HHsearch alignment for GI: 254781193 and conserved domain: PRK07997

>PRK07997 consensus.
Probab=100.00  E-value=0  Score=913.29  Aligned_cols=539  Identities=20%  Similarity=0.234  Sum_probs=460.2

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEEECCCC----------HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             6899981417898700044001127981999999984803999978881----------043799999863889819997
Q gi|254781193|r    2 ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMPQVLKEALENTDVTIVAH   71 (675)
Q Consensus         2 k~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~d~~~~----------~~~~~~l~~~L~~~~~~kV~H   71 (675)
T Consensus       350 ~~~a~DtEt~sld~~----------~a~lvGiS~s~~~g~a~YiPl~h~~l~~~~ql~~~~vl~~LkplLed~~i~KIgh  419 (928)
T PRK07997        350 PVFAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYLPVAHDYLDAPDQISRERVLELLKPLLEDEKALKVGQ  419 (928)
T ss_pred             CEEEEEEECCCCCCC----------CCCCCCEEEEECCCCEEEEECCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCHHCC
T ss_conf             869999512786600----------0244433898627746874022123476001249999999898752865303212


Q ss_pred             EHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             3077499999860899884203316889998678---99968989982-9981100437999986202112343323467
Q gi|254781193|r   72 NSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKAVGEAL-KLSSQKMEEGKELIARFCKGETHECLYDRNK  147 (675)
Q Consensus        72 Na~FD~~~L~~~~Gi~i~~~~~~DTmi~A~~l~~---~~sL~~la~~l-~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~  147 (675)
T Consensus       420 nlK~d~~vL~~~-GI~l~-gi~fDTmLAaYLLnp~~~~~~Ld~La~~yL~~~~---i~~~el~----------gkgk~q~  484 (928)
T PRK07997        420 NLKFDRGILANY-GIELR-GIAFDTMLESYILNSVAGRHDMDSLAERWLKHKT---ITFEEIA----------GKGKNQL  484 (928)
T ss_pred             HHHHHHHHHHHC-CCEEC-CCCCCHHHHHHHCCCCCCCCCHHHHHHHHHCCCC---CCHHHHC----------CCCCCCC
T ss_conf             168899999977-94105-6430345532222443344788999999713466---4335432----------4464547


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----------HCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             85853289999998998999999996301040-----------0015133666653115621379999999999999999
Q gi|254781193|r  148 PNHREAWRLFGEYCKGDVTVTREIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT  216 (675)
Q Consensus       148 ~~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~-----------~~E~~~~~~~~~me~~Gi~vD~e~l~~l~~~~~~~~~  216 (675)
T Consensus       485 ~f~~v~~~~~~~Ya~edA~~t~~L~~~L~~~L~~~~~l~~Ly~~IE~PLi~VLa~ME~~GI~vD~~~L~~ls~el~~~l~  564 (928)
T PRK07997        485 TFNQIALEEAGRYAAEDADVTLQLHLKMWPKLQQHKGPLNVFENIEMPLVPVLSRIERNGVKIDPAVLHAHSEELTLRLA  564 (928)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHH
T ss_conf             74353599999999999999999999999998621449999999998999999999853959989999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCC---C-CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999987288547678879998877775588888898---8-533899872130482389999999997655101335
Q gi|254781193|r  217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT---E-TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN  292 (675)
Q Consensus       217 ~l~~~i~~~~~~~~~n~~S~~ql~~~L~~~lg~~~~~~~---k-~t~~~~L~~~~~~~~~~~~~l~~r~~~~k~~~~~~~  292 (675)
T Consensus       565 ~le~~I~~~-aG~eFNinSpKQLgeILFekLgLp~~KKTktG~~ST~~~vLe~L~~~h~i~~~il~yR~-l~KL~sTY~d  642 (928)
T PRK07997        565 ELEKKAHEI-AGEPFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEYRG-LAKLKSTYTD  642 (928)
T ss_pred             HHHHHHHHH-CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHH-HHHHHHHHHH
T ss_conf             999999986-29988878999999998986299988858899968469999972025750899999989-9998998898


