HHsearch alignment for GI: 254781193 and conserved domain: PRK07456

>PRK07456 consensus.
Probab=100.00  E-value=0  Score=887.30  Aligned_cols=536  Identities=21%  Similarity=0.241  Sum_probs=444.5

Q ss_pred             EEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEEC--CEEEEEEECCCCH--------HHHHHHHHHHCCCCCEEEEEE
Q ss_conf             899981417898700044001127981999999984--8039999788810--------437999998638898199973
Q gi|254781193|r    3 TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFD--DHPVELWDCVHDP--------VMPQVLKEALENTDVTIVAHN   72 (675)
Q Consensus         3 ~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~--~~~v~~~d~~~~~--------~~~~~l~~~L~~~~~~kV~HN   72 (675)
T Consensus       384 ~vA~DtETtsLdp----------~~A~lVGis~s~~~~~~~a~YIPl~h~~~~~~l~~~~vl~~LkpiLed~~i~KighN  453 (975)
T PRK07456        384 PVAWDTETTSLNP----------RDAELVGIGCCWGEELDDLAYIPLGHQQAGEQLPLETVLEALRPWLESPEHPKALQN  453 (975)
T ss_pred             EEEEECCCCCCCH----------HHCCEEEEEEECCCCCCCEEEEECCCCCCHHHCCHHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             5899804688774----------232102666411557872699773455613105799999999998628875310211


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCC--CCCHHHHHHHC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             077499999860899884203316889998678--99968989982-998110043799998620211234332346785
Q gi|254781193|r   73 SYFERTVLKACFNLDIPIHRWICTLVLARSNGL--PSALKAVGEAL-KLSSQKMEEGKELIARFCKGETHECLYDRNKPN  149 (675)
Q Consensus        73 a~FD~~~L~~~~Gi~i~~~~~~DTmi~A~~l~~--~~sL~~la~~l-~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~~~  149 (675)
T Consensus       454 lKyD~~vL~~~-GI~l~-g~~fDTmLAsYLLnP~~~h~Ld~La~~yL~~~~i---~~edl~g---kg--------k--~~  515 (975)
T PRK07456        454 AKFDRLILLRH-GIALK-GVVFDTLLADYLLNPEAKHNLDDLAQRELGFTPT---SYKDLVG---KG--------Q--TF  515 (975)
T ss_pred             HHHHHHHHHHC-CCCCC-CCCCCHHHHHHHHCCCCCCCHHHHHHHHHCCCCC---CHHHHCC---CC--------C--CC
T ss_conf             14679999976-95106-7551399999876876558989999997188877---4998628---88--------7--60


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCH------------HCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             853289999998998999999996301040------------00151336666531156213799999999999999999
Q gi|254781193|r  150 HREAWRLFGEYCKGDVTVTREIFKRLEPLS------------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK  217 (675)
Q Consensus       150 ~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~------------~~E~~~~~~~~~me~~Gi~vD~e~l~~l~~~~~~~~~~  217 (675)
T Consensus       516 ~~v~~~~~~~ya~~dA~~~~~L~~~l~~~L~~~~~~L~~l~~~iE~PLi~VLa~ME~~GI~vD~~~L~~l~~~l~~~l~~  595 (975)
T PRK07456        516 ADVDIATASQYCGMDVYLTYRLAPILREQLAKTGPELIKLLEEVELPLEPVLAEMEATGIRIDIPYLKELSQELESTLER  595 (975)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             20897899999999999999999999999986236999999998736999999999718501699999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCC--CCC---CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999872885476788799988777755888888--988---533899872130482389999999997655101335
Q gi|254781193|r  218 LDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED--LTE---TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN  292 (675)
Q Consensus       218 l~~~i~~~~~~~~~n~~S~~ql~~~L~~~lg~~~~~--~~k---~t~~~~L~~~~~~~~~~~~~l~~r~~~~k~~~~~~~  292 (675)
T Consensus       596 le~~i~~~-aG~eFNinSpkQL~evLFekL~L~~~k~~KtKtGySTd~~vLe~L~~~hpi~~~il~~R~-l~Kl~sTY~~  673 (975)
T PRK07456        596 LEQQAYEL-AGEDFNLSSPKQLGELLFEKLGLDRKKSRKTKTGYSTDAAVLEKLEGDHPIVPLILEHRT-LSKLKSTYVD  673 (975)
T ss_pred             HHHHHHHH-CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             99999986-489889899899999989863999877777889988629999975204727999999878-9999999999


