HHsearch alignment for GI: 254781193 and conserved domain: PRK08434

>PRK08434 consensus.
Probab=100.00  E-value=0  Score=876.56  Aligned_cols=530  Identities=19%  Similarity=0.269  Sum_probs=442.5

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEEECCCCH-----HH-HH----HHHHHHCCCCCEEEEE
Q ss_conf             68999814178987000440011279819999999848039999788810-----43-79----9999863889819997
Q gi|254781193|r    2 ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDP-----VM-PQ----VLKEALENTDVTIVAH   71 (675)
Q Consensus         2 k~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~d~~~~~-----~~-~~----~l~~~L~~~~~~kV~H   71 (675)
T Consensus       319 ~~~a~d~Ett~l-d---------~~~a~lvGis~~~~~~~a~YiPi~h~~l~~~~~~~~~~~~~~l~~~~~---~~~Igh  385 (887)
T PRK08434        319 SIIAFDTETTGL-D---------TKEAKLVGFSFCFNEEEAYYVPLAHSYLGVGEQISLESAKKAIEKIFN---HFVIGH  385 (887)
T ss_pred             CEEEEEEECCCC-C---------CCCCCEEEEEEEECCCCEEEEECCCCCCCCHHHCCHHHHHHHHHHHHH---CCCHHH
T ss_conf             769999512786-6---------133430589999559858999752112577333599999999787633---740364


Q ss_pred             EHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCC--CCCHHHHHHHC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             3077499999860899884203316889998678--99968989982-99811004379999862021123433234678
Q gi|254781193|r   72 NSYFERTVLKACFNLDIPIHRWICTLVLARSNGL--PSALKAVGEAL-KLSSQKMEEGKELIARFCKGETHECLYDRNKP  148 (675)
Q Consensus        72 Na~FD~~~L~~~~Gi~i~~~~~~DTmi~A~~l~~--~~sL~~la~~l-~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~~  148 (675)
T Consensus       386 NlKyDl~vL~~~~gi~l~-g~~fDTmLAaYLLdp~~r~~Ld~La~~yL~~~~---i~~e~l~~---kg--------~--~  448 (887)
T PRK08434        386 NLKYDFKIIQNNFGLELP-QKYADTMILAWLKDPSSRVGLDDLAKRLFNYEM---IHFESVVK---KG--------E--N  448 (887)
T ss_pred             HHHHHHHHHHHHCCCCCC-CCHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCC---CCHHHHHC---CC--------C--C
T ss_conf             779999999985698777-731489999986698666666789999708787---74899854---67--------7--7


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-------------HCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             5853289999998998999999996301040-------------001513366665311562137999999999999999
Q gi|254781193|r  149 NHREAWRLFGEYCKGDVTVTREIFKRLEPLS-------------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVER  215 (675)
Q Consensus       149 ~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~-------------~~E~~~~~~~~~me~~Gi~vD~e~l~~l~~~~~~~~  215 (675)
T Consensus       449 f~~v~i~~a~~YAaedA~it~~L~~~l~~~L~~~~~~~L~~Ly~~IElPLi~VLa~ME~~GI~VD~~~L~~ls~el~~~i  528 (887)
T PRK08434        449 FSSVDLEKACKYAAEDAWITLRFYKKFLENLEKRGATHLLELAKNVEFPFIKTLLMMEENGIKLDTNFLEELKKKFEEEI  528 (887)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             02078899999999999999999999999998655177999999988659999999997195026999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC---CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999872885476788799988777755888888988---533899872130482389999999997655101335
Q gi|254781193|r  216 TKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE---TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN  292 (675)
Q Consensus       216 ~~l~~~i~~~~~~~~~n~~S~~ql~~~L~~~lg~~~~~~~k---~t~~~~L~~~~~~~~~~~~~l~~r~~~~k~~~~~~~  292 (675)
T Consensus       529 ~~Le~~Iy~l-AG~eFNInSPKQLgeILFekLgLp~~KKTKTGySTd~evLe~L~~~hpi~~~iLeyR-~l~KL~sTYvd  606 (887)
T PRK08434        529 KELTEEIYEL-CGEEFNINSTKQLGAVLFEKLKLPSGKKTKTGYSTDEKVLNALLDKHPVIPKILEYR-ELYKLYSTYIE  606 (887)
T ss_pred             HHHHHHHHHH-CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHH-HHHHHHHHHHH
T ss_conf             9999999985-576647799999999989864998888888998880999999887387389999860-89999999998


