RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781191|ref|YP_003065604.1| hypothetical protein
CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62]
         (165 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 33.8 bits (77), Expect = 0.021
 Identities = 32/197 (16%), Positives = 61/197 (30%), Gaps = 76/197 (38%)

Query: 23  LSTFSEHMQILS------NRQLSQVMNVLPLIETWMKGVKEEALNV---LSSGEDLP--- 70
           +   +E +  L        +  +Q +N+L     W++       +    LS     P   
Sbjct: 188 IKFSAETLSELIRTTLDAEKVFTQGLNIL----EWLEN-PSNTPDKDYLLSIPISCPLIG 242

Query: 71  -----NY------------ELKE---GRKG-------------SRT----YNNDNQVEQL 93
                +Y            EL+    G  G             + +    + +  +   +
Sbjct: 243 VIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITV 302

Query: 94  LMRELG---DEAYNRTLLSPTETEQLVKRKK--------VSETTWEQLQKFITRKDGKQV 142
           L   +G    EAY  T L P+  E  ++  +        +S  T EQ+Q ++ +      
Sbjct: 303 LFF-IGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNK------ 355

Query: 143 IVPCDLPVN-HLKANIS 158
                LP    +   IS
Sbjct: 356 -TNSHLPAGKQV--EIS 369


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 30.0 bits (66), Expect = 0.29
 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 10/21 (47%)

Query: 2  DENACRFCRAKPRCGALAVKA 22
          D++A       P   ALA+KA
Sbjct: 34 DDSA-------P---ALAIKA 44


>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding,
           hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1
           c.19.1.2 PDB: 1bci_A
          Length = 749

 Score = 28.4 bits (63), Expect = 0.83
 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 3/43 (6%)

Query: 108 LSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPV 150
           L   E     +RK+      E ++K +  K+ + +    D+PV
Sbjct: 150 LCDQEKTFRQQRKEH---IRESMKKLLGPKNSEGLHSARDVPV 189


>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum.,
           structural genomics, PSI-2, protein structure
           initiative; 2.50A {Corynebacterium glutamicum}
          Length = 307

 Score = 27.9 bits (62), Expect = 1.1
 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 5/55 (9%)

Query: 107 LLSPTETEQLVK-RKKVSETTWEQLQKFITR----KDGKQVIVPCDLPVNHLKAN 156
           ++SP   E L + R        E+ ++   R    +DGK  IV  D P     A 
Sbjct: 5   IISPESFEALRRMRAAEPTMVAERFKQRRKRELLGEDGKLFIVAADHPARGALAV 59


>3glc_A Aldolase LSRF; TIM barrel, cytoplasm, lyase, schiff base; HET: R5P;
           2.50A {Escherichia coli k-12} PDB: 3gnd_A* 3gkf_O
          Length = 295

 Score = 26.8 bits (59), Expect = 2.6
 Identities = 6/23 (26%), Positives = 9/23 (39%)

Query: 130 LQKFITRKDGKQVIVPCDLPVNH 152
           L +    K GK V++  D     
Sbjct: 44  LSRIFNPKTGKTVMLAFDHGYFQ 66


>1vk1_A Conserved hypothetical protein; reductive methylation, dimethyl
           lysine, structural genomics, PSI, protein structure
           initiative; HET: MLY; 1.20A {Pyrococcus furiosus} SCOP:
           d.268.1.2
          Length = 242

 Score = 26.1 bits (57), Expect = 4.4
 Identities = 14/61 (22%), Positives = 22/61 (36%), Gaps = 2/61 (3%)

Query: 82  RTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKV--SETTWEQLQKFITRKDG 139
             Y      +  + +   D  + R   +  E  +LVKR +V    TT   L     + D 
Sbjct: 177 VYYGLKEDAKADMEKGEIDYVFIRXAPTKEEVMELVKRGEVFSPXTTRHVLPFIPDKIDV 236

Query: 140 K 140
           K
Sbjct: 237 K 237


>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel,
           glycolytic, archaeal, catalytic mechanism, reaction
           intermediate, lyase; HET: FBP; 1.85A {Thermoproteus
           tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 1ojx_A 1ok4_A 1ok6_A
          Length = 263

 Score = 26.1 bits (57), Expect = 4.5
 Identities = 6/19 (31%), Positives = 10/19 (52%)

Query: 134 ITRKDGKQVIVPCDLPVNH 152
           I  + GK +I+  D  + H
Sbjct: 11  IFARRGKSIILAYDHGIEH 29


>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein,
           structural genomics, PSI- 2, protein structure
           initiative; 3.00A {Corynebacterium diphtheriae}
          Length = 583

 Score = 25.5 bits (55), Expect = 5.4
 Identities = 14/100 (14%), Positives = 28/100 (28%), Gaps = 1/100 (1%)

Query: 35  NRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLL 94
              L+ +   L L++    GV      +++ G   P  E   G     T      V  +L
Sbjct: 356 YPALADLYRALGLVDKQGVGVDRMYQAMIALGHRPPTIEEIAGPFVETTLVGGRPVLPVL 415

Query: 95  MRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFI 134
              +                 L    +    T + + + +
Sbjct: 416 -ELVSSIVPEARQDDYRIAIVLYLLFQRPFITIDVVARGL 454


>2zbk_A Type II DNA topoisomerase VI subunit A; DNA binding protein,
           decatenation, ATPase, drug design, DNA-binding,
           magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus
           shibatae}
          Length = 389

 Score = 25.0 bits (54), Expect = 7.7
 Identities = 19/123 (15%), Positives = 48/123 (39%), Gaps = 16/123 (13%)

Query: 44  VLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAY 103
              ++      + E+    L  G +    E+       RT +N    E+  +  LG++  
Sbjct: 17  AANILRDKFLNLVEQ----LKKG-EPLVMEIP-----MRTLSNAIYDEKRKLLLLGEKKL 66

Query: 104 NRTLLSPTETEQLVKRKKVSETTWEQLQ--KFITRKD----GKQVIVPCDLPVNHLKANI 157
            R  L   E ++ ++   ++   ++ L   ++ T +D    GK  ++   +  N + +  
Sbjct: 67  RRNFLDLNEAKRFMQTVLMASIIYDALVSDEYPTIRDLYYRGKHSLLLKSIEGNKIVSEE 126

Query: 158 SEF 160
           + +
Sbjct: 127 NTW 129


>2oka_A Hypothetical protein; PAR82, NESG, structural genomics, PSI-2,
          protein structure initiative, northeast structural
          genomics consortium; 2.50A {Pseudomonas aeruginosa}
          PDB: 2obk_A
          Length = 104

 Score = 25.1 bits (55), Expect = 8.6
 Identities = 9/23 (39%), Positives = 13/23 (56%)

Query: 6  CRFCRAKPRCGALAVKALSTFSE 28
          C  C+   R   LA + LSTF++
Sbjct: 13 CTQCQWLLRAAWLAQELLSTFAD 35


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.315    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0492    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,315,130
Number of extensions: 54555
Number of successful extensions: 159
Number of sequences better than 10.0: 1
Number of HSP's gapped: 158
Number of HSP's successfully gapped: 17
Length of query: 165
Length of database: 5,693,230
Length adjustment: 85
Effective length of query: 80
Effective length of database: 3,632,490
Effective search space: 290599200
Effective search space used: 290599200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (24.8 bits)