RPSBLAST alignment for GI: 254781191 and conserved domain: pfam10926

>gnl|CDD|151373 pfam10926, DUF2800, Protein of unknown function (DUF2800). This is a family of uncharacterized proteins found in bacteria and viruses. Some members of this family are annotated as being Phi APSE P51-like proteins. Length = 363
 Score =  108 bits (272), Expect = 7e-25
 Identities = 49/146 (33%), Positives = 79/146 (54%), Gaps = 11/146 (7%)

Query: 6   CRFCRAKPRCGALAVKALST----FSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALN 61
           CRFC+AK  C A A   L+     F +    L++ +L++++    L+E W K V+  AL+
Sbjct: 215 CRFCKAKATCRARAQAVLNLAKYDFEDPTLDLTDEELAELLEKADLLEKWAKDVEAYALD 274

Query: 62  VLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRE-LGDEA-YNRTLLSPTETEQLVKR 119
              +G+++P Y+L EGR  +R + ++  V   L    L DE  Y + L+SPT+ E+L+ +
Sbjct: 275 EARNGKEVPGYKLVEGR-SNRKWTDEEAVAAALKAAGLKDEDIYKKKLISPTQAEKLLGK 333

Query: 120 KKVSETTWEQLQKFITRKDGKQVIVP 145
           KK  E     L   I +  GK  +VP
Sbjct: 334 KKFKEL----LGALIVKPPGKPTLVP 355