Q ss_pred             HHHHHCC--CCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHHHHEEEEC
Q ss_conf             7887408--68967677884000132211247888444888886511345543101233334554432100333301266
Q gi|254781193|r  293 TLVEAMN--SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIA  370 (675)
Q Consensus       293 ~~~~~~~--~dgRih~~~~~~gat~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a  370 (675)
T Consensus       607 ~L~~~~~~d~tgRIHttfnQ~~-t~TGRLSS~~PNLQNIPirt~~Gr~-------------------------iR~aFv~  660 (887)
T PRK08434        607 PLLKLALKDKNSRIYTSFLQTG-TATGRLSSKNPNLQNIPARGELAKD-------------------------IREAFVA  660 (887)
T ss_pred             HHHHHCCCCCCCEECCHHHHHC-CCCEEECCCCCCCCCCCCCCCCCHH-------------------------HHHHEEE
T ss_conf             8877514788870310115313-2210123689975678777642155-------------------------4644340


Q ss_pred             CCCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHCCHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             89878999834537233332311462011345411331010147644879567062011101652021002888888998
Q gi|254781193|r  371 SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQK  450 (675)
Q Consensus       371 ~~G~~lv~aDySqiElRvlA~ls~d~~l~~af~~g~D~h~~tA~~~~g~~~~~~~~~~R~~aK~~~~g~~YG~G~~~l~~  450 (675)
T Consensus       661 ~~g~~l~~aDysQiElRilAh~s~d~~l~~af~~~~DiH~~tA~~vf~---~~~~~~~R~~aK~vnfgi~YG~~~~gLa~  737 (887)
T PRK08434        661 KEGYSLISLDYSQIELRLLAHFSKDEALLEAFKNDEDIHARTAIKIFG---EENAKAKRAVAKSINFGLIYGMGSKKLSE  737 (887)
T ss_pred             CCCCEEEEECHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHC---CCCCHHHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             688779970573899999999718899999984499848999999837---77888899897777756655468777998


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             79870888311345565554555567888899998876431000102207888999999998788789999999999999
Q gi|254781193|r  451 MASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQ  530 (675)
Q Consensus       451 ~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~r~~~p~i~~~~~~~~~~~~~  530 (675)
T Consensus       738 --------------------------------------------~l~i~~~eA~~~i~~yf~~yp~v~~~~~~~~~~a~~  773 (887)
T PRK08434        738 --------------------------------------------TLGISAKEAKEYIESYFASFPTIKNFLESIKNFAKE  773 (887)
T ss_pred             --------------------------------------------HCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH
T ss_conf             --------------------------------------------709899999999999999680199999999999997


Q ss_pred             HHHCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97549179621542113322234456402324766310167866210210100234567775314565545368899999
Q gi|254781193|r  531 TIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDIL  610 (675)
Q Consensus       531 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~GR~~~~~~~~~~~~~~~~~~~~~~r~~~~~~k~~n~~iQgtaadi~  610 (675)
T Consensus       774 ---~-----------------------gyv~Tl~gRrr~~-~~~~~~~~~~---~~~eR~------A~N~piQGtaADii  817 (887)
T PRK08434        774 ---N-----------------------GYVETLLGRKRYF-DFENATPMQK---AMYERE------AVNTIFQGSAADLI  817 (887)
T ss_pred             ---C-----------------------CCEECCCCCCCCC-CCCCCCHHHH---HHHHHH------HHCCCCCHHHHHHH
T ss_conf             ---6-----------------------8877888872068-8779898899---899999------83823366799999


Q ss_pred             HHHHHHHHH----CCCCEEEEECCEEEEECCCCHHHHH-HHHHHHHCCCCHHCCCCCCEEEECCCCCCC
Q ss_conf             999999996----7981889952589997792489999-999998456520215995157401004631
Q gi|254781193|r  611 AEGMMNATK----AGYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRYR  674 (675)
Q Consensus       611 k~ami~l~~----~g~~ivl~VHDEiv~evp~~~~~~~-~~i~~~M~~~~~w~~~~pl~ae~~~~~~y~  674 (675)
T Consensus       818 k~Ami~~~~~l~~~~~~~~lqvHDElv~e~~~~~~~~~~~~v~~~Me~a~~--L~VPL~v~~~~g~nW~  884 (887)
T PRK08434        818 KLAMNEINKLLNEEDAKLLLQIHDELIFEVKDELAEEFAKKFKDIMENIVK--LNVPLKTSLSIAKNWG  884 (887)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECEEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCCCCHH
T ss_conf             999999999986449869997542678962686999999999999728501--6787686428278946