLHKDGGHF 184

Query: 65  LFRMQET-NLKKQKSE----EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119
            F + E   L  Q          +     L   +  V      +    Y      +    
Sbjct: 185 YFTLPEGVELPSQPGAMVVGSDPEAKYAILWAQRYVVIPPSIREEG-PYELLGRDYP--- 240

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSY---RKLSKIWKSHNNRRYTNIEIRAFLSC 176
                 T + V+   E  D        +         +    S        +    +   
Sbjct: 241 -----ATEELVDAILEQADRRAARMKHDGPRDEGLATAIDAWSQQVSWSDILSPIGWTPA 295

Query: 177 FGEEFYNGSHDEWIPVVM 194
              +        W     
Sbjct: 296 ARPDGC--GCPVWTAPGA 311


>gi|125625286|ref|YP_001033769.1| hypothetical protein llmg_2533 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124494094|emb|CAL99095.1| hypothetical protein predicted by Glimmer/Critica [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300072098|gb|ADJ61498.1| hypothetical protein LLNZ_13085 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 264

 Score = 43.6 bits (101), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/242 (9%), Positives = 53/242 (21%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D     +     F+  +            + 
Sbjct: 44  VSAWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRTVFSRLWNEHSEGEILSTYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +     Q    ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKELFS-QPIVSELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                K    + L       +E            R + ++    S            N  
Sbjct: 156 DTETNKPLTFDSLCDCPDWLLE---------MIQRPQARATTGTSSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  + +  ++      +         +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIGIDNNHCM----DLLRTFNN--RTSPPLPDDELATIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|227821693|ref|YP_002825663.1| hypothetical protein NGR_c11250 [Sinorhizobium fredii NGR234]
 gi|227340692|gb|ACP24910.1| hypothetical protein NGR_c11250 [Sinorhizobium fredii NGR234]
          Length = 403

 Score = 43.6 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 29/108 (26%), Gaps = 7/108 (6%)

Query: 24  PVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQ 83
            +   D+D    +         +   G+   +V         FR         +      
Sbjct: 95  GILVVDIDTDTPEA----REYVRQRFGESSVQVKSPRGAHHYFRFDGKPPAPVRLTN--- 147

Query: 84  GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVE 131
             ++F A  Q  +A     +    +   +      V  LP     ++E
Sbjct: 148 IAIDFKAGSQSLIAGPFAERADGGHYLPLQGRLDSVASLPTFYDRDLE 195


>gi|325527161|gb|EGD04562.1| hypothetical protein B1M_10828 [Burkholderia sp. TJI49]
          Length = 893

 Score = 43.6 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 17/173 (9%), Positives = 47/173 (27%), Gaps = 7/173 (4%)

Query: 67  RMQETNLKKQKSEEKIQGHL-EFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
           R      K++        ++      G + +  ++   T     W        + +  +L
Sbjct: 711 RQPAPGEKRRFFFYARPHNVRNLYWRGLEVIVTSLKDGTLDPLEWEFHFVGKDMPDA-VL 769

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
             +   YF                   LS +   H +    ++     +    +      
Sbjct: 770 PHNIRPYFHRNLPWQNYVELISSMDIGLSLMDTPHPSYPPLDLAATGAIVVTNQHGCKTD 829

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWC----KLGRTYDEKSFNAKW-DSFD 233
            +++   ++    +     +G +   +      +    +   S +  W  SFD
Sbjct: 830 LEKYSKNIICTSTDIESLQDGIKKALDLSRNPEQRSANFSSNSISKNWSQSFD 882


>gi|124378226|ref|YP_001029423.1| GfV-C20-ORF1 [Glypta fumiferanae ichnovirus]
 gi|124270633|dbj|BAF45559.1| GfV-C20-ORF1 [Glypta fumiferanae ichnovirus]
          Length = 972

 Score = 43.6 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 34/114 (29%), Gaps = 13/114 (11%)

Query: 122 LPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEF 181
           +P  +   ++      +  +      ++   +S   KS                      
Sbjct: 200 VPETSESLIDINESNSEPPSKKMKTNENPGNISYNKKSLERLVMDLE-----------SR 248

Query: 182 YNGSHDEWIPVVMAIHYETRG-SAEGKEIVREWCKLGRTYDE-KSFNAKWDSFD 233
           ++  +D W  V+ A++        +  +I  ++ K    Y   +     + S D
Sbjct: 249 HSEKYDLWRNVLWALNTCGLENGYDTLDIADKFSKRSAKYKNIEDVKKTFQSSD 302


>gi|13095885|ref|NP_076774.1| hypothetical protein bIL310p24 [Lactococcus phage bIL310]
 gi|15672012|ref|NP_266186.1| prophage ps1 protein 06 [Lactococcus lactis subsp. lactis Il1403]
 gi|12722869|gb|AAK04128.1|AE006242_7 prophage ps1 protein 06 [Lactococcus lactis subsp. lactis Il1403]
 gi|12831074|gb|AAK08427.1|AF323671_23 Orf23 [Lactococcus phage bIL310]
 gi|326405627|gb|ADZ62698.1| phage bifunctional DNA primase/polymerase [Lactococcus lactis
           subsp. lactis CV56]
          Length = 264

 Score = 43.6 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 21/242 (8%), Positives = 52/242 (21%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D     +   + F+  +            + 
Sbjct: 44  VSAWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRNVFSRLWNEHSEGEILSTYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +T         ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKTIFNS-PLVSELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                +    + L       +E            R + ++    S            N  
Sbjct: 156 DTETNEPLTFDSLCDCPDWLLE---------MIQRPQARATTGTSSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  +      +     +         +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIG----IDNNSCMDLLRTFNN--RTSPPLPDDELATIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|220909682|ref|YP_002484993.1| hypothetical protein Cyan7425_4322 [Cyanothece sp. PCC 7425]
 gi|219866293|gb|ACL46632.1| hypothetical protein Cyan7425_4322 [Cyanothece sp. PCC 7425]
          Length = 811

 Score = 43.2 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 29/237 (12%), Positives = 51/237 (21%), Gaps = 30/237 (12%)

Query: 8   HYVYNGFGILCGIGTHP-VYAFDVDVLD----EQVVDRFNNEFQSC---CGKPISRV-GQ 58
                G G L G      +   D DV D    E          +      G P  R  G 
Sbjct: 78  RDRKTGIGTLAGWNGEHWLGWIDFDVKDFASQEACDRAVAEWMEQYQIVKGCPRFRTPGG 137

Query: 59  APKTLMLFRMQETNLKKQKS----EEKIQGHLEFLA-YGQQFVAYNIHPKTQRAYTWSIA 113
             + L+ +  +  N           +      E L   G   +         + Y W   
Sbjct: 138 GYRFLIAWEKEPENFGANNGFSLSPDGSTRSGELLTKNGGHTLLPPTIGVNGKPYYWEYW 197

Query: 114 PHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAF 173
                +   P                I     +     +          ++ T  ++  F
Sbjct: 198 QEYPPLASSPEAV------------GIYPLVTQTSKPEESHYKQNGGKAKQKTETDLTQF 245

Query: 174 L-SCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
           L               W     +         +G     +  + G  +     +  W
Sbjct: 246 LKQEVYPRLTPEQIYNW--PGHSWQERRNSKLQGCCPWHD-SQSGTAFYVDEVDGIW 299


>gi|125625018|ref|YP_001033501.1| phage protein by Glimmer/Critica [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124493826|emb|CAL98819.1| hypothetical phage protein predicted by Glimmer/Critica
           [Lactococcus lactis subsp. cremoris MG1363]
 gi|300071818|gb|ADJ61218.1| phage protein by Glimmer/Critica [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 264

 Score = 43.2 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/242 (9%), Positives = 51/242 (21%), Gaps = 38/242 (15%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEF-----QSCCGKPIS 54
           V+   D         +  +    +   D+D     +     F+  +            + 
Sbjct: 44  VSAWFDEIPNRNI--MINLRNSGLICIDLDQHQNGQNGRTVFSRLWNEHSEGEILSAYVE 101

Query: 55  RVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPK--TQRAYTWSI 112
           +        + F++ +     Q    ++   +E   +        I+P   T   Y    
Sbjct: 102 KTPTGNGLHVFFKVPKELFN-QPIVNELADGVEIKTH-----FTPIYPSKRTDGDYIPLN 155

Query: 113 APHALKV---EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169
                K    + L       +E            R + ++    S            N  
Sbjct: 156 DTETNKPLTFDSLCDCPDWLLE---------MIQRPQARATTGTSSRTYGAEMWELFNQG 206

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKW 229
            R                 W  +      +     +         +      +      W
Sbjct: 207 ARKGNRNNDTNRI---LHYWRKIG----IDNNSCMDLLRTFNN--RTSPPLPDDELATIW 257

Query: 230 DS 231
            S
Sbjct: 258 KS 259


>gi|125974153|ref|YP_001038063.1| hypothetical protein Cthe_1647 [Clostridium thermocellum ATCC
           27405]
 gi|125714378|gb|ABN52870.1| conserved hypothetical protein [Clostridium thermocellum ATCC
           27405]
          Length = 851

 Score = 43.2 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 23/220 (10%), Positives = 51/220 (23%), Gaps = 33/220 (15%)

Query: 21  GTHPVYAFDVD-VLDEQVVD--RFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQK 77
            +  +   D+D   D+   +      +                   + ++ +       K
Sbjct: 74  KSGGLVGIDIDHCRDKNTGELSDTAKDILERFPSYTEISPSGTGLHIFYKGEMP----AK 129

Query: 78  SEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFF 137
             +  +  +E  A+ + F        T      +    A     L       +   +   
Sbjct: 130 GNKNTKTGVEMYAHSRYFTM------TGDPLPGTPDSIAEDNGAL-----AWIHENYIKS 178

Query: 138 DTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIH 197
              +    K +   KL  +       +    E         +EF      +W        
Sbjct: 179 KKRSGKSKKNRKNFKLEPLTDEEILEKAQTAE-------NHKEFELLWEGKWQEAGYPSQ 231

Query: 198 YETRGSAEGKEIVREWCKLGRTY------DEKSFNAKWDS 231
            E   +         W    +        +   F  KWD+
Sbjct: 232 SEADLALCCMLAF--WSGKNKEQMDRLFRNSGLFREKWDT 269


>gi|256397870|ref|YP_003119434.1| Bifunctional DNA primase/polymerase [Catenulispora acidiphila DSM
           44928]
 gi|256364096|gb|ACU77593.1| Bifunctional DNA primase/polymerase [Catenulispora acidiphila DSM
           44928]
          Length = 223

 Score = 43.2 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 19/138 (13%), Positives = 36/138 (26%), Gaps = 13/138 (9%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPK 61
           V +  + +  +   +  G         DV      +         +  G   +      +
Sbjct: 86  VHSWWEEHPDSAILLPTGRTFD---VIDVPEQAGCLALARLERNGAALGPVAAT---PTR 139

Query: 62  TLMLFRMQETNLKKQK---SEEKIQGHLEFLAYG--QQFVAYNIHPKTQRAYTWSIAPHA 116
            L  F +  T  K  +        +  L+ + +G     VA      T     W+  P  
Sbjct: 140 RLYFFVLPGTKKKIPEMLVRAGWGRAQLDLICHGEKGFVVAPPSRMGTGGQVQWARPPGE 199

Query: 117 L--KVEELPLLTPDEVEY 132
               + E   L P     
Sbjct: 200 SNRWLPEAAELIPTLAYA 217


>gi|330815841|ref|YP_004359546.1| hypothetical protein bgla_1g09050 [Burkholderia gladioli BSR3]
 gi|327368234|gb|AEA59590.1| hypothetical protein bgla_1g09050 [Burkholderia gladioli BSR3]
          Length = 930

 Score = 43.2 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 24/67 (35%), Gaps = 5/67 (7%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
                +   LS       +  H +W+ V   + YE     EG  I  +W +   TY   S
Sbjct: 5   DDREILLVALSHIPP---DIQHQDWMRVAAGLKYEL--GEEGFRIFDDWSRGAETYVAAS 59

Query: 225 FNAKWDS 231
             + W +
Sbjct: 60  AKSTWRA 66


>gi|290891514|ref|ZP_06554572.1| hypothetical protein AWRIB429_1962 [Oenococcus oeni AWRIB429]
 gi|290478863|gb|EFD87529.1| hypothetical protein AWRIB429_1962 [Oenococcus oeni AWRIB429]
          Length = 265

 Score = 43.2 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 8/146 (5%), Positives = 29/146 (19%), Gaps = 18/146 (12%)

Query: 6   VDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQ-SCCGKPISRVGQAPKTL 63
            + +      +         +  D+D   D                   +++        
Sbjct: 48  WEQHPNADIAVRT----VDFFVVDIDKHQDNNGFKSLKEFNHNEYFSTTLTQKTAHGGAQ 103

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
           M +   +    +Q         ++        +A +        Y +      ++  +  
Sbjct: 104 MFYMKPKGIEVEQNIGWLKGVDVKAHINNYVVIAPS------DGYQFVNHHKIVEASK-- 155

Query: 124 LLTPDEVEYFFEFFDTITTPRDKEKS 149
               + +            P      
Sbjct: 156 ----ELLRAIKPVNSQYDIPESVRNK 177