Q ss_pred             HHHHHCCC-CCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHHHHEEEECC
Q ss_conf             78874086-89676778840001322112478884448888865113455431012333345544321003333012668
Q gi|254781193|r  293 TLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS  371 (675)
Q Consensus       293 ~~~~~~~~-dgRih~~~~~~gat~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a~  371 (675)
T Consensus       643 ~L~~~i~~~~gRiHt~f~Q~~-t~TGRlSS~~PNLQNIPir~~~G~~-------------------------iR~aFi~~  696 (928)
T PRK07997        643 KLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIPVRNEEGRR-------------------------IRQAFIAP  696 (928)
T ss_pred             HHHHHHCCCCCEEEEEEHCCC-CCCCCCCCCCCCCCCCCCCCHHHHH-------------------------HHHHHCCC
T ss_conf             889753866687820301110-2125112589986758888622578-------------------------99874378


Q ss_pred             CCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHCCHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             98789998345372333323114620113454113310101476448795670620111016520210028888889987
Q gi|254781193|r  372 EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKM  451 (675)
Q Consensus       372 ~G~~lv~aDySqiElRvlA~ls~d~~l~~af~~g~D~h~~tA~~~~g~~~~~~~~~~R~~aK~~~~g~~YG~G~~~l~~~  451 (675)
T Consensus       697 ~g~~l~saDYSQiELRilAh~s~d~~li~af~~~~DiH~~tA~~if~~~~~~v~~~~R~~aK~vnfgi~YG~s~~gLa~-  775 (928)
T PRK07997        697 EDYVIVSADYSQIELRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLEKVTSEQRRSAKAINFGLIYGMSAFGLAR-  775 (928)
T ss_pred             CCCEEEEECHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHHCCCHHHHHH-
T ss_conf             9987997056289999999997687688775168883401179882999465798899886877766466268778998-


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             98708883113455655545555678888999988764310001022078889999999987887899999999999999
Q gi|254781193|r  452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQT  531 (675)
Q Consensus       452 ~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~r~~~p~i~~~~~~~~~~~~~~  531 (675)
T Consensus       776 -------------------------------------------~l~i~~~eA~~~i~~yf~~~~~v~~~~~~~~~~a~~-  811 (928)
T PRK07997        776 -------------------------------------------QLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKE-  811 (928)
T ss_pred             -------------------------------------------HHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH-
T ss_conf             -------------------------------------------709999999999999988683399999999999997-


Q ss_pred             HHCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             75491796215421133222344564023247663101678662102101002345677753145655453688999999
Q gi|254781193|r  532 IENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILA  611 (675)
Q Consensus       532 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~GR~~~~~~~~~~~~~~~~~~~~~~r~~~~~~k~~n~~iQgtaadi~k  611 (675)
T Consensus       812 -------------------------~gyv~Tl~gRrr~~~~i~s~n~~~r~~---~eR~------a~N~piQgtaADiik  857 (928)
T PRK07997        812 -------------------------QGYVETLDGRRLYLPDIKSSNAARRAA---AERA------AINAPMQGTAADIIK  857 (928)
T ss_pred             -------------------------CCCEECCCCCEECCCCCCCCCHHHHHH---HHHH------HHCCCCCHHHHHHHH
T ss_conf             -------------------------794788889614588767899889968---9999------958113378999999


Q ss_pred             HHHHHHHHC------CCCEEEEECCEEEEECCCCHHHHH-HHHHHHHCCCCHHCCCCCCEEEECCCCCCC
Q ss_conf             999999967------981889952589997792489999-999998456520215995157401004631
Q gi|254781193|r  612 EGMMNATKA------GYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRYR  674 (675)
Q Consensus       612 ~ami~l~~~------g~~ivl~VHDEiv~evp~~~~~~~-~~i~~~M~~~~~w~~~~pl~ae~~~~~~y~  674 (675)
T Consensus       858 ~Ami~~~~~l~~~~~~~~~~lqvHDEli~e~~~~~~~~~~~~~~~~Me~a~~--l~VPL~v~~~~g~nW~  925 (928)
T PRK07997        858 RAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDDLDAVAKKIHQLMENCTR--LDVPLLVEVGSGENWD  925 (928)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCCCCHH
T ss_conf             9999999999844888648973560678842688999999999999728443--7887585359277968