HHsearch alignment for GI: 254781193 and conserved domain: TIGR01388

>TIGR01388 rnd ribonuclease D; InterPro: IPR006292 These proteins represent ribonuclease D, a 3-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo. Members of this family are restricted to the Proteobacteria; Aquifex, Mycobacteria and eukaryotes. Ribonuclease D is not essential in Escherichia coli but is deleterious when overexpressed. The precise biological role of ribonuclease D is still unknown. ; GO: 0004540 ribonuclease activity, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=99.49  E-value=1.9e-12  Score=99.01  Aligned_cols=158  Identities=21%  Similarity=0.191  Sum_probs=109.9

Q ss_pred             EEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEE-ECCCCHHHHHHHHHHHCCCCCEEEEEEHHHHHHHHH
Q ss_conf             8999814178987000440011279819999999848039999-788810437999998638898199973077499999
Q gi|254781193|r    3 TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELW-DCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLK   81 (675)
Q Consensus         3 ~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~-d~~~~~~~~~~l~~~L~~~~~~kV~HNa~FD~~~L~   81 (675)
T Consensus        20 ~valDTEF~-----R~~TF-----wP~LgLiQ~a~g~~-~~LIDPL~~~-~~~~Pl~~lL~d~~v~KvlHAaseDlEvF~   87 (374)
T TIGR01388        20 FVALDTEFV-----RERTF-----WPQLGLIQVADGEQ-LALIDPLVID-IDLSPLLELLADESVVKVLHAASEDLEVFL   87 (374)
T ss_pred             EEECCCCEE-----CCCCC-----CHHHCCEECCCCCE-EEEECCCCCC-CCHHHHHHHHHCCCCEEEECCCCHHHHHHH
T ss_conf             374155411-----26532-----02040031137875-6876588875-234799999738981585304504799999


Q ss_pred             HHCCCCCCCCCEEEHHHHHHHHCCCCCHHH---HHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             860899884203316889998678999689---89982998110043799998620211234332346785853289999
Q gi|254781193|r   82 ACFNLDIPIHRWICTLVLARSNGLPSALKA---VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFG  158 (675)
Q Consensus        82 ~~~Gi~i~~~~~~DTmi~A~~l~~~~sL~~---la~~l~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~~~~~~~~~~~~  158 (675)
T Consensus        88 ~l~g~-lP-~PLfDTQi~Aa~~G~g~s~gY~~LV~~~~~v~LdKse~rtDW~~------------------RPL-td~Ql  146 (374)
T TIGR01388        88 NLFGV-LP-KPLFDTQIAAAFLGFGESMGYDKLVQEVLGVELDKSETRTDWLA------------------RPL-TDKQL  146 (374)
T ss_pred             HHHCC-CC-CCCHHHHHHHHHHCCCCCHHHHHHHHHHHCEECCCCCCCCHHHC------------------CCC-CHHHH
T ss_conf             87057-98-88305889999836785210899999973703178887222104------------------789-87789


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHCCCCHHHHHHHHH
Q ss_conf             99899899999999630104000151336666531
Q gi|254781193|r  159 EYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTIN  193 (675)
Q Consensus       159 ~Ya~~Dv~~t~~L~~~l~~~~~~E~~~~~~~~~me  193 (675)
T Consensus       147 ~YAaaDV~yL~~~y~~L~~~l~~~~R~~~l~ee~~  181 (374)
T TIGR01388       147 EYAAADVTYLLPLYEKLTERLAEEGRLAWLEEECE  181 (374)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999988645999972059