>gi|319778340|ref|YP_004129253.1| toprim domain protein [Taylorella equigenitalis MCE9]
 gi|317108364|gb|ADU91110.1| toprim domain protein [Taylorella equigenitalis MCE9]
          Length = 311

 Score = 43.2 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 2/40 (5%)

Query: 192 VVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
           +  AI  E      G EI   W K    Y+EKS  + W S
Sbjct: 1   MGGAIKSEY--GDSGFEIWNGWSKRASNYEEKSAKSTWRS 38


>gi|167739962|ref|ZP_02412736.1| putative helicase [Burkholderia pseudomallei 14]
          Length = 317

 Score = 42.9 bits (99), Expect = 0.041,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 24/72 (33%), Gaps = 8/72 (11%)

Query: 163 RRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD- 221
                +  R+ L C          DEW+ + MA       +        EWC  G  Y  
Sbjct: 1   MTDDPLRARSALFCLDAGC---ERDEWVRIGMAYKASGGDTET----WVEWCATGANYSG 53

Query: 222 EKSFNAKWDSFD 233
           E+   A W S D
Sbjct: 54  ERDARAVWKSID 65


>gi|116326764|ref|YP_803301.1| hypothetical protein TNAV2c_gp078 [Trichoplusia ni ascovirus 2c]
 gi|102231772|gb|ABF70595.1| hypothetical protein [Trichoplusia ni ascovirus 2c]
          Length = 1046

 Score = 42.5 bits (98), Expect = 0.043,   Method: Composition-based stats.
 Identities = 11/75 (14%), Positives = 20/75 (26%), Gaps = 6/75 (8%)

Query: 161 NNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGS----AEGKEIVREWCKL 216
           +N       +  +L+           D W+    AI            +G  +  E+   
Sbjct: 352 SNADDYCNNLSIWLNALNISRATEQSD-WMKTFWAILNCVDEGKITQDQGFHLFDEFSSR 410

Query: 217 G-RTYDEKSFNAKWD 230
               YD       W+
Sbjct: 411 CNEKYDAMEVAHMWN 425


>gi|298708396|emb|CBJ48459.1| protein tyrosine phosphatase, receptor type [Ectocarpus
           siliculosus]
          Length = 1867

 Score = 42.5 bits (98), Expect = 0.046,   Method: Composition-based stats.
 Identities = 10/97 (10%), Positives = 23/97 (23%), Gaps = 10/97 (10%)

Query: 142 TPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE-----WIPVVMAI 196
                     +  + ++  +  +         L            D+     W+ V  A+
Sbjct: 411 RNVRAAARRTEKVEAFRGWSRLKAVKEAAVRCLEDIDPPPSGKGADKREKEHWLEVGRAL 470

Query: 197 HYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
                  A        W +    +      A WD+ +
Sbjct: 471 KSV---DARLLSDWTAWAR--GNFPPAHCQAVWDALE 502


>gi|256824525|ref|YP_003148485.1| DNA primase/polymerase-like protein [Kytococcus sedentarius DSM
           20547]
 gi|256687918|gb|ACV05720.1| DNA primase/polymerase-like protein [Kytococcus sedentarius DSM
           20547]
          Length = 317

 Score = 42.5 bits (98), Expect = 0.051,   Method: Composition-based stats.
 Identities = 11/118 (9%), Positives = 26/118 (22%), Gaps = 25/118 (21%)

Query: 2   VATDVDHYVYNGFGILCGIGTH---------PVYAFDVDVLDE----QVVDRFNNEFQSC 48
           +      +      +  G  +                 D              +  +Q  
Sbjct: 61  ITAWWREHPEANLAVPTGAASGVVVVDVDVHGPV----DGYRAFERAHRAGLVSGWWQLL 116

Query: 49  CGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQR 106
              P      +      +    T  ++Q+S +  +  ++F   G   V       T  
Sbjct: 117 VATP------SAGMHAYY--PATPDREQRSWQAARAGIDFRGDGGYIVVPPSTVSTGG 166


>gi|29567083|ref|NP_818646.1| gp108 [Mycobacterium phage Barnyard]
 gi|29425808|gb|AAN02162.1| gp108 [Mycobacterium phage Barnyard]
          Length = 916

 Score = 42.5 bits (98), Expect = 0.054,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 41/177 (23%), Gaps = 31/177 (17%)

Query: 11  YNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC---------CGKPISRVGQAPK 61
                +  G          +DV      D+     +                    +   
Sbjct: 67  RANIALRLGGVDKEYEVIGIDVDHYVKGDKEKRGGEQLQALENAHGPLPPTWISSARTDG 126

Query: 62  --TLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQ--FVAYNIHPKTQRAYTWSIAPHAL 117
              +  +R+     +      ++   +E +  G +   V  + +P ++  Y W      L
Sbjct: 127 VSGIRYYRVP----RGLAFRGQVSKDIECIQKGHRFAVVWPSYNPDSKSDYWWFPPDADL 182

Query: 118 KVE--------------ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSH 160
             E              ELPLL    +++                S       W   
Sbjct: 183 TPEGRKAWRVGELPVATELPLLPETWLKFLTRGLMEAGKVEIDMDSTVDDIYAWAYE 239


>gi|320166803|gb|EFW43702.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
          Length = 763

 Score = 42.1 bits (97), Expect = 0.054,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 33/105 (31%), Gaps = 8/105 (7%)

Query: 129 EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDE 188
           + +   E  +         +  RKL           +T  EIR  L       + G    
Sbjct: 282 QCDAIDEALEEQERSNKAAEERRKLQLAT---PVNEHTVREIREILMEHLGPEHYGQRKH 338

Query: 189 WIPVVMAIHYETRGSAEGKEIVREWCKL--GRTYDEKSFNAKWDS 231
           W  +V A+         G ++ RE+        YD   F   W+S
Sbjct: 339 WFGIVAAVKCVL--GEAGYDLAREFSARAGDPQYD-NDFPKNWES 380


>gi|213692143|ref|YP_002322729.1| Helicase superfamily 3 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|213523604|gb|ACJ52351.1| Helicase superfamily 3 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|320458261|dbj|BAJ68882.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 837

 Score = 42.1 bits (97), Expect = 0.065,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 43/177 (24%), Gaps = 16/177 (9%)

Query: 21  GTHPVYAFDVDVLDEQVVDRFNNEFQSC-------CGKPISRVGQAPKTLMLFRMQETNL 73
                   D+D   +  +  +                +  +    +    +L+ + +   
Sbjct: 621 VADDYMWVDLDCHKQDQMSGWEQIQTDVGPYGTPPLPRTFAVRTPSGGVHLLYHIPDG-- 678

Query: 74  KKQKSEEKIQGHLEFL-AYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEY 132
            + KS     G ++F        V         R YT    P       +P L+   + +
Sbjct: 679 ARLKSRTHNGGQIDFKIGRDGYVVMGGSVLPDGRRYTPIDRPED----RIPDLSDAFLRW 734

Query: 133 FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEW 189
                 T         +    +    S         E    +S   E   N +   W
Sbjct: 735 AERVDATDKPRHAPAPARTAAAFDLPSPGMPGSPEGEP--DMSPIPEGRRNDTLYRW 789


>gi|194100566|ref|YP_002003891.1| gp52 [Mycobacterium phage Nigel]
 gi|192758282|gb|ACF05055.1| gp52 [Mycobacterium phage Nigel]
          Length = 929

 Score = 42.1 bits (97), Expect = 0.067,   Method: Composition-based stats.
 Identities = 18/192 (9%), Positives = 39/192 (20%), Gaps = 37/192 (19%)

Query: 30  VDVLDEQVVDRFNNEFQ----SCCGKPISRVGQAP---------------KTLMLFRMQE 70
           +D      VDR+    +    +     I   GQ                      F + +
Sbjct: 155 IDCDTAAQVDRWFEVAEIPEDARPAPTILTPGQVGPDADINDPSTWAHADGGHFWFTVPD 214

Query: 71  TNLKKQKS-----EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
             L                    L   +  +                     ++  +  +
Sbjct: 215 KYLPVLPRHLGAMTWGGDHGFAILWDRRYVLIPPSTRPEGAY---------EQLGHVYDM 265

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG----EEF 181
                E   +  +      +     R  +    +H +R   N+   + L   G       
Sbjct: 266 PDWLGEAIMQAGERRVQRAELAAGDRAENPELATHIDRWAENVSWASILEPLGWTPAPRA 325

Query: 182 YNGSHDEWIPVV 193
            +     W    
Sbjct: 326 DSCGCAVWTAPG 337


>gi|268592737|ref|ZP_06126958.1| putative P4-specific DNA primase [Providencia rettgeri DSM 1131]
 gi|291311513|gb|EFE51966.1| putative P4-specific DNA primase [Providencia rettgeri DSM 1131]
          Length = 801

 Score = 41.7 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 13/129 (10%), Positives = 28/129 (21%), Gaps = 12/129 (9%)

Query: 111 SIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
               +  +V  +  L    +              D        +              +I
Sbjct: 192 ECHYYEGEVINVDALP---LPEIALVSKKGKATSDTTTQSEDFADFDDLEALDECLISDI 248

Query: 171 RAFLSCFGEEFYNGSHDEWIPVV---MAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNA 227
           R+ L          +  +WI       ++          + +  EW      Y       
Sbjct: 249 RSALWHPEMLKQAHNDHQWISNGYRLASLKNTELEDE-ARTLWVEWSLTAADYYPDEQLD 307

Query: 228 -----KWDS 231
                +WD+
Sbjct: 308 EVAGNRWDN 316


>gi|330963895|gb|EGH64155.1| bifunctional DNA primase/polymerase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 823

 Score = 41.7 bits (96), Expect = 0.077,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 9/72 (12%)

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
           L+R    N K+    E   G +      Q  +  +IHP T + YTW   P     E LP+
Sbjct: 89  LYRADAENYKRFTVFELRAGLV------QDVLPPSIHPGTGKPYTWRTPP---DAEGLPV 139

Query: 125 LTPDEVEYFFEF 136
           L  D +  +  +
Sbjct: 140 LISDLLNVWNNW 151


>gi|322691149|ref|YP_004220719.1| hypothetical protein BLLJ_0960 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320456005|dbj|BAJ66627.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 847

 Score = 41.7 bits (96), Expect = 0.079,   Method: Composition-based stats.
 Identities = 14/120 (11%), Positives = 31/120 (25%), Gaps = 14/120 (11%)

Query: 21  GTHPVYAFDVDVLDEQVVDRFNN-------EFQSCCGKPISRVGQAPKTLMLFRMQETNL 73
                   D+D   +     +                +  +    +    +L+ + +   
Sbjct: 621 VADDYMWVDLDCHKQDQTSGWEQIQTDVGPYGTPLLPRTFAVRTPSGGVHLLYHIPDG-- 678

Query: 74  KKQKSEEKIQGHLEFL-AYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEY 132
            + KS     G ++F        V         R YT    P       +P L+   + +
Sbjct: 679 ARLKSRTHNGGQIDFKIGRDGYVVMGGSVLPDGRRYTPIDRPED----RIPDLSDAFLRW 734


>gi|325184124|emb|CCA18582.1| conserved hypothetical protein [Albugo laibachii Nc14]
 gi|325186037|emb|CCA20539.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 1755

 Score = 41.7 bits (96), Expect = 0.080,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 16/47 (34%), Gaps = 7/47 (14%)

Query: 188 EWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE-KSFNAKWDSFD 233
           +W+ V  A+    RG     +   +W      Y         W SFD
Sbjct: 647 KWVQVGKALKAVDRG---LFDAWVQWSAS---YTSLSKCRMYWQSFD 687


>gi|9633552|ref|NP_050964.1| hypothetical protein APSE-1_03 [Acyrthosiphon pisum bacteriophage
           APSE-1]
 gi|6118000|gb|AAF03948.1|AF157835_3 P3 [Endosymbiont phage APSE-1]
          Length = 752

 Score = 41.7 bits (96), Expect = 0.087,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 226 QNINDQTFEDLRSALWYPKILNRAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 285

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 286 AKGDIEAAEAKWA 298


>gi|303237557|ref|ZP_07324121.1| VirE N-terminal domain protein [Prevotella disiens FB035-09AN]
 gi|302482276|gb|EFL45307.1| VirE N-terminal domain protein [Prevotella disiens FB035-09AN]
          Length = 292

 Score = 41.7 bits (96), Expect = 0.092,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 58/213 (27%), Gaps = 24/213 (11%)

Query: 20  IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRV-GQAPKTLMLFRMQETNLKKQKS 78
           +    +   D+D  D   V  F++        P     G++ +    F +      +   
Sbjct: 76  VAHSNLLCIDIDKKDNMDVGWFDDLKHEWHNIPQILYAGRSIRGKGWFAIF-----RIAY 130

Query: 79  EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFD 138
            +K +   E L   + F +  +     +A         +  +  P +  D          
Sbjct: 131 PDKHEDQFEAL--KRDFASSGLIID--KACKNVNRMRFISYDPEPYVNED-------ATL 179

Query: 139 TITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHY 198
                 + + +Y            +      I A            ++D+W  V  A+  
Sbjct: 180 YTKVWVEPKPTYHSSCTYSGGDMEQVERCCRIIADRDI----DITATYDDWFHVGAAL-- 233

Query: 199 ETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231
                  G+ +          Y     + K+D+
Sbjct: 234 -ASLGERGRRLFHLVSSQNAKYKAGETDKKFDN 265


