HHsearch alignment for GI: 254781193 and conserved domain: PRK06859

>PRK06859 consensus.
Probab=99.14  E-value=2.5e-09  Score=78.74  Aligned_cols=88  Identities=17%  Similarity=0.189  Sum_probs=61.0

Q ss_pred             HHHHHHHHCCCCCEEEEEEHHHHHHHHHHH---CCCCCCC---CCEEEHHHHHHHHCC--CCCHHHHHHHCCCCCCHHHH
Q ss_conf             799999863889819997307749999986---0899884---203316889998678--99968989982998110043
Q gi|254781193|r   54 PQVLKEALENTDVTIVAHNSYFERTVLKAC---FNLDIPI---HRWICTLVLARSNGL--PSALKAVGEALKLSSQKMEE  125 (675)
Q Consensus        54 ~~~l~~~L~~~~~~kV~HNa~FD~~~L~~~---~Gi~i~~---~~~~DTmi~A~~l~~--~~sL~~la~~l~l~~~k~~~  125 (675)
T Consensus        82 a~efl~Fi~--~a~LVaHNa~FD~~FLn~El~r~g~~~~~~~~~~viDTL~lAR~~~Pg~~~sLdaLc~r~~id~~~R--  157 (253)
T PRK06859         82 AQEFIDYIK--GAELLIHNAPFDVGFMDYEFRKLNLNVKTDDICLVTDTLQMARQMYPGKRNNLDALCDRLGIDNSKR--  157 (253)
T ss_pred             HHHHHHHHC--CCEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHHHHCCCCCCCHHHHHHHCCCCCCCC--
T ss_conf             999999967--9979995718889999999997499965322001133999999878799779999999739987663--


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             799998620211234332346785853289999998998999999996301
Q gi|254781193|r  126 GKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLE  176 (675)
Q Consensus       126 ~k~l~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~  176 (675)
T Consensus       158 -------------------------------~~HgAllDa~lLa~VYl~mt  177 (253)
T PRK06859        158 -------------------------------TLHGALLDAEILADVYLMMT  177 (253)
T ss_pred             -------------------------------CCCCHHHHHHHHHHHHHHHC
T ss_conf             -------------------------------30132888999999999872