Q ss_pred             HHHHHCCCC-CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHHHHEEEECC
Q ss_conf             788740868-9676778840001322112478884448888865113455431012333345544321003333012668
Q gi|254781193|r  293 TLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS  371 (675)
Q Consensus       293 ~~~~~~~~d-gRih~~~~~~gat~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a~  371 (675)
T Consensus       674 ~L~~~i~~~tgriht~f~Q~~-t~TGRlSS~~PNLQNIP~r~~~g~~-------------------------iR~~Fv~~  727 (975)
T PRK07456        674 ALPQLVEAETGRVHTDFNQAV-TATGRLSSSNPNLQNIPIRTEFSRR-------------------------IRKAFLPQ  727 (975)
T ss_pred             HHHHHHCCCCCEECCHHHHHC-CCCCCCCCCCCCCCCCCCCCCCCHH-------------------------HHEEECCC
T ss_conf             988752877587657555410-6656504789751357776410312-------------------------34124358


Q ss_pred             CCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHCCHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             98789998345372333323114620113454113310101476448795670620111016520210028888889987
Q gi|254781193|r  372 EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKM  451 (675)
Q Consensus       372 ~G~~lv~aDySqiElRvlA~ls~d~~l~~af~~g~D~h~~tA~~~~g~~~~~~~~~~R~~aK~~~~g~~YG~G~~~l~~~  451 (675)
T Consensus       728 ~g~~l~saDySQiELRilAh~s~d~~li~af~~~~DiH~~tA~~if~~--~~v~~~~R~~AK~infgiiYG~~~~gLa~-  804 (975)
T PRK07456        728 EGWLLLSADYSQIELRILAHLSQEPVLLEAYRSGDDVHTLTARLLFEK--EEISSDERRLGKTINFGVIYGMGAQRFAR-  804 (975)
T ss_pred             CCCEEEEECHHHHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCHHHHHH-
T ss_conf             998899963208799999998588899998717998689999986393--01999999997898876776468778898-


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             98708883113455655545555678888999988764310001022078889999999987887899999999999999
Q gi|254781193|r  452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQT  531 (675)
Q Consensus       452 ~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~r~~~p~i~~~~~~~~~~~~~~  531 (675)
T Consensus       805 -------------------------------------------~l~is~~eA~~~i~~yf~~yp~v~~~~~~~~~~a---  838 (975)
T PRK07456        805 -------------------------------------------ETGVSQSEAKEFLSRYKERYPKVFAFLELQERLA---  838 (975)
T ss_pred             -------------------------------------------HHCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHH---
T ss_conf             -------------------------------------------8597999999999999986901999999999999---


Q ss_pred             HHCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCH--------------HHHC-CHHHHHHHHHHHHHH
Q ss_conf             7549179621542113322234456402324766310167866210--------------2101-002345677753145
Q gi|254781193|r  532 IENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR--------------SYLN-TTTRQLTREYTYGGK  596 (675)
Q Consensus       532 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~GR~~~~~~~~~~~--------------~~~~-~~~~~~~r~~~~~~k  596 (675)
T Consensus       839 ~~~g-----------------------yv~Tl~gRrr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R------~  889 (975)
T PRK07456        839 LSKG-----------------------YVETILGRRRYFHFDKNGLGRLLGKDPEEIDLDVARRAGMEAQQLR------A  889 (975)
T ss_pred             HHCC-----------------------CEECCCCCEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH------H
T ss_conf             9769-----------------------8876667700464444310001356822134065666777758889------8


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC------CCCEEEEECCEEEEECCCCHHHHH-HHHHHHHCCCCHHCCCCCCEEEECC
Q ss_conf             655453688999999999999967------981889952589997792489999-9999984565202159951574010
Q gi|254781193|r  597 LTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYE  669 (675)
Q Consensus       597 ~~n~~iQgtaadi~k~ami~l~~~------g~~ivl~VHDEiv~evp~~~~~~~-~~i~~~M~~~~~w~~~~pl~ae~~~  669 (675)
T Consensus       890 A~N~piQGtaADiiK~AMi~~~~~l~~~~~~~~~llqvHDElifev~~~~~~~~~~~v~~~Me~a~~--l~Vpl~v~~~~  967 (975)
T PRK07456        890 AANAPIQGSSADIIKIAMVQLQKKLLEQNLPARLLLQVHDELVLEVPPEELEELKPLVKSTMENAVK--LSVPLVVEIGA  967 (975)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCC
T ss_conf             8370244679999999999999999737988538998643778953688999999999999827435--78875841173


Q ss_pred             CCCCC
Q ss_conf             04631
Q gi|254781193|r  670 SKRYR  674 (675)
Q Consensus       670 ~~~y~  674 (675)
T Consensus       968 G~nW~  972 (975)
T PRK07456        968 GDNWM  972 (975)
T ss_pred             CCCHH
T ss_conf             88968