>gi|211731819|gb|ACJ10131.1| predicted P-loop ATPase [Bacteriophage APSE-6]
          Length = 661

 Score = 41.3 bits (95), Expect = 0.099,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  WI +   +A   +TR   E K +  +W    
Sbjct: 135 QNINDQTFEDLRSALWYPKILNQAENYPSWIDMGNRLARFKDTRFEDEAKTMWLDWSSAA 194

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 195 AKGDIEAAEAKWA 207


>gi|296447833|ref|ZP_06889745.1| phage/plasmid primase, P4 family [Methylosinus trichosporium OB3b]
 gi|296254633|gb|EFH01748.1| phage/plasmid primase, P4 family [Methylosinus trichosporium OB3b]
          Length = 892

 Score = 41.3 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 34/92 (36%), Gaps = 4/92 (4%)

Query: 143 PRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRG 202
             D  K  +  +      + R   +  + + L   G +        WI +  A++ E  G
Sbjct: 278 ADDDPKRGQSAALTPIFTDPRYDKSKVVWSALEAIGNKG--IERKPWIKIGAALYVEFGG 335

Query: 203 SAEGKEIVREWCK--LGRTYDEKSFNAKWDSF 232
           SAEG+E+  +W           +   A W +F
Sbjct: 336 SAEGEELFEDWTALREEGNVKPEKDAASWRNF 367


>gi|282164833|ref|YP_003357218.1| hypothetical protein MCP_2163 [Methanocella paludicola SANAE]
 gi|282157147|dbj|BAI62235.1| hypothetical protein [Methanocella paludicola SANAE]
          Length = 237

 Score = 41.3 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/175 (10%), Positives = 40/175 (22%), Gaps = 33/175 (18%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGK--------- 51
           ++   V  +    +G+        +   D D   + V+      F    G          
Sbjct: 65  LIEALVKRFYPCNYGLYT--LGKNIVVIDTDNK-KIVLKNGKELFYGLTGVQAYYLLANQ 121

Query: 52  ------PISRVGQAPKTLMLFRMQETN-----------LKKQKSEEKIQG-HLEFLAYGQ 93
                  I     +      F + E              K  K         ++  +   
Sbjct: 122 YPEILNTIKVKTPSGGIHYYFSVPEGYDISGFNAADAMSKPVKVPIIGSWFGMDVRSQKS 181

Query: 94  QFVA---YNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           Q +     +     +  Y          +++LP+L    +           +  D
Sbjct: 182 QGIIVTPPSSKKGVKYEYIGERTLLNTHIDDLPVLPDFLLNILKSMGYARRSKHD 236


>gi|211731751|gb|ACJ10090.1| predicted P-loop ATPase [Bacteriophage APSE-4]
          Length = 661

 Score = 41.3 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 135 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 194

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 195 AKGDIEAAEAKWA 207


>gi|325288111|ref|YP_004263901.1| hypothetical protein Celly_3213 [Cellulophaga lytica DSM 7489]
 gi|324323565|gb|ADY31030.1| hypothetical protein Celly_3213 [Cellulophaga lytica DSM 7489]
          Length = 583

 Score = 41.3 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 35/88 (39%), Gaps = 4/88 (4%)

Query: 145 DKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYN--GSHDEWIPVVMAIHYETRG 202
           +  K   K      + N     + +I +++S   +   +  GS+  W  +  A+  E R 
Sbjct: 12  EVPKEPTKPKSNTATTNVVAVADNDIESYISAIEQSGTDITGSYATWRDLGFALAEEYR- 70

Query: 203 SAEGKEIVREWCKLGRTYDEKSFNAKWD 230
              G++      K    YD K  +A++D
Sbjct: 71  -ETGRDYFHRISKNYAGYDAKECDAQFD 97


>gi|211731797|gb|ACJ10118.1| predicted P-loop ATPase [Bacteriophage APSE-3]
          Length = 666

 Score = 41.3 bits (95), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 135 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 194

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 195 AKGDIEAAEAKWA 207


>gi|109392405|ref|YP_654949.1| gp52 [Mycobacterium phage Cooper]
 gi|88910239|gb|ABD58169.1| gp52 [Mycobacterium phage Cooper]
          Length = 926

 Score = 40.9 bits (94), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/192 (9%), Positives = 37/192 (19%), Gaps = 37/192 (19%)

Query: 30  VDVLDEQVVDRFNNEFQ---SCCGKPIS-RVGQAP---------------KTLMLFRMQE 70
           +D      VDR+    +        P     GQ                      F + +
Sbjct: 155 IDCDTAAQVDRWFEVAEIPDDMRPAPTILTPGQFGADADPNDPSTWAHADGGHFWFTVPD 214

Query: 71  TNLKKQKS-----EEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLL 125
             L                    L   +  +                     ++  +  L
Sbjct: 215 KYLPVLPRHLGAMTWGGDHGFAVLWDRRYVLIPPSTRPEGAY---------EQLGHVYDL 265

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFG----EEF 181
                E   +  +      +        +    +H +R   N+   + L   G       
Sbjct: 266 PDWLGEAIMQAGERRVQRAEASAGDTAENPELATHIDRWAENVSWASILEPLGWTPAPRA 325

Query: 182 YNGSHDEWIPVV 193
            +     W    
Sbjct: 326 DSCGCAVWTAPG 337


>gi|221632575|ref|YP_002521796.1| hypothetical protein trd_0550 [Thermomicrobium roseum DSM 5159]
 gi|221155705|gb|ACM04832.1| hypothetical protein trd_0550 [Thermomicrobium roseum DSM 5159]
          Length = 781

 Score = 40.5 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 17/138 (12%), Positives = 39/138 (28%), Gaps = 23/138 (16%)

Query: 4   TDVDHYVYN---GFGILCGIGT--HPVYA-FDVDVLDEQVVDRFNNEFQSCCGKP----I 53
            +V+ + ++   G  ++CG  T     +   DV+               +         +
Sbjct: 45  EEVEGWPWSKADGVAVICGHQTTFGGFWWCLDVEHQHRVEA---ERWLDATHPGWRHGLV 101

Query: 54  SRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI---HPKTQRAYTW 110
           +   +    L ++      ++ Q+ E       +    G    A       P   + Y W
Sbjct: 102 AESQRNG--LHVYCRSRQPVRTQRHEWG-----DIKGSGSLVYAPPSRRYKPDATQDYEW 154

Query: 111 SIAPHALKVEELPLLTPD 128
                   ++  P   P 
Sbjct: 155 LSFDPTNALQLEPADLPW 172


>gi|134287274|ref|YP_001110970.1| ATPase [Heliothis virescens ascovirus 3e]
 gi|133722182|gb|ABO37304.1| ATPase [Heliothis virescens ascovirus 3e]
          Length = 1052

 Score = 40.5 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 44/189 (23%), Gaps = 27/189 (14%)

Query: 66  FRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIH------PKTQRAYTWSIAPHALKV 119
           +++            +    L+ L+  +  VA          P+ + + TW       ++
Sbjct: 202 YKLSGAYFCDNTGAPEPVSPLQVLSRIRDPVATERFRDLFMTPEAEMSATWQTR--DCEI 259

Query: 120 EELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN---------NRRYTNIEI 170
             +   T                      +         +           N    + E 
Sbjct: 260 TWITTWTYYLSVRMSIINSKRFYRPSTIPAVVTPVAATVNGPAGVPPSAVCNEPLNSEEA 319

Query: 171 RAFLSCFGE------EFYNGSHDEWIPVVMAIHYE----TRGSAEGKEIVREWCKLGRTY 220
             F            E  +   + W+ V  A+            E  E  + +  L +  
Sbjct: 320 EQFSRHIKSCVRLLSEQRSAERNTWMRVFWALKDTVQKGYMKGDEAFECFQNFSMLWKQC 379

Query: 221 DEKSFNAKW 229
           D     + W
Sbjct: 380 DPDEIRSMW 388


>gi|212499708|ref|YP_002308516.1| predicted P-loop ATPase [Bacteriophage APSE-2]
 gi|238898740|ref|YP_002924422.1| APSE-2 prophage; predicted P-loop ATPase [Bacteriophage APSE-2]
 gi|211731677|gb|ACJ10165.1| predicted P-loop ATPase [Bacteriophage APSE-2]
 gi|229466500|gb|ACQ68274.1| APSE-2 prophage; predicted P-loop ATPase [Bacteriophage APSE-2]
          Length = 745

 Score = 40.5 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +T    E K +  +W    
Sbjct: 220 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTHFEDEAKTMWLDWSSAA 279

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 280 AKGDIEAAEAKWA 292


>gi|227431840|ref|ZP_03913864.1| possible bifunctional DNA primase/polymerase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227352382|gb|EEJ42584.1| possible bifunctional DNA primase/polymerase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 295

 Score = 40.5 bits (93), Expect = 0.19,   Method: Composition-based stats.
 Identities = 11/127 (8%), Positives = 31/127 (24%), Gaps = 9/127 (7%)

Query: 8   HYVYNGFGILCGIGTHPVYAFDVD--VLDEQVVDRFNNEFQ-SCCGKPISRVGQAPKTLM 64
           H   +  GI        +   D+D    ++  +               +          +
Sbjct: 77  HGDDSNVGISL--VDTGLVVLDIDRHTPNKNGLASLKKAGITPNFDDEVIEKTPRNGFHI 134

Query: 65  LFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPL 124
            + + +     +K        +E +   +  VA +         ++           L  
Sbjct: 135 FYYIPKG-FDMEKINHNPLNGVEIITD-KITVAPSFKTIDGNPVSYEHFGKDFIHANL-- 190

Query: 125 LTPDEVE 131
           +    +E
Sbjct: 191 MPDWLIE 197


>gi|269955633|ref|YP_003325422.1| Bifunctional DNA primase/polymerase [Xylanimonas cellulosilytica
           DSM 15894]
 gi|269304314|gb|ACZ29864.1| Bifunctional DNA primase/polymerase [Xylanimonas cellulosilytica
           DSM 15894]
          Length = 305

 Score = 40.5 bits (93), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/112 (10%), Positives = 22/112 (19%), Gaps = 26/112 (23%)

Query: 2   VATDVDHYVYNGFGILCGIGTH-------------PVYAFDVDVLDEQVVDRFNNEFQSC 48
           VA+          G+  G  +                 A            +        
Sbjct: 64  VASWWRTTPRANIGMPTGEMSGLDVVDVDVHDGRTGFPAI-----------QAARRAGLV 112

Query: 49  CGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
            G        +      +        +Q+S      H++F   G   V    
Sbjct: 113 DGFAWMVRTPSGGLHAYY--PHLAGTEQRSWSSPTAHVDFRGDGGYVVVPPS 162


>gi|211731774|gb|ACJ10104.1| predicted P-loop ATPase [Bacteriophage APSE-7]
          Length = 654

 Score = 40.5 bits (93), Expect = 0.20,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +T    E K +  +W    
Sbjct: 129 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTHFEDEAKTMWLDWSSAA 188

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 189 AKGDIEAAEAKWA 201


>gi|211731726|gb|ACJ10075.1| predicted P-loop ATPase [Bacteriophage APSE-5]
          Length = 654

 Score = 40.5 bits (93), Expect = 0.20,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +T    E K +  +W    
Sbjct: 129 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTHFEDEAKTMWLDWSSAA 188

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 189 AKGDIEAAEAKWA 201


>gi|159146228|gb|ABW90577.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 385

 Score = 40.5 bits (93), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 198 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 257

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 258 AKGDIEAAEAKWA 270


>gi|159146232|gb|ABW90579.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 385

 Score = 40.2 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 198 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 257

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 258 AKGDIEAAEAKWA 270


>gi|159146222|gb|ABW90574.1| virulence-associated protein [Bacteriophage APSE-2]
 gi|159146224|gb|ABW90575.1| virulence-associated protein [Bacteriophage APSE-2]
 gi|159146226|gb|ABW90576.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 385

 Score = 40.2 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +TR   E K +  +W    
Sbjct: 198 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTRFEDEAKTMWLDWSSAA 257

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 258 AKGDIEAAEAKWA 270


>gi|297625631|ref|YP_003687394.1| hypothetical protein PFREUD_04140 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296921396|emb|CBL55949.1| Hypothetical protein PFREUD_04140 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 840

 Score = 40.2 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/180 (11%), Positives = 40/180 (22%), Gaps = 15/180 (8%)

Query: 11  YNGFGIL-CGIGTHPVYAFDVDVLDEQVVDRFNNEFQSC-CGKPISRVGQAPKTLMLFR- 67
           + G G+  CG  T      DVD      ++      +             +         
Sbjct: 51  HYGPGMAVCGAVTERWAFVDVDTKAGASIEAAEAWLRGLGVSPWARVSTPSGGAHFYVSG 110

Query: 68  --MQETNLKKQKSEEKIQGHLEFLA----YGQQFVAYNI----HPKTQRAYTWSIAPHAL 117
              Q     +  ++      +E                     +P       W   P  +
Sbjct: 111 APGQANYPGETVAKLTGLVGVEVFGGIAPSAHFAFLPGSERPKYPGRGYTVEWE-HPELI 169

Query: 118 KVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCF 177
             +  PL          E      +P +  KS ++        ++         A+    
Sbjct: 170 DADATPLWNA-LAHAAAERRTGQGSPEEGAKSAKRAGTDTPPPSHPSEGRPRAEAYTRSV 228


