HHsearch alignment for GI: 254781193 and conserved domain: cd06148

>cd06148 Egl_like_exo The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs.
Probab=99.67  E-value=5.4e-15  Score=115.45  Aligned_cols=157  Identities=15%  Similarity=0.069  Sum_probs=111.4

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEEECCCCHH--HHHHHHHHHCCCCCEEEEEEHHHHHHH
Q ss_conf             689998141789870004400112798199999998480399997888104--379999986388981999730774999
Q gi|254781193|r    2 ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPV--MPQVLKEALENTDVTIVAHNSYFERTV   79 (675)
Q Consensus         2 k~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~d~~~~~~--~~~~l~~~L~~~~~~kV~HNa~FD~~~   79 (675)
T Consensus        11 ~vi~iD~E~~~--------~~~---~g~l~LiQiat~~~~vyl~D~~~~~~~~~~~~Lk~iLe~~~I~KV~H~~r~D~~~   79 (197)
T cd06148          11 KVIGLDCEGVN--------LGR---KGKLCLVQIATRTGQIYLFDILKLGSIVFINGLKDILESKKILKVIHDCRRDSDA   79 (197)
T ss_pred             CEEEEECCCCC--------CCC---CCCEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECHHHHHHH
T ss_conf             99999888678--------898---9988799996489988999616676344568999995699823999610999999


Q ss_pred             HHHHCCCCCCCCCEEEHHHHHHHHCC----------CCCHHHHHHH-CCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99860899884203316889998678----------9996898998-299811004379999862021123433234678
Q gi|254781193|r   80 LKACFNLDIPIHRWICTLVLARSNGL----------PSALKAVGEA-LKLSSQKMEEGKELIARFCKGETHECLYDRNKP  148 (675)
Q Consensus        80 L~~~~Gi~i~~~~~~DTmi~A~~l~~----------~~sL~~la~~-l~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~~  148 (675)
T Consensus        80 L~~~~gi~~--~nvfDTqiA~~ll~~~~~~~~~~~~~~sl~~l~~~~l~~~~~~~~~~~~~~~----------~~~s~W~  147 (197)
T cd06148          80 LYHQYGIKL--NNVFDTQVADALLQEQETGGFNPDRVISLVQLLDKYLYISISLKEDVKKLMR----------EDPKFWA  147 (197)
T ss_pred             HHHHHCCCC--CCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHH----------CCCCCCC
T ss_conf             999709970--6703199999997531314767756415999999995764017787788875----------0655446


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHCC
Q ss_conf             5853289999998998999999996301040001
Q gi|254781193|r  149 NHREAWRLFGEYCKGDVTVTREIFKRLEPLSSKE  182 (675)
Q Consensus       149 ~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~~~E  182 (675)
T Consensus       148 ~RPL-t~~ql~YAa~DV~yL~~L~~~L~~~Li~~  180 (197)
T cd06148         148 LRPL-TEDMIRYAALDVLCLLPLYYAMLDALISK  180 (197)
T ss_pred             CCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7999-99999999998999999999999999999