RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} (U:48-134) Length = 87 Score = 27.7 bits (62), Expect = 0.91 Identities = 4/29 (13%), Positives = 13/29 (44%) Query: 114 EQLVKRKKVSETTWEQLQKFITRKDGKQV 142 E ++ ++E + L++ + +V Sbjct: 42 EDVLNIPGLTERQKQILRENLEHFTVTEV 70 >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} (A:499-568) Length = 70 Score = 27.0 bits (60), Expect = 1.4 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 114 EQLVKRKKVSETTWEQLQKFITRKDGKQ 141 ++L K ++ E T+EQ F+ +G Sbjct: 40 DELKKVSRLGEKTFEQAAGFLRVMNGDN 67 >2hcn_A RNA-directed RNA polymerase (NS5); WEST-NIle virus RNA polymerase, structural genomics, marseilles structural genomics program @ AFMB, MSGP; 2.35A {Kunjin virus} PDB: 2hcs_A 2hfz_A (A:84-278,A:394-425) Length = 227 Score = 26.0 bits (57), Expect = 2.7 Identities = 16/76 (21%), Positives = 26/76 (34%), Gaps = 17/76 (22%) Query: 85 NNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK--------KVSETTWEQL----QK 132 D + E ++ L E R L E + K W+Q+ Sbjct: 153 RADLENEAKVLELLDGEH--RRLARAI-IELTYRHKVVKVMRPAADGWYDWQQVPFCSNH 209 Query: 133 F--ITRKDGKQVIVPC 146 F + KDG+ ++ PC Sbjct: 210 FTELIMKDGRTLVTPC 225 >2reu_A Type II restriction enzyme SAU3AI; helix, beta, random coil, endonuclease, hydrolase, magnesium, nuclease, restriction system; 1.90A {Staphylococcus aureus} (A:149-258) Length = 110 Score = 25.7 bits (56), Expect = 3.2 Identities = 10/39 (25%), Positives = 16/39 (41%) Query: 48 IETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNN 86 I +K + ++ + L G L K + G R NN Sbjct: 2 INGPVKRMWDDTVKKLKEGVTLEAVPDKSTKDGWRIKNN 40 >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A (A:) Length = 273 Score = 25.5 bits (55), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 130 LQKFITRKDGKQVIVPCDLPVNH 152 L++ R+ K VIVP D V++ Sbjct: 16 LERIFNRESEKTVIVPMDHGVSN 38 >2oka_A Hypothetical protein; PAR82, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.50A {Pseudomonas aeruginosa} PDB: 2obk_A (A:) Length = 104 Score = 24.4 bits (53), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 6 CRFCRAKPRCGALAVKALSTFSE 28 C C+ R LA + LSTF++ Sbjct: 13 CTQCQWLLRAAWLAQELLSTFAD 35 >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 98 Score = 24.4 bits (53), Expect = 8.6 Identities = 4/22 (18%), Positives = 8/22 (36%) Query: 114 EQLVKRKKVSETTWEQLQKFIT 135 E L + + ++ E K Sbjct: 70 EDLERVEGITGKQMESFLKANI 91 >3bz1_U Photosystem II 12 kDa extrinsic protein; electron transport photosystem, membrane complex, transmembrane alpha-helix; HET: CLA PHO HEM PL9 BCR DGD LHG SQD LMG LMT; 2.90A {Thermosynechococcus elongatus} PDB: 2axt_U* 3bz2_U* 3a0b_U* 3a0h_U* (U:) Length = 104 Score = 24.1 bits (52), Expect = 9.0 Identities = 3/27 (11%), Positives = 11/27 (40%) Query: 114 EQLVKRKKVSETTWEQLQKFITRKDGK 140 E ++ ++E + L++ + Sbjct: 59 EDVLNIPGLTERQKQILRENLEHFTVT 85 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.130 0.371 Gapped Lambda K H 0.267 0.0520 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,155,180 Number of extensions: 46424 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 19 Length of query: 165 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 83 Effective length of database: 2,184,039 Effective search space: 181275237 Effective search space used: 181275237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.9 bits)