>gi|27764600|ref|NP_776223.1| hypothetical protein pCG2_1 [Corynebacterium glutamicum]
 gi|27657769|gb|AAO18199.1| hypothetical protein [Corynebacterium glutamicum]
          Length = 622

 Score = 40.2 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 8/84 (9%), Positives = 16/84 (19%), Gaps = 3/84 (3%)

Query: 14  FGILCGIGTHPVYAFDVDVLDE-QVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETN 72
            GI  G+    +   D D               +                  LF      
Sbjct: 54  IGIHTGL--SGLVVVDRDNKHGKNGFKALVASGKPLPATMHYTSRSGRGRHDLFIAPTDI 111

Query: 73  LKKQKSEEKIQGHLEFLAYGQQFV 96
                ++      ++  A     +
Sbjct: 112 ECTVGTDVHGMQGVDIRAGVGMII 135


>gi|239928943|ref|ZP_04685896.1| hypothetical protein SghaA1_12032 [Streptomyces ghanaensis ATCC
           14672]
 gi|291437277|ref|ZP_06576667.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340172|gb|EFE67128.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
          Length = 186

 Score = 40.2 bits (92), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 38/129 (29%), Gaps = 4/129 (3%)

Query: 41  FNNEFQSCCGKPISRVGQAPKTLMLF---RMQETNLKKQKSEEKIQGHLEFLAYGQQFVA 97
           F+   +S      S + +  + +  F   + +E  +   + E        +L +G   V 
Sbjct: 56  FDRLLRSGLPFGPSAIDRKAQRVGFFLGSQSREAFMHYLERETPSPPPYRYLGHGSAVVV 115

Query: 98  YNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
             + P +   Y W  AP    V   PL             + +      ++ Y       
Sbjct: 116 PGLIPLSGDRYQWLHAPMRRPVAN-PLRPVALATALVASAELLARIDRFDEQYPTPYAAV 174

Query: 158 KSHNNRRYT 166
            +      T
Sbjct: 175 AALPEETTT 183


>gi|255690110|ref|ZP_05413785.1| primase C 2 family protein [Bacteroides finegoldii DSM 17565]
 gi|260624392|gb|EEX47263.1| primase C 2 family protein [Bacteroides finegoldii DSM 17565]
          Length = 625

 Score = 39.8 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 11/96 (11%), Positives = 32/96 (33%), Gaps = 3/96 (3%)

Query: 135 EFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVM 194
           E ++ + +      +    S    +  + R     + + +   G +     +D W+ V  
Sbjct: 7   EEWENVPSNTANSNTSNTPSAYSNTSEDTRAKVERVLSLIEQKGID-ITNGYDNWLKVGF 65

Query: 195 AIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
           A+  E + +  G        +    Y     + +++
Sbjct: 66  ALTSEFQEAGRGF--FHRVSRQNPEYKASDTDKQYN 99


>gi|254385241|ref|ZP_05000572.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194344117|gb|EDX25083.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 367

 Score = 39.8 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 15/177 (8%), Positives = 38/177 (21%), Gaps = 43/177 (24%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDV-----------------------LDEQVV 38
           +          G  + CG     +   D+D                              
Sbjct: 86  IDQWWGKTPSLGVAVACGPA--GLVVIDIDAHQSEPPHRDKVLPGIPIGEHIDLSGMTTG 143

Query: 39  DRFNNEFQSCCGKP--------ISRVGQAPKTLMLFRMQETNLKKQKSEEKIQ---GHLE 87
                   +  G+P        +     +    + +R  +    +  +    +     ++
Sbjct: 144 YHSLAVLAALRGEPSPAEDTSTLRVRTPSGGLHVWYRATDGRRWQCSTGSGKRALAWQVD 203

Query: 88  FLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPR 144
             A+G   +A             +     +  E  P   P  +    +    +  P 
Sbjct: 204 VRAHGGYIIAPGTTTT-------AGTYTPVGPERRPAPLPAWLAQELQRTGHLPAPH 253


>gi|159146234|gb|ABW90580.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 378

 Score = 39.8 bits (91), Expect = 0.33,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 25/73 (34%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRG--SAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   + +        E K +  +W    
Sbjct: 192 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWVKDTHFEDEAKTMWLDWSSAA 251

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 252 AKGDIEAAEAKWA 264


>gi|159146230|gb|ABW90578.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 378

 Score = 39.8 bits (91), Expect = 0.34,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +T    E K +  +W    
Sbjct: 192 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTHFEDEAKTMWLDWSSAA 251

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 252 AKGDIEAAEAKWA 264


>gi|159146220|gb|ABW90573.1| virulence-associated protein [Bacteriophage APSE-2]
          Length = 378

 Score = 39.8 bits (91), Expect = 0.34,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 2/73 (2%)

Query: 160 HNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV--MAIHYETRGSAEGKEIVREWCKLG 217
            N    T  ++R+ L          ++  W+ +   +A   +T    E K +  +W    
Sbjct: 192 QNINDQTFEDLRSALWYPKILNQAENYPSWVDMGNRLAWFKDTHFEDEAKTMWLDWSSAA 251

Query: 218 RTYDEKSFNAKWD 230
              D ++  AKW 
Sbjct: 252 AKGDIEAAEAKWA 264


>gi|218670885|ref|ZP_03520556.1| hypothetical protein RetlG_04143 [Rhizobium etli GR56]
          Length = 266

 Score = 39.4 bits (90), Expect = 0.36,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 42/143 (29%), Gaps = 6/143 (4%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL-PLLTPDEVEYFFEFFDTITTPRDKE 147
           LA G    A   HP       W  + H      +  ++  DE               D  
Sbjct: 21  LAGGDATAAALCHPM-----RWPGSWHTKGAPNMCSIVGGDEQREVRLADAAKALDVDTA 75

Query: 148 KSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGK 207
            S  +  +        R    E +           +   D++    MA +    GS+ G 
Sbjct: 76  ASRERGDRQVGQSFTTRTEWTEAQLMDVAEKLPNTDLDWDDFNSTGMAFYDAAHGSSHGY 135

Query: 208 EIVREWCKLGRTYDEKSFNAKWD 230
           E  R +      +D+    A+W+
Sbjct: 136 EAFRTFSAKSAKHDDAETEARWE 158


>gi|167893788|ref|ZP_02481190.1| putative helicase [Burkholderia pseudomallei 7894]
          Length = 661

 Score = 39.4 bits (90), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 17/65 (26%), Gaps = 5/65 (7%)

Query: 168 IEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDE-KSFN 226
            +               S DEW+   MA         +      EW   G  Y   +   
Sbjct: 5   FDAARAREALFSLSAGCSRDEWVRAGMAAKAAGLSEDD----FLEWSATGDNYGGVREAR 60

Query: 227 AKWDS 231
           + W S
Sbjct: 61  SVWKS 65


>gi|291165124|gb|ADD81151.1| gp46 [Rhodococcus phage ReqiPine5]
          Length = 983

 Score = 39.4 bits (90), Expect = 0.46,   Method: Composition-based stats.
 Identities = 14/186 (7%), Positives = 26/186 (13%), Gaps = 35/186 (18%)

Query: 26  YAFDVDVLD-EQVVDRFNNEFQSCCGKPISRVGQAP---------KTLMLFRMQET-NLK 74
              D D  +  +   R            +   G                 F + E   L 
Sbjct: 123 IVVDCDTTEQREAFLRDAGLAGMNIPPTVQSPGAKNAAGEWVHYDGGHYYFTVPEGVELP 182

Query: 75  KQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFF 134
                         L   +  +               +                 +E   
Sbjct: 183 TNVGMWTSPDGYAVLWRDRYVLIPPSTRAEGAYAQLGLEY---------PAPDWLLEKIT 233

Query: 135 EFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG-------SHD 187
                        +  R                 E  ++    G   +           D
Sbjct: 234 --------AHGAARVPRAREDGDGELATVVDDWAEQVSWADLLGPLGWAQANRYDNCGCD 285

Query: 188 EWIPVV 193
            W    
Sbjct: 286 VWTAPG 291


>gi|309702931|emb|CBJ02262.1| putative virulence associated protein virE [Escherichia coli ETEC
           H10407]
          Length = 574

 Score = 39.0 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 11/105 (10%)

Query: 84  GHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTP 143
           G +E LA GQQFVA   H  +     W         +E P +T +++E  ++        
Sbjct: 2   GIIELLANGQQFVACGTH-SSGARIEWDGGL----PDEPPAITGEQLETLWQRLAEQLPV 56

Query: 144 RDKEK------SYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
               +        R       + +   Y +      L     E Y
Sbjct: 57  SVTTEAGNTKMRDRSAFTPGATDDTAEYLDANGWTLLDGANGERY 101


>gi|237653460|ref|YP_002889774.1| P4 family phage/plasmid primase [Thauera sp. MZ1T]
 gi|237624707|gb|ACR01397.1| phage/plasmid primase, P4 family [Thauera sp. MZ1T]
          Length = 782

 Score = 39.0 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 28/77 (36%), Gaps = 4/77 (5%)

Query: 159 SHNNRRYTNIEIRAFLSCFGEEFYNG-SHDEWIPVVMAIHYETRGSAEGKEIVREWCKLG 217
                R     +R+  +        G + D ++ V+        G    +E+ REWC   
Sbjct: 224 PEPETRENVERLRSAAAAIPSSKAKGCTRDIYLTVLWGF--AATGWNCAEELAREWCMTS 281

Query: 218 R-TYDEKSFNAKWDSFD 233
              +DE  F   W S+D
Sbjct: 282 PEDFDEDDFGKDWRSYD 298


>gi|298241727|ref|ZP_06965534.1| Bifunctional DNA primase/polymerase [Ktedonobacter racemifer DSM
           44963]
 gi|297554781|gb|EFH88645.1| Bifunctional DNA primase/polymerase [Ktedonobacter racemifer DSM
           44963]
          Length = 605

 Score = 39.0 bits (89), Expect = 0.56,   Method: Composition-based stats.
 Identities = 17/168 (10%), Positives = 34/168 (20%), Gaps = 19/168 (11%)

Query: 27  AFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLML----FRMQETNLKKQKSEEKI 82
             D D              +     P  + G     + L    + +   N K ++     
Sbjct: 1   MLDFDGEAG------QETRKRLGLSPHVQTGSGGAHVYLEHPGWLVPTLNSKSKRELGAR 54

Query: 83  QGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITT 142
              L+  A                 Y W   P    +  LP      +          T 
Sbjct: 55  WPGLDIRADDGYAAFCGE--SESGPYLWLRDPQLDPLGCLPEELRAFLNLLQPPVSAST- 111

Query: 143 PRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWI 190
                +   +      +              +   G+   +     W+
Sbjct: 112 ----TREGHEAGAASTARIATSTLIERALKCIHEQGKGRNDTGF--WL 153


>gi|301114397|ref|XP_002998968.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262111062|gb|EEY69114.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 1753

 Score = 38.6 bits (88), Expect = 0.62,   Method: Composition-based stats.
 Identities = 9/45 (20%), Positives = 14/45 (31%), Gaps = 5/45 (11%)

Query: 188 EWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
            W  +  A+    R      +    W +  R        A W+SF
Sbjct: 637 RWEEIGKALKAVDR---TLLDAWVRWSRGFRN--AGRCRALWESF 676


>gi|167823694|ref|ZP_02455165.1| putative helicase [Burkholderia pseudomallei 9]
 gi|226196186|ref|ZP_03791771.1| putative helicase [Burkholderia pseudomallei Pakistan 9]
 gi|225931772|gb|EEH27774.1| putative helicase [Burkholderia pseudomallei Pakistan 9]
          Length = 659

 Score = 38.2 bits (87), Expect = 0.79,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 18/63 (28%), Gaps = 8/63 (12%)

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTY-DEKSFNAK 228
            R  L            +EW+   MA         +      EW   G  Y  E+   + 
Sbjct: 10  AREALFSLDAGC---PREEWVRAGMAAKAAGLLEDD----FLEWSATGANYGGERDARSV 62

Query: 229 WDS 231
           W S
Sbjct: 63  WKS 65


>gi|145610915|ref|XP_368435.2| hypothetical protein MGG_00809 [Magnaporthe oryzae 70-15]
 gi|145018255|gb|EDK02534.1| hypothetical protein MGG_00809 [Magnaporthe oryzae 70-15]
          Length = 1213

 Score = 38.2 bits (87), Expect = 0.80,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 52/188 (27%), Gaps = 34/188 (18%)

Query: 56  VGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFV--------------AYNIH 101
            G   +  +LF          +   +++   +  + G + V              A    
Sbjct: 11  SGGGNRDDLLFSG-IKFWLALRVPSRLKFKEKIQSNGGEVVPMERQADILIADDAAPKKA 69

Query: 102 PKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN 161
           P    +Y+W     A++  ELP      +                  S +     + + +
Sbjct: 70  PSNWDSYSWKFIDAAIEKGELPDKADYLIPRPTSAATATRASIPANGSSKGTRTPFTAED 129

Query: 162 NRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYD 221
           +R  T    R   +  G               M      +GS +G     ++      + 
Sbjct: 130 DRILTECARRQLCAPQGP-------------GM------KGSLKGITFWADFAAKNPRHT 170

