RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >gnl|CDD|33471 COG3673, COG3673, Uncharacterized conserved protein [Function unknown]. Length = 423 Score = 30.4 bits (68), Expect = 0.24 Identities = 11/57 (19%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Query: 16 GALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSS-GEDLPN 71 GA + + L+ H+ +LS + +++ + G+ E V E N Sbjct: 132 GAFSARVLAGMIRHVGLLSRKHAARIDEAWAHYRQRLSGLDPEGQKVTRFRAEYFRN 188 >gnl|CDD|58116 cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.. Length = 146 Score = 26.8 bits (59), Expect = 2.9 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Query: 94 LMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHL 153 L R L D LL EQ+ + ++ WE L+ I K + +V DLP +H Sbjct: 50 LFRLLDDAQSGDVLL----VEQIDRLSRLPLDDWETLKASIAAKGLR--VVSLDLPTSHS 103 >gnl|CDD|153346 cd07662, BAR_SNX6, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX6 forms a stable complex with SNX1 and may be a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. It interacts with the receptor serine/threonine kinases from the transforming growth factor-beta family. It also plays roles in enhancing the degradation of EGFR and in regulating the activity of Na,K-ATPase through its interaction with Translationally Controlled Tumor Protein (TCTP). BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 218 Score = 26.2 bits (57), Expect = 4.4 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Query: 102 AYNRTLLSPTETEQLV--KRKKVSETTWEQLQKFITRKDG---KQVIVPCDLPVNHLKAN 156 A N+ +L T+QL K +K+SE+ ++L F TR+ K ++ +L + H K N Sbjct: 147 AKNKDVLQAETTQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGN 206 Query: 157 I 157 + Sbjct: 207 L 207 >gnl|CDD|114021 pfam05272, VirE, Virulence-associated protein E. This family contains several bacterial virulence-associated protein E like proteins. Length = 198 Score = 26.2 bits (58), Expect = 4.8 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 11/54 (20%) Query: 96 RELGDEAYNRTLLSPTETEQLVKRKKV-----------SETTWEQLQKFITRKD 138 ++LG E + ++ S + K + V S+ E ++ FITR Sbjct: 70 KKLGGEWFTDSIRSFEGKDAYEKLQGVWIVEIAELDGFSKAEVEAIKAFITRTV 123 >gnl|CDD|143183 cd04982, IgV_TCR_gamma, Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor. Length = 116 Score = 26.2 bits (58), Expect = 5.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 128 EQLQKFITRKDGKQVIVPCDL 148 EQ Q ITR++ K V + C + Sbjct: 2 EQPQLSITREESKSVTISCKV 22 >gnl|CDD|39762 KOG4562, KOG4562, KOG4562, Uncharacterized conserved protein (tumor-rejection antigen MAGE in humans) [Function unknown]. Length = 329 Score = 25.8 bits (56), Expect = 6.0 Identities = 28/118 (23%), Positives = 50/118 (42%), Gaps = 14/118 (11%) Query: 41 VMNVLPLIETWMKG--VKEEAL-NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRE 97 +M +L +I +MKG EE + VL + +GR+ S + Q L++E Sbjct: 206 LMIILGII--FMKGNCAPEEEIWEVLRR------LGVYDGREHSIFGEPRKLLTQDLVQE 257 Query: 98 LGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKA 155 E P E L + +ET+ ++ +F+ + +GK P P + +A Sbjct: 258 KYLEYRQVPDSDPPRYEFLWGPRAHAETSKMKVLEFVAKVNGK---DPISWPSLYEEA 312 >gnl|CDD|132868 cd07230, Pat_TGL4-5_like, Triacylglycerol lipase 4 and 5. TGL4 and TGL5 are triacylglycerol lipases that are involved in triacylglycerol mobilization and degradation; they are found in lipid particles. Tgl4 is a functional ortholog of mammalian adipose TG lipase (ATGL) and is phosphorylated and activated by cyclin-dependent kinase 1 (Cdk1/Cdc28). TGL4 is 30% homologus to TGL3, whereas TGL5 is 26% homologus to TGL3. This family includes TGL4 (STC1) and TGL5 (STC2) from Saccharomyces cerevisiae. Length = 421 Score = 25.6 bits (57), Expect = 6.9 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Query: 87 DNQVEQLLMRE-LGD----EAYNRT 106 D +MR LGD EAYNRT Sbjct: 165 DISHLTRVMRGFLGDLTFQEAYNRT 189 >gnl|CDD|35433 KOG0212, KOG0212, KOG0212, Uncharacterized conserved protein [Function unknown]. Length = 675 Score = 25.3 bits (55), Expect = 7.4 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 90 VEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFI 134 + + R L D+ Y + + E E+LVK V+ ++Q++K I Sbjct: 1 MSASIARGLTDKLYEKRKAAALELEKLVK-DLVNNNDYDQIRKVI 44 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.130 0.371 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,833,644 Number of extensions: 84374 Number of successful extensions: 217 Number of sequences better than 10.0: 1 Number of HSP's gapped: 217 Number of HSP's successfully gapped: 15 Length of query: 165 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 78 Effective length of database: 4,383,754 Effective search space: 341932812 Effective search space used: 341932812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.6 bits)