Query: 222 EKSFNAKW 229
            +S+  +W
Sbjct: 171 AQSWRDRW 178


>gi|121610736|ref|YP_998543.1| radical SAM domain-containing protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121555376|gb|ABM59525.1| Radical SAM N-terminal domain protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 796

 Score = 38.2 bits (87), Expect = 0.95,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 27/90 (30%), Gaps = 2/90 (2%)

Query: 58  QAPKTLMLFRMQETN--LKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH 115
           +  +    F            ++  K  G  + +  G+Q +   + P T  +Y  +   +
Sbjct: 692 KRRRLHKAFLRYHDPNNWPLLRAALKSMGRADLIGNGRQHLIPGMQPLTDGSYHSARRKN 751

Query: 116 ALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           A     +    P   +       T   PR 
Sbjct: 752 ATPATPVASAPPSVPKGRLLTQHTGLPPRP 781


>gi|320333454|ref|YP_004170165.1| Bifunctional DNA primase/polymerase [Deinococcus maricopensis DSM
           21211]
 gi|319754743|gb|ADV66500.1| Bifunctional DNA primase/polymerase [Deinococcus maricopensis DSM
           21211]
          Length = 630

 Score = 38.2 bits (87), Expect = 0.97,   Method: Composition-based stats.
 Identities = 24/224 (10%), Positives = 53/224 (23%), Gaps = 44/224 (19%)

Query: 29  DVDVLD---EQVVDRFNNE--FQSCCGKPISRVGQAPKTLMLFRMQETN----------- 72
           D+D  D   E+      +     +    P    G+     + +R+ +             
Sbjct: 74  DIDRDDLAREEFAKHGLDLDAMIAVHPHPTQAKGKK----LWYRLPDDLDLPGVRAFQLP 129

Query: 73  ----LKKQKSEEKIQGHLEFLA------YGQQFVAYNI-HPKTQ----------RAYTWS 111
               +     + +     E  A         Q  A    HP+ +          R Y WS
Sbjct: 130 NPDNVDPITGQPRPMTIFELRASPRDGSKSVQDAAPGSLHPEPEYRHGDAHPHPRYYIWS 189

Query: 112 IAPHALKVEELPLLTPDEVEYF-FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEI 170
                   E++P      ++ +          PR   +    ++   +S      +    
Sbjct: 190 ADGAPTTREDIPEAPQALLDLYQVLRPSPDLAPRPTARRRSVIALPTRSGARANSSARYA 249

Query: 171 RAFLSCFGEEFYNGSHDEWIPVVM--AIHYETRGSAEGKEIVRE 212
                          +            H +   +     + R+
Sbjct: 250 AWARQHVNLCEIMARYRAVDSSGQCKCTHPDHPDAQGSMHVWRD 293


>gi|167462196|ref|ZP_02327285.1| phage / plasmid primase, P4 family protein [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 582

 Score = 38.2 bits (87), Expect = 0.97,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 49/186 (26%), Gaps = 19/186 (10%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
                          GI    +   DVD +D    D            P   V       
Sbjct: 30  EWARKLPEYA-----GILAEDIILVDVDDMD--TSDTLLQIVDDLA-IPCFVVDTTRGKH 81

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP 123
            LFR  E +  K K++  +   ++     +    Y I      A  W          ELP
Sbjct: 82  FLFRNSEVSTNKTKTKTAVGIQVDMKLGSRNS--YQILKHNGVARKWIRKC------ELP 133

Query: 124 -LLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFY 182
             L    +    +         + +   + L     +  +   +  EIR  +    +   
Sbjct: 134 DELPRWLLP--VKTNVDFNALGEGDGRNQALFNYILTLQSAGLSKDEIRETIGLINKYVV 191

Query: 183 NGSHDE 188
           +   ++
Sbjct: 192 SEPLED 197


>gi|223933203|ref|ZP_03625194.1| Bifunctional DNA primase/polymerase [Streptococcus suis 89/1591]
 gi|223898133|gb|EEF64503.1| Bifunctional DNA primase/polymerase [Streptococcus suis 89/1591]
          Length = 268

 Score = 38.2 bits (87), Expect = 1.0,   Method: Composition-based stats.
 Identities = 11/108 (10%), Positives = 30/108 (27%), Gaps = 12/108 (11%)

Query: 37  VVDRFNNE-FQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQ 93
               F     +      +     +    +  +  +    +   + K++  ++  A     
Sbjct: 74  GYSSFEEWELKQYIPATLQATTPSGGRHIFLKKPKG--VQISQDIKVRPGIDIKAHPNNY 131

Query: 94  QFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
             VA + +P+    Y W        VEE+     + ++          
Sbjct: 132 VLVAPSNNPR--GKYVW-----DQSVEEMAEAPIELLDILQAGKKPSK 172


>gi|218290889|ref|ZP_03494953.1| phage/plasmid primase, P4 family [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239156|gb|EED06358.1| phage/plasmid primase, P4 family [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 1061

 Score = 37.8 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/231 (10%), Positives = 48/231 (20%), Gaps = 28/231 (12%)

Query: 26  YAFDVDVLDEQVVDRFNNEF---------QSCCGKPISRVGQAPKTLMLFR------MQE 70
              DVD    +  D    +                   R G      + F+       + 
Sbjct: 160 VWADVDDHGNEQDDERIAQAEQALAALADLGFVPSAEVRSGGGRGRHVYFKFIRSEGAKT 219

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYNI-HPKTQR--AYTWSIAPHA--LKVEELPLL 125
                +K    +   L      +        H K+ R     W++         E L   
Sbjct: 220 VRAIGRKLAMLLGSDLSVAEPARIMRLPGSMHTKSGRIIQVEWTVRRDEARYDPEALEAA 279

Query: 126 TPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGS 185
             +  +      D         +            +  +     I      +  E    +
Sbjct: 280 IEEVAKSLGIDLDAPEPSSSSGREEIMGDWAPIPLDFVKEQLPTICPRFEAYVREPNIVT 339

Query: 186 HDEWIPVVMAIHYETRGSAEGKEIVREWCKLGR-----TYDEKSFNAKWDS 231
              W  +   +      S+       EW K         Y+      K+  
Sbjct: 340 EPAWYQMACVLKALNPDSSSLF---HEWSKAYDVGPNKRYNWSEAERKFRG 387


>gi|322417789|ref|YP_004197012.1| Bifunctional DNA primase/polymerase [Geobacter sp. M18]
 gi|320124176|gb|ADW11736.1| Bifunctional DNA primase/polymerase [Geobacter sp. M18]
          Length = 643

 Score = 37.8 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 33/110 (30%), Gaps = 20/110 (18%)

Query: 6   VDHYVYNGFGILCGIGTH--PVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
            + +   G GI  G+ +    +   D             N+ +   G   S +      +
Sbjct: 262 WEKHPTKGIGIRTGVRSGIVGLLFADH---------GLLNQLRGKYGPLSSTMIDGRHPI 312

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKT--QRAYTWS 111
           + FR        QK        LE LAY  +   +   P T   R   W 
Sbjct: 313 LCFRAPAEKFPSQK-------ILEGLAYIGEDDCFPAPPSTVDGRKLGWE 355


>gi|32481504|gb|AAP84036.1| hypothetical protein [Streptococcus suis]
          Length = 236

 Score = 37.5 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/108 (10%), Positives = 30/108 (27%), Gaps = 12/108 (11%)

Query: 37  VVDRFNNE-FQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLA--YGQ 93
               F     +      +     +    +  +  +    +   + K++  ++  A     
Sbjct: 42  GYSSFEEWELKQYIPATLQATTPSGGRHIFLKKPKG--VQISQDIKVRPGIDIKAHPNNY 99

Query: 94  QFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTIT 141
             VA + +P+    Y W        VEE+     + ++          
Sbjct: 100 VLVAPSNNPR--GKYVW-----DQSVEEMAEAPIELLDILQAGKKPSK 140


>gi|291444711|ref|ZP_06584101.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291347658|gb|EFE74562.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 195

 Score = 37.5 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 23/90 (25%), Gaps = 5/90 (5%)

Query: 12  NGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQ 69
            G G +       V   D+D    +      +        G     V ++   L L+   
Sbjct: 88  AGLGFVL--NGDGVVCLDLDHCLDEHGEPAGWARTILDAAGPTWVEVSRSGDGLHLWGYG 145

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
                + +      G +E    G+      
Sbjct: 146 TLPHGR-RITVGGGGSVELYGTGRYIAVTG 174


>gi|169829605|ref|YP_001699763.1| hypothetical protein Bsph_4172 [Lysinibacillus sphaericus C3-41]
 gi|168994093|gb|ACA41633.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41]
          Length = 861

 Score = 37.5 bits (85), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/92 (11%), Positives = 26/92 (28%), Gaps = 2/92 (2%)

Query: 9   YVYNGFGILCGIGTHPVYAFDVD-VLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR 67
             YNG G +           D+D   +  V +                        ++ +
Sbjct: 83  GRYNGIGFMF-TQNDEYIGIDIDNCYENGVFNEVATSVIDSLDSYTEFSPSKTGVHLIVK 141

Query: 68  MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
            +  +      ++  +  +E  +YG+ F    
Sbjct: 142 GKMPDWVSGTGKKSSKYGIEIYSYGRYFTFTG 173


>gi|294633257|ref|ZP_06711816.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292831038|gb|EFF89388.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 400

 Score = 37.5 bits (85), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/105 (13%), Positives = 27/105 (25%), Gaps = 12/105 (11%)

Query: 51  KPISRVGQAPKTLMLFRMQETNLKKQKSEEKI-----QGHLEFLAYGQQFVAYNIHPKTQ 105
             +     +    + +R  + + + + S            ++  A G   VA       Q
Sbjct: 157 DTLRVRTPSGGLHVWYRNPDPDTRLRCSTGSGSRAALAWQVDVRADGGYIVAPTT-RTAQ 215

Query: 106 RAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSY 150
             Y        +    LP   PD +         +  P   E   
Sbjct: 216 GVYR------PVGSTRLPAPLPDWLRDELVRTGHLVAPTPSEPPD 254


>gi|284504212|ref|YP_003406927.1| helicase origin-binding-protein [Marseillevirus]
 gi|282935650|gb|ADB03965.1| helicase origin-binding-protein [Marseillevirus]
          Length = 1173

 Score = 37.5 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
             ++E   FL     +     + +W  V   I   T+    G E++RE+      YDE+ 
Sbjct: 385 QEDVEHLRFLLSGLSDERRKDYSKWCEVAFFIFGITKDLEVGAELLREFSMESDGYDERR 444

Query: 225 FNAKWDS 231
           F  +W S
Sbjct: 445 F-DEWIS 450


>gi|219111929|ref|XP_002177716.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410601|gb|EEC50530.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 779

 Score = 37.5 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/79 (11%), Positives = 22/79 (27%), Gaps = 3/79 (3%)

Query: 28  FDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLE 87
            D+D               +   +  +  G+  +    F +      +  +       ++
Sbjct: 242 LDIDYSTRTSFLPAAASAATSLPQTPTNTGRKNRKAFFFGVARDGWVRPPNFVGGGIGMD 301

Query: 88  FL-AYGQQFVAYN--IHPK 103
                 QQ + +   IHP 
Sbjct: 302 TYDGREQQRLPWPYNIHPS 320


>gi|310818529|ref|YP_003950887.1| hypothetical protein STAUR_1256 [Stigmatella aurantiaca DW4/3-1]
 gi|309391601|gb|ADO69060.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 191

 Score = 37.1 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 8/52 (15%), Positives = 17/52 (32%), Gaps = 4/52 (7%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPH----ALKVEELPLLTPDEVEYFFEF 136
               +  V   + P T   Y +   P+     L++  +PL+    +      
Sbjct: 101 RWNSRIIVIPGLPPVTGGPYRFLRHPNYVAVVLELLAVPLIHGAWLTALVFT 152


>gi|295397650|ref|ZP_06807725.1| phage protein [Aerococcus viridans ATCC 11563]
 gi|294974113|gb|EFG49865.1| phage protein [Aerococcus viridans ATCC 11563]
          Length = 269

 Score = 37.1 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 35/114 (30%), Gaps = 12/114 (10%)

Query: 17  LCGIGTHPVYAFDVDVLDEQV--------VDRFNNEFQSCCGKPISRVGQAPKTLMLFRM 68
           + G  T  ++  D+D   +           + F  E          +V  +    ++F+ 
Sbjct: 52  VLGCLTRDLWCIDIDKDHKDGQNGFESIEANPFAEEILKNATNTFRQVTPSGGLHLIFKK 111

Query: 69  QETNLKKQKSEEKIQGHLEFLA-YGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           +      QK        ++  A     FV       ++  YT +  P A    E
Sbjct: 112 KNDVNYGQKL--GYLDGVDIKAHNNNYFVFAGSV-TSKGTYTNNEKPPAFYDGE 162


>gi|239941271|ref|ZP_04693208.1| hypothetical protein SrosN15_09776 [Streptomyces roseosporus NRRL
           15998]
 gi|239987727|ref|ZP_04708391.1| hypothetical protein SrosN1_10513 [Streptomyces roseosporus NRRL
           11379]
          Length = 136

 Score = 37.1 bits (84), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 23/90 (25%), Gaps = 5/90 (5%)

Query: 12  NGFGILCGIGTHPVYAFDVDV--LDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQ 69
            G G +       V   D+D    +      +        G     V ++   L L+   
Sbjct: 29  AGLGFVL--NGDGVVCLDLDHCLDEHGEPAGWARTILDAAGPTWVEVSRSGDGLHLWGYG 86

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
                + +      G +E    G+      
Sbjct: 87  TLPHGR-RITVGGGGSVELYGTGRYIAVTG 115


>gi|83859126|ref|ZP_00952647.1| general secretion pathway protein K [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852573|gb|EAP90426.1| general secretion pathway protein K [Oceanicaulis alexandrii
           HTCC2633]
          Length = 335

 Score = 37.1 bits (84), Expect = 2.2,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 49/200 (24%), Gaps = 20/200 (10%)

Query: 23  HPVYAFDVDVLDE---QVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSE 79
           + + A D D  D    +         +         +G           Q T+      +
Sbjct: 109 NALVAPDTDGDDPLEREARSSDIQWLRQAFLSLSLELGVPAGEAETLLAQITDWID-ADQ 167

Query: 80  EKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPH--ALKVEELPLLTPDEVEY----F 133
               G  E   YG             + Y  +  P     ++  LP++TP          
Sbjct: 168 SAEPGGAEDRTYGAYA----------QPYRAANQPFVELEELRALPVMTPSLYAAYRPVL 217

Query: 134 FEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVV 193
                    P +        S +  +  +      +    L       Y+ + D W   +
Sbjct: 218 CVLPLAEQPPLNINTLSLDQSLLLSALVHEDLDPADAETVLFRRPPAGYDSAEDVWADPL 277

Query: 194 MAIHYETRGSAEGKEIVREW 213
           MA    +        +   W
Sbjct: 278 MAQLDLSDAEKTRLTLRSRW 297


>gi|85375274|ref|YP_459336.1| glycosyl transferase, group 1 family protein [Erythrobacter
           litoralis HTCC2594]
 gi|84788357|gb|ABC64539.1| glycosyl transferase, group 1 family protein [Erythrobacter
           litoralis HTCC2594]
          Length = 395

 Score = 37.1 bits (84), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 30/87 (34%), Gaps = 10/87 (11%)

Query: 22  THPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEK 81
           +  +   D D  D  V           C  PI+ +G+       + ++     ++ + E 
Sbjct: 36  SQHLLTLD-DPSDPWVAA---------CPSPIAAMGRPGPRKRFYPVRAIRWLRRHAREF 85

Query: 82  IQGHLEFLAYGQQFVAYNIHPKTQRAY 108
               ++ L  G    A  + P +  AY
Sbjct: 86  DGVVVDGLWNGSTLAARRVLPGSGIAY 112


>gi|313114054|ref|ZP_07799607.1| nucleoside triphosphatase, D5 family [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623624|gb|EFQ07026.1| nucleoside triphosphatase, D5 family [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 799

 Score = 36.7 bits (83), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 26/100 (26%), Gaps = 10/100 (10%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVD-VLDEQVV--DRFNNEFQSCCGKPISRVGQA 59
              V  +   G G+L G     +   D+D   D           E               
Sbjct: 48  QAAVSRFGLRGVGVLLG---DGLCGIDIDHCRDPDTGVLSDMAREIIDGMQTYAEESPSG 104

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
               +LF  Q+     +KS       LE    G+ F    
Sbjct: 105 TGVHLLFTGQKPAGACRKSSIG----LEMYDGGRYFTVTG 140


>gi|257076832|ref|ZP_05571193.1| hypothetical protein Faci_07211 [Ferroplasma acidarmanus fer1]
          Length = 324

 Score = 36.7 bits (83), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 41/159 (25%), Gaps = 20/159 (12%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQET 71
             +G++           D D        +  N   S         G       LF +++ 
Sbjct: 86  GNWGLMH--PAGMSIGIDEDNE------KIRNAALSLGDTARFNTGTPGHFCDLFLIKDE 137

Query: 72  NLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELP--LLTPDE 129
            +      +           G Q +           Y       ++ +  +P  ++T  E
Sbjct: 138 PVGNIPLIDGAY----IRGKGGQNLGPGSIHPNGNIY------GSIYLHLVPPVVVTKSE 187

Query: 130 VEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNI 168
           +   F+ +        K  S  +  +    ++      I
Sbjct: 188 LLEVFKPYIKGKEKLSKNDSKPEYKQPLNPYSLTMKDLI 226


>gi|167892250|ref|ZP_02479652.1| metallophosphoesterase [Burkholderia pseudomallei 7894]
 gi|167917006|ref|ZP_02504097.1| metallophosphoesterase [Burkholderia pseudomallei BCC215]
          Length = 376

 Score = 36.7 bits (83), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/107 (13%), Positives = 29/107 (27%), Gaps = 4/107 (3%)

Query: 14  FGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNL 73
            G+  G     + A D+D  +    +R                 +       +       
Sbjct: 157 IGLAHGSVQ-GILAEDIDATNPIAPERSALARLDYLALGDWHGTKQIGDRTWYSGTPETD 215

Query: 74  KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
           + + ++      +E  A G       + P T   Y W      L++ 
Sbjct: 216 RFRNNDSGQVLLVELAAPG---AVPTVTPITTGRYRWRYIERELQLA 259


>gi|146087218|ref|XP_001465760.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134069860|emb|CAM68187.1| putative mitochondrial DNA primase [Leishmania infantum JPCM5]
          Length = 684

 Score = 36.7 bits (83), Expect = 2.8,   Method: Composition-based stats.
 Identities = 7/34 (20%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 201 RGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
              AE  +   E  +     +      A+W +FD
Sbjct: 568 PAMAEMLDAWTEASRKCPLKFHSGECEARWAAFD 601


>gi|313667338|ref|YP_004049739.1| hypothetical protein Ocepr_2371 [Oceanithermus profundus DSM 14977]
 gi|313153969|gb|ADR37819.1| hypothetical protein Ocepr_2371 [Oceanithermus profundus DSM 14977]
          Length = 282

 Score = 36.7 bits (83), Expect = 2.9,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 46/192 (23%), Gaps = 29/192 (15%)

Query: 13  GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQS---CCGKPISRVGQAPKTLMLFRMQ 69
           G G +       +   D+D + +    R +   +      G             +  R +
Sbjct: 65  GIGFV--FAGDGIVGVDLDGVRDPETGRLDAWAEEIVVRLGSFAEVSPSGRGLHIFLRGE 122

Query: 70  ETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
               ++++   ++     F  +    V    H                 +   P      
Sbjct: 123 IPGERRRRGPVEVYEKDRFFTFTGAVVPGAPH----------------TINADPDALAWL 166

Query: 130 VEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEW 189
            + + +       P  + K     S             +E R F S  GE         W
Sbjct: 167 YQTYLD-------PPQERKPPSSRSLTSTYEPADDQVVLE-RMFRSKHGERNRALWEGRW 218

Query: 190 IPVVMAIHYETR 201
             +  A   E  
Sbjct: 219 QELGYASQSEAD 230


>gi|5852135|emb|CAB55379.1| hypothetical protein L7836.04 [Leishmania major]
          Length = 679

 Score = 36.7 bits (83), Expect = 2.9,   Method: Composition-based stats.
 Identities = 7/34 (20%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 201 RGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
              AE  +   E  +     +      A+W +FD
Sbjct: 563 PAMAEMLDAWTEASRKCPLKFHSGECEARWAAFD 596


>gi|322499209|emb|CBZ34280.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 684

 Score = 36.7 bits (83), Expect = 2.9,   Method: Composition-based stats.
 Identities = 7/34 (20%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 201 RGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
              AE  +   E  +     +      A+W +FD
Sbjct: 568 PAMAEMLDAWTEASRKCPLKFHSGECEARWAAFD 601


>gi|94985425|ref|YP_604789.1| bifunctional nicotinamide mononucleotide
           adenylyltransferase/ADP-ribose pyrophosphatase
           [Deinococcus geothermalis DSM 11300]
 gi|94555706|gb|ABF45620.1| Cytidyltransferase-related protein [Deinococcus geothermalis DSM
           11300]
          Length = 311

 Score = 36.3 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 38/162 (23%), Gaps = 7/162 (4%)

Query: 55  RVGQAPKTLMLFR-MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAY-TWSI 112
           R     +  +LFR + +    +  + +      E                   AY  W  
Sbjct: 67  RETGVRRGRVLFRPLPDRFNAELWAADVRAAAAEVFGPETPVQLVGFEKDASTAYLRWFP 126

Query: 113 APHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRA 172
           A   L   ELP L   ++   +     +                      R         
Sbjct: 127 AWERLPAPELPGLNATDLRAAWLTGRPLPEGVPPPVRAFLARFAVTPAFIRLQAEWAAVE 186

Query: 173 FLSCFGEEFYNGSHDEWIPVVMA---IHYETRGSAEGKEIVR 211
                     +   + W+ V      +H  TR    G+ +  
Sbjct: 187 AARAVLPPGVHLHEERWLHVAQGQVWLH--TRQDDIGRGLWE 226


>gi|77360464|ref|YP_340039.1| hypothetical protein PSHAa1523 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76875375|emb|CAI86596.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 554

 Score = 36.3 bits (82), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 25/69 (36%), Gaps = 6/69 (8%)

Query: 41  FNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
            N        +   R+G       L+R +  +    +S + I+  + +   G     Y  
Sbjct: 152 INALPHELGPQSPYRMGAK-----LYREKHKDH-LLRSTDNIKPGVMYNGDGHTIDVYLA 205

Query: 101 HPKTQRAYT 109
           HPKT + Y 
Sbjct: 206 HPKTGKPYR 214


>gi|319762282|ref|YP_004126219.1| primase 2 [Alicycliphilus denitrificans BC]
 gi|317116843|gb|ADU99331.1| Primase 2 [Alicycliphilus denitrificans BC]
          Length = 650

 Score = 36.3 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 10/67 (14%), Positives = 19/67 (28%), Gaps = 7/67 (10%)

Query: 165 YTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKS 224
           +   +    L        +   + W+ V MA       +  G +    W      Y+  +
Sbjct: 2   HDTAKAIDALHSIPP---DIDRESWVRVAMA----ANAAGVGFDDFDAWSAGAGNYNAAA 54

Query: 225 FNAKWDS 231
               W S
Sbjct: 55  SRDVWRS 61


>gi|307330207|ref|ZP_07609355.1| Bifunctional DNA primase/polymerase [Streptomyces violaceusniger Tu
           4113]
 gi|306884113|gb|EFN15151.1| Bifunctional DNA primase/polymerase [Streptomyces violaceusniger Tu
           4113]
          Length = 342

 Score = 36.3 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 14/137 (10%), Positives = 28/137 (20%), Gaps = 42/137 (30%)

Query: 2   VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLD-------------------------- 34
           +        +  G+GI CG   + +   D+D+ D                          
Sbjct: 68  IRALFAAAPWATGYGIACGRAPYHLIGLDLDLKDGRPGRPRGPGGAGATDGRARTRKPGA 127

Query: 35  -------------EQVVDRFNNEFQSCCGKPISRVG--QAPKTLMLFRMQETNLKKQKSE 79
                           +       +         V          L+      L    S 
Sbjct: 128 SGKDGTDSTDGLTADGLAALARLAREHAFAIPLTVTVLTPSGGRHLWLCGPPGLAVPNSA 187

Query: 80  EKIQGHLEFLAYGQQFV 96
            ++   ++    G   V
Sbjct: 188 GRLAPGIDIRGLGGYLV 204


>gi|260835842|ref|XP_002612916.1| hypothetical protein BRAFLDRAFT_94199 [Branchiostoma floridae]
 gi|229298298|gb|EEN68925.1| hypothetical protein BRAFLDRAFT_94199 [Branchiostoma floridae]
          Length = 961

 Score = 36.3 bits (82), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/150 (10%), Positives = 36/150 (24%), Gaps = 16/150 (10%)

Query: 41  FNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLK---------------KQKSEEKIQGH 85
           F          P   + Q P    +FR  E   K               + K E+     
Sbjct: 136 FPAWDPVMPSVPPITIKQEPPDEPVFRKPEPPAKGKSVKSRLHNKITQNRLKKEDMNCHQ 195

Query: 86  LEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRD 145
           L   +     V       +   +   + P    +   P ++      +          R 
Sbjct: 196 LPTFSTSHMTVPPPSPHLSLHPFHTGMMPFHPSIPPSP-MSYPLPPPYIPPTVPFMPTRP 254

Query: 146 KEKSYRKLSKIWKSHNNRRYTNIEIRAFLS 175
           ++        + ++  +     +++     
Sbjct: 255 RKPRKCVQKYLHEARRSEVRRLMKLLQCRE 284


>gi|157869704|ref|XP_001683403.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68126468|emb|CAJ04379.1| putative mitochondrial DNA primase [Leishmania major strain
           Friedlin]
          Length = 532

 Score = 36.3 bits (82), Expect = 3.6,   Method: Composition-based stats.
 Identities = 7/34 (20%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 201 RGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
              AE  +   E  +     +      A+W +FD
Sbjct: 416 PAMAEMLDAWTEASRKCPLKFHSGECEARWAAFD 449


>gi|258511071|ref|YP_003184505.1| DNA primase small subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477797|gb|ACV58116.1| DNA primase small subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 1036

 Score = 36.3 bits (82), Expect = 3.7,   Method: Composition-based stats.
 Identities = 23/218 (10%), Positives = 56/218 (25%), Gaps = 24/218 (11%)

Query: 31  DVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFR----MQETNLKKQKSEEKIQGHL 86
           D  +  +               + + G      + F+    +  T  K+  ++       
Sbjct: 176 DQAERALAFLSER---GVVPSAVVKSGGGRGRHVYFKFTCSVDGTTGKRIAAKLAKLLGS 232

Query: 87  E--FLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTP 143
           +       +        H K+ R    SI     +    P      ++          + 
Sbjct: 233 DPNVADAARVMRIPGSMHTKSGRIVKVSIESWHKEAHYNPEAFEAAIDEIAHALGIDVSR 292

Query: 144 RDKEKSYRKLSKIWKSHNNRRYTNIE-----IRAFLSCFGEEFYNGSHDEWIPVVMAIHY 198
            +   + R+  +            +E     I A    + ++    S   W  +   +  
Sbjct: 293 TEPFLTPRENVECMGDWKPVPAEFVEEQLPTICARFKAYVQDPNIVSEPVWHKMASLLKA 352

Query: 199 ETRGSAEGKEIVREWCKL-----GRTYDEKSFNAKWDS 231
               S     +  +W +      G+ Y+      K+ S
Sbjct: 353 MNPDS----SLFHKWSEGYDAGPGKRYNWGEAERKFRS 386


>gi|258510492|ref|YP_003183926.1| ATPase-like protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477218|gb|ACV57537.1| ATPase-like protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 1039

 Score = 36.3 bits (82), Expect = 3.8,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 59/229 (25%), Gaps = 30/229 (13%)

Query: 29  DVDV----LDEQVVDRFNNEF-----QSCCGKPISRVGQAPKTLMLFR----MQETNLKK 75
           DVD      DE+ + +          +      + R G      + F+    +     ++
Sbjct: 163 DVDDHGREDDEERMAQAERVLVMLAEKGFVPSAVVRSGGGRGRHLYFKFMRPVDPETGRR 222

Query: 76  Q--KSEEKIQGHLEFLAYGQQFVAYNI-HPKTQRAYTWSIAPHALKVEELPLLTPDEVEY 132
              K  + +   L      +        H +  R    ++          P      ++ 
Sbjct: 223 IVWKLAKVLSSDLNVADVARVMRIPGSMHTRAGRIVKVTVEELRKDALYRPDELETAIDE 282

Query: 133 FFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE-----IRAFLSCFGEEFYNGSHD 187
             E      T  +   S    ++            +E     I A    + ++    S  
Sbjct: 283 IAEALGVDLTRTESVPSVSDGAEFTGDWKPVPAEFVEEQLPTICARFKAYVQDPNIVSEP 342

Query: 188 EWIPVVMAIHYETRGSAEGKEIVREWCKL-----GRTYDEKSFNAKWDS 231
            W  +   +      S     +  +W +       + Y+      K+ S
Sbjct: 343 IWHKMACLLKSMNPDS----SLFHKWSEGYDMGPDKRYNWSETERKFRS 387


>gi|319441591|ref|ZP_07990747.1| D-tyrosyl-tRNA(Tyr) deacylase [Corynebacterium variabile DSM 44702]
          Length = 157

 Score = 36.3 bits (82), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/100 (14%), Positives = 24/100 (24%), Gaps = 2/100 (2%)

Query: 31  DVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLA 90
           D      +       +         V +    L +           +         E L 
Sbjct: 28  DGAGRGALLALVGVGREDAPDAWRTVARKIADLRILPAPGEPWDGVRGSGAADNGAEILV 87

Query: 91  YGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEV 130
              QF          R  +WS A      E++  L  D++
Sbjct: 88  VS-QFTLMGA-TAKGRRPSWSAAAPGQDAEKVIDLLVDDL 125


>gi|84490091|ref|YP_448323.1| hypothetical protein Msp_1303 [Methanosphaera stadtmanae DSM
          3091]
 gi|84373410|gb|ABC57680.1| FrhD [Methanosphaera stadtmanae DSM 3091]
          Length = 157

 Score = 35.9 bits (81), Expect = 3.9,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 21/75 (28%), Gaps = 6/75 (8%)

Query: 20 IGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLK----- 74
          +G   +   D D    +V++          G      G       +F + +   K     
Sbjct: 10 VGCGNILFGD-DGFGPKVIEYMKENNVEIPGDTCLIDGGTSAPHYIFTLPQDKWKNIIII 68

Query: 75 KQKSEEKIQGHLEFL 89
                K  G +E L
Sbjct: 69 DIALLNKKPGTIEVL 83


>gi|281421921|ref|ZP_06252920.1| VirE protein [Prevotella copri DSM 18205]
 gi|281403975|gb|EFB34655.1| VirE protein [Prevotella copri DSM 18205]
          Length = 295

 Score = 35.9 bits (81), Expect = 4.4,   Method: Composition-based stats.
 Identities = 18/212 (8%), Positives = 54/212 (25%), Gaps = 27/212 (12%)

Query: 23  HPVYAFDVDVLDEQVVDRFNNEFQSCC--GKPISRVGQAPKTLMLFRMQETNLKKQKSEE 80
             +   D+D  +   +  +N   +      +            +                
Sbjct: 80  SGLICVDMDAKENPAISDWNAVKEQLAVIPQIAYCSLSVSGNGL--------FAVIPLRY 131

Query: 81  KIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTI 140
             +  L+F      F    I      +    +   +      P++  + + Y   + +  
Sbjct: 132 PEKHLLQFRQLQHDFYRMGITIDAACSDITRMRCVSYDAH--PIINENAIPYEGIYMEPP 189

Query: 141 TTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYN--GSHDEWIPVVMAIHY 198
              R       + +              E+ A      +   +    +D+W+ V  ++  
Sbjct: 190 KVRRYLSYRNIREN----------DILSEVAACCKQIEQRGIDITDGYDQWLKVGCSL-- 237

Query: 199 ETRGSAEGKEIVREWCKLGRTYDEKSFNAKWD 230
                 +G++      +    Y+E   +  + 
Sbjct: 238 -ATLGEDGRDFFHLCSQQSMDYNESKTDKMFS 268


>gi|9885250|emb|CAC04162.1| hypothetical protein [Lactococcus phage phi31]
          Length = 268

 Score = 35.9 bits (81), Expect = 4.4,   Method: Composition-based stats.
 Identities = 11/144 (7%), Positives = 31/144 (21%), Gaps = 16/144 (11%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAF--DVDVLDEQVVDRFNNEFQSCCGKPISRVGQA 59
           +             + C            D++  +          ++      +S+   +
Sbjct: 43  IKDFWKQNPTANLAMKCDKFVVVDVDVHNDINGYESIQPLLDEEWWK----PTLSQTTAS 98

Query: 60  PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY-GQQFVAYNIHPKTQRAYTWSIAPHALK 118
                 F  +E               ++  A+     V      +  + Y W        
Sbjct: 99  GGKQYFFLKREDMA--VTQRIGFLKGVDIKAHENNYVVIPPSVTRKGQ-YKWDNQL---- 151

Query: 119 VEELPLLTPDEVEYFFEFFDTITT 142
              +     + +    +  D  T 
Sbjct: 152 --PIITAPKELIREIMKNRDNYTH 173


>gi|284990051|ref|YP_003408605.1| bifunctional DNA primase/polymerase [Geodermatophilus obscurus DSM
           43160]
 gi|284063296|gb|ADB74234.1| Bifunctional DNA primase/polymerase [Geodermatophilus obscurus DSM
           43160]
          Length = 400

 Score = 35.5 bits (80), Expect = 5.1,   Method: Composition-based stats.
 Identities = 8/104 (7%), Positives = 20/104 (19%), Gaps = 9/104 (8%)

Query: 2   VATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQ-----VVDRFNNEFQSCCGKPISRV 56
           +        +   GI  G   +     D D    +     +               + R 
Sbjct: 75  ITKWWTDEPFANIGIPQGRI-NQTGVIDHDRKHGERPRLQLAAHLRTVGVEVSRGIVVRT 133

Query: 57  GQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNI 100
                    + +         +       ++    G   +A   
Sbjct: 134 --PFGEHEWYLLPRGGQSG-TTCHPYVPGVDLQLDGTYVLAPPS 174


>gi|326774777|ref|ZP_08234042.1| Isoprenylcysteine carboxyl methyltransferase [Streptomyces cf.
           griseus XylebKG-1]
 gi|326655110|gb|EGE39956.1| Isoprenylcysteine carboxyl methyltransferase [Streptomyces cf.
           griseus XylebKG-1]
          Length = 177

 Score = 35.5 bits (80), Expect = 5.2,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 4/53 (7%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE----ELPLLTPDEVEYFFEFF 137
               +  V   +   T   Y W   P+ + V      LPL+    V       
Sbjct: 98  RWNTRVIVVPGLPRVTGGPYRWLSHPNYVAVAAEGIALPLVYGAWVTALVFTA 150


>gi|256833376|ref|YP_003162103.1| hypothetical protein Jden_2163 [Jonesia denitrificans DSM 20603]
 gi|256686907|gb|ACV09800.1| conserved hypothetical protein [Jonesia denitrificans DSM 20603]
          Length = 189

 Score = 35.5 bits (80), Expect = 5.2,   Method: Composition-based stats.
 Identities = 12/89 (13%), Positives = 29/89 (32%), Gaps = 9/89 (10%)

Query: 13  GFGILCGIGTHPVYAFDVD--VLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQE 70
           G G + G     V   D+D  +++ ++     +    C    +          +   ++E
Sbjct: 88  GIGFVLG---DGVGCIDLDHCIVNGELQGWARDILDRCPPTFVEVSQSGTGLHIFGLLRE 144

Query: 71  TNLKKQKSEEKIQGHLEFLAYGQQFVAYN 99
              + Q+        +EF + G+      
Sbjct: 145 GKGRGQRG----GDGVEFYSTGRYIAVTG 169


>gi|182434264|ref|YP_001821983.1| methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|178462780|dbj|BAG17300.1| methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 177

 Score = 35.5 bits (80), Expect = 5.2,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 4/53 (7%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE----ELPLLTPDEVEYFFEFF 137
               +  V   +   T   Y W   P+ + V      LPL+    V       
Sbjct: 98  RWNTRVIVVPGLPRVTGGPYRWLSHPNYVAVAAEGIALPLVHGAWVTALVFTA 150


>gi|302544509|ref|ZP_07296851.1| putative integral membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302462127|gb|EFL25220.1| putative integral membrane protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 345

 Score = 35.5 bits (80), Expect = 5.2,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 30/96 (31%), Gaps = 8/96 (8%)

Query: 34  DEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQ 93
                    +   +  G            + ++R  E  + K  +    Q  +++    +
Sbjct: 100 GPDGNVYVGDIGDNLGGTWP--------HVWIYRFPEPKVLKNTTVTATQFTVKYEGGAR 151

Query: 94  QFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDE 129
              A  +HPKT R Y  S +     + E P     +
Sbjct: 152 NAEAMMVHPKTGRVYIASKSDDDPGLYEAPATLSAQ 187


>gi|115372824|ref|ZP_01460129.1| isoprenylcysteine carboxyl methyltransferase (icmt) family
           [Stigmatella aurantiaca DW4/3-1]
 gi|115370091|gb|EAU69021.1| isoprenylcysteine carboxyl methyltransferase (icmt) family
           [Stigmatella aurantiaca DW4/3-1]
          Length = 564

 Score = 35.5 bits (80), Expect = 5.3,   Method: Composition-based stats.
 Identities = 8/52 (15%), Positives = 17/52 (32%), Gaps = 4/52 (7%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPH----ALKVEELPLLTPDEVEYFFEF 136
               +  V   + P T   Y +   P+     L++  +PL+    +      
Sbjct: 474 RWNSRIIVIPGLPPVTGGPYRFLRHPNYVAVVLELLAVPLIHGAWLTALVFT 525


>gi|260429685|ref|ZP_05783661.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419168|gb|EEX12422.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 517

 Score = 35.5 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 10/30 (33%)

Query: 203 SAEGKEIVREWCKLGRTYDEKSFNAKWDSF 232
             EG  +  EW       +  +    W SF
Sbjct: 8   GEEGATLFAEWSGQAAKNNPAATAKAWASF 37


>gi|254387537|ref|ZP_05002776.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|197701263|gb|EDY47075.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 283

 Score = 35.5 bits (80), Expect = 5.8,   Method: Composition-based stats.
 Identities = 16/177 (9%), Positives = 38/177 (21%), Gaps = 36/177 (20%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A D     +   G+    G   +   D+D              +    +    V      
Sbjct: 82  AADW----HRATGLAYHPGGAGLTIVDLDD------AAAIAWARRTLPRT-VTVATTRGE 130

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
             ++R         +S   ++  ++  +                   W   P    +  L
Sbjct: 131 HWIYR------GTMRSANAVRPGVDIKSTMAYA-------------RWL-GPGTGAMIHL 170

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEK-----SYRKLSKIWKSHNNRRYTNIEIRAFL 174
           P +    V                        +R    + +          + R+ +
Sbjct: 171 PDVVRALVVKATAPRTASLPAVPLPGGGGACPHRTPVFLERGIAMAEQHIADARSAI 227


>gi|333024183|ref|ZP_08452247.1| hypothetical protein STTU_1687 [Streptomyces sp. Tu6071]
 gi|332744035|gb|EGJ74476.1| hypothetical protein STTU_1687 [Streptomyces sp. Tu6071]
          Length = 217

 Score = 35.5 bits (80), Expect = 5.9,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 28/127 (22%), Gaps = 11/127 (8%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDV-DVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
                +      +  G       AFDV DV +           +         +    + 
Sbjct: 81  AAWSRWPGAALMLPVGS------AFDVLDVAERAGRHALARLERMGLPPGPVALTPQGRA 134

Query: 63  LMLFR----MQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALK 118
                         L  +   +  +  L  L  G    A       +   +W  AP    
Sbjct: 135 QFYVAPGSAAALPRLLARAGWDDARLDLRALGTGAYVTAPPSDRGGRGPVSWLRAPSLDT 194

Query: 119 VEELPLL 125
               P +
Sbjct: 195 ALRPPEV 201


>gi|327310553|ref|YP_004337450.1| peptidase M1, membrane alanine aminopeptidase [Thermoproteus
           uzoniensis 768-20]
 gi|326947032|gb|AEA12138.1| peptidase M1, membrane alanine aminopeptidase [Thermoproteus
           uzoniensis 768-20]
          Length = 823

 Score = 35.5 bits (80), Expect = 5.9,   Method: Composition-based stats.
 Identities = 23/198 (11%), Positives = 44/198 (22%), Gaps = 31/198 (15%)

Query: 29  DVDVLDEQVVDRFNNEFQSCCGKPISRV--GQAPKTLML-------------FRMQETNL 73
           D DVL        +   +   G    RV   +  + +ML             +      +
Sbjct: 24  DFDVLKLDADIEVDLWSREVKGVVKYRVRAKRDLRKVMLDAVELEVLGASTSYSYDGETI 83

Query: 74  K-KQKSEEKIQGHLEFLAY-----GQQFVAYNIHPKTQRAYTW-----SIAPHALKVEEL 122
                     +   E         G  FV  + H   +    W         + L + + 
Sbjct: 84  TLDLDLPAGREAEFEIRYRARPRKGIYFVLPDKHHPYRVPMAWTQGESEDNRYWLPLPDT 143

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKS-----HNNRRYTNIEIRAFLSCF 177
           P +              +          R             H    Y            
Sbjct: 144 PNIKFPWKLAITVPKPYVAGSNGVLVEVRDNGDRQTFVWEMRHPMSPYLIALAAGDFEII 203

Query: 178 GEEFYNGSHDEWIPVVMA 195
            ++  + + + W+P   A
Sbjct: 204 RDKCGDVALEYWLPRGRA 221


>gi|332863999|ref|XP_003318203.1| PREDICTED: hypothetical protein LOC100610700 [Pan troglodytes]
          Length = 383

 Score = 35.5 bits (80), Expect = 6.0,   Method: Composition-based stats.
 Identities = 16/193 (8%), Positives = 38/193 (19%), Gaps = 23/193 (11%)

Query: 40  RFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAY--GQQFVA 97
           R  N  +S    P++  G+  +  + F +          +      L             
Sbjct: 155 RTQNLLKSASPDPLAPSGRPLRAQLFFLVASPGPTPASQQPLWTQCLPISWRPWSAHSFL 214

Query: 98  YNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIW 157
               P   +A  W +    L  + +          +        + R  +      S   
Sbjct: 215 KPSSPGPGQASRWPLQDELLPSDGISR-PQMVSGRWAPPRQAWASRRPPQAQDVLKSTSP 273

Query: 158 KSHNNRRYTNIEIRAF------------------LSCFGEEFYNGSHDEWIP--VVMAIH 197
              + +      + +                                  W       A+ 
Sbjct: 274 GPASQQVSKLFWLNSCPAPNRLCRPRTFSSQALRAHFLPPGGLYRPSTGWRTASAGPALA 333

Query: 198 YETRGSAEGKEIV 210
            +    A+     
Sbjct: 334 SQGPLQAQLLPPW 346


>gi|118462462|ref|YP_879573.1| hypothetical protein MAV_0284 [Mycobacterium avium 104]
 gi|118163749|gb|ABK64646.1| hypothetical protein MAV_0284 [Mycobacterium avium 104]
          Length = 932

 Score = 35.5 bits (80), Expect = 6.1,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 62/219 (28%), Gaps = 19/219 (8%)

Query: 12  NGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQA--PKTLMLFRMQ 69
              G+  G     + A D + L             +         G      + +  R+ 
Sbjct: 53  GNVGVHLGF--SGLIALDAENLPATQHLLGAGFQLTVAPAKSRIEGNPKHQGSHVWLRVP 110

Query: 70  E--TNLKKQKSEEK------IQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEE 121
           +    +     E          G ++ LA G+  VA     +   A  W+ + +A    +
Sbjct: 111 KGIDPMALSSGERTMQVRLPGGGLIDVLAGGRYAVAPPS--QLAEAPGWAYSAYAGSPLD 168

Query: 122 LPLLTPD-EVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           L +   D EV    ++    T P  +  +  +     K+  +    +    A  +   + 
Sbjct: 169 LAVPLEDVEVAEAPKWLFDPTLPCPEPLTALRGCLAPKARRDLAELDARSVALTTEIDQV 228

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRT 219
            +     +WI     +    +    G E+          
Sbjct: 229 PWG----DWIAGDRRLSPTGQVDGCGCEVWHWTDAEHDK 263


>gi|311897855|dbj|BAJ30263.1| hypothetical protein KSE_44800 [Kitasatospora setae KM-6054]
          Length = 234

 Score = 35.5 bits (80), Expect = 6.6,   Method: Composition-based stats.
 Identities = 19/164 (11%), Positives = 37/164 (22%), Gaps = 16/164 (9%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDV-DVLDEQVVDRFNNEFQSCCG--KPISRVG 57
           +V             +  G         DV +V     + R               +  G
Sbjct: 77  VVRKWWTENPEASILLPTGRAFD---VLDVPEVAGCLALARMERMGLQLGPVVAVPAAPG 133

Query: 58  QAPKTLMLFRMQE---TNLKKQKSEEKIQGHLEF--LAYGQQFVAYNIHPKTQRAYTWSI 112
           +  + L    +           +        L+      G   VA        R   ++ 
Sbjct: 134 RTGRRLHFLVLPGVVDKLPDLLRQIGWSPERLDLVARGEGDWVVAPPS-----RVGGYAS 188

Query: 113 APHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKI 156
           A  A     L    PD +E                ++ ++ +  
Sbjct: 189 AQWARPPSALNRWLPDALELISPLAYACGREAAAPRAVQRPAAA 232


>gi|108803353|ref|YP_643290.1| glucose sorbosone dehydrogenase [Rubrobacter xylanophilus DSM 9941]
 gi|108764596|gb|ABG03478.1| glucose sorbosone dehydrogenase [Rubrobacter xylanophilus DSM 9941]
          Length = 367

 Score = 35.2 bits (79), Expect = 6.9,   Method: Composition-based stats.
 Identities = 14/89 (15%), Positives = 25/89 (28%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A  V    + G  +  G+    ++  +VD  D   V R     +   G+  + V      
Sbjct: 279 AEYVREGPWRGSILFTGLRGESLHRVEVDPEDPGRVVRHREYLEGEYGRLRTVVQGPDGA 338

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAY 91
           L L              +     +E    
Sbjct: 339 LYLLTSNRDGRGDPAPSDDRLLRVEVGGR 367


>gi|90421224|ref|ZP_01229124.1| putative virulence-associated protein E [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334537|gb|EAS48322.1| putative virulence-associated protein E [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 424

 Score = 35.2 bits (79), Expect = 7.0,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 17/68 (25%), Gaps = 6/68 (8%)

Query: 170 IRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRG---SAEGKEI-VREWCKLGRTYDEKSF 225
               L        +  + +W     A      G         +    WC      D  + 
Sbjct: 2   AHQALQSISPS--DLDYGQWRDTTAAFRQCATGHDVDEPAVRLAWDHWCSQFPNNDLAAN 59

Query: 226 NAKWDSFD 233
           +  W SFD
Sbjct: 60  DKLWRSFD 67


>gi|294815074|ref|ZP_06773717.1| Hypothetical protein SCLAV_4242 [Streptomyces clavuligerus ATCC
           27064]
 gi|326443439|ref|ZP_08218173.1| hypothetical protein SclaA2_20338 [Streptomyces clavuligerus ATCC
           27064]
 gi|294327673|gb|EFG09316.1| Hypothetical protein SCLAV_4242 [Streptomyces clavuligerus ATCC
           27064]
          Length = 280

 Score = 35.2 bits (79), Expect = 7.1,   Method: Composition-based stats.
 Identities = 16/177 (9%), Positives = 38/177 (21%), Gaps = 36/177 (20%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A D     +   G+    G   +   D+D              +    +    V      
Sbjct: 79  AADW----HRATGLAYHPGGAGLTIVDLDD------AAAIAWARRTLPRT-VTVATTRGE 127

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEEL 122
             ++R         +S   ++  ++  +                   W   P    +  L
Sbjct: 128 HWIYR------GTMRSANAVRPGVDIKSTMAYA-------------RWL-GPGTGAMIHL 167

Query: 123 PLLTPDEVEYFFEFFDTITTPRDKEK-----SYRKLSKIWKSHNNRRYTNIEIRAFL 174
           P +    V                        +R    + +          + R+ +
Sbjct: 168 PDVVRALVVKATAPRTASLPAVPLPGGGGACPHRTPVFLERGIAMAEQHIADARSAI 224


>gi|315425757|dbj|BAJ47412.1| hypothetical protein HGMM_F29F08C21 [Candidatus Caldiarchaeum
           subterraneum]
          Length = 139

 Score = 35.2 bits (79), Expect = 7.4,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 23/99 (23%), Gaps = 13/99 (13%)

Query: 4   TDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTL 63
                +     GI        +   D++         F  E +    K            
Sbjct: 44  AVFREHSGCNIGIRL----DSLTVLDIEHA-RLWRLFFETEPRELASKTWVSRTGGGGYH 98

Query: 64  MLFRMQETNLKKQKSEEKIQGHLEFL-AYGQQFVAYNIH 101
           + F       K   +  K  G+ E      Q  VA   H
Sbjct: 99  VYF-------KGSTTPSKADGYAELRSGEKQFVVAPPQH 130


>gi|154337848|ref|XP_001565150.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134062197|emb|CAM36585.1| putative mitochondrial DNA primase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 534

 Score = 35.2 bits (79), Expect = 7.9,   Method: Composition-based stats.
 Identities = 6/34 (17%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 201 RGSAEGKEIVREWCKLGR-TYDEKSFNAKWDSFD 233
              AE  +   E  +     +      A+W +F+
Sbjct: 417 PAMAEMLDAWTEASRKCPLKFHNGECEARWAAFN 450


>gi|302382355|ref|YP_003818178.1| Bifunctional DNA primase/polymerase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192983|gb|ADL00555.1| Bifunctional DNA primase/polymerase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 158

 Score = 35.2 bits (79), Expect = 8.2,   Method: Composition-based stats.
 Identities = 11/92 (11%), Positives = 27/92 (29%), Gaps = 4/92 (4%)

Query: 3   ATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKT 62
           A     Y +    +  G  +  +        D+  +      F +     +  + +  + 
Sbjct: 24  AAWARSYPHADLALRTG-VSTGLVVV--QADDDDALAAAEEAFGALPAATVRSLSREGRL 80

Query: 63  LMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQ 94
            +  R+    L+   +   I   +  LA G  
Sbjct: 81  RLWMRVPAG-LRSLPTCLDIAPGVRLLADGAY 111


>gi|239946048|ref|ZP_04697985.1| methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|239992518|ref|ZP_04713182.1| methyltransferase [Streptomyces roseosporus NRRL 11379]
 gi|291449497|ref|ZP_06588887.1| isoprenylcysteine carboxyl methyltransferase [Streptomyces
           roseosporus NRRL 15998]
 gi|291352444|gb|EFE79348.1| isoprenylcysteine carboxyl methyltransferase [Streptomyces
           roseosporus NRRL 15998]
          Length = 175

 Score = 35.2 bits (79), Expect = 8.6,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 14/53 (26%), Gaps = 4/53 (7%)

Query: 89  LAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE----ELPLLTPDEVEYFFEFF 137
               +  V   +   T   Y W   P+ + V      LPL     V       
Sbjct: 96  RWNTRVIVVPGLPRVTGGPYRWLSHPNYVAVAAEGLALPLAHGAWVTALVFTA 148


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.310    0.124    0.357 

Lambda     K      H
   0.267   0.0382    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,819,222,460
Number of Sequences: 14124377
Number of extensions: 53328229
Number of successful extensions: 203020
Number of sequences better than 10.0: 742
Number of HSP's better than 10.0 without gapping: 352
Number of HSP's successfully gapped in prelim test: 390
Number of HSP's that attempted gapping in prelim test: 201730
Number of HSP's gapped (non-prelim): 803
length of query: 233
length of database: 4,842,793,630
effective HSP length: 135
effective length of query: 98
effective length of database: 2,936,002,735
effective search space: 287728268030
effective search space used: 287728268030
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.3 bits)
S2: 78 (34.8 bits)