HHsearch alignment for GI: 254781193 and conserved domain: pfam00940

>pfam00940 RNA_pol DNA-dependent RNA polymerase. This is a family of single chain RNA polymerases.
Probab=97.44  E-value=0.0094  Score=36.23  Aligned_cols=179  Identities=11%  Similarity=0.042  Sum_probs=100.4

Q ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             01110165202100288888899879870888311345565554555567888899998876431000102207888999
Q gi|254781193|r  427 DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV  506 (675)
Q Consensus       427 ~~R~~aK~~~~g~~YG~G~~~l~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~  506 (675)
T Consensus       154 i~Rk~vKr~vMT~~Yg~t~~g~~~qi~~~l~~~~~~~---------------------------~~~~~~~~~~yla~~i  206 (391)
T pfam00940       154 ITRKVVKQTVMTLVYGVTFYGAREQIKDQLKEKGTDE---------------------------SKVLSYKAANYLAKII  206 (391)
T ss_pred             CCHHHHHCCEEEEECCCCCCHHHHHHHHHHHHCCCCC---------------------------CHHHHHHHHHHHHHHH
T ss_conf             6686640321664226662009999999998436873---------------------------1456789999999999


Q ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCEEECC-CCCCCCCCCCCCCHHHHCCHHH
Q ss_conf             999998788789999999999999975491796215421133222344564023247-6631016786621021010023
Q gi|254781193|r  507 KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLP-SGRSLVYRDVGNNRSYLNTTTR  585 (675)
Q Consensus       507 ~~~~r~~~p~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p-~GR~~~~~~~~~~~~~~~~~~~  585 (675)
T Consensus       207 ~~si~~v~~~a~~~m~wL~~~a~~~~~~~~pv~W~TP~Gf~V~Q~Y~k~~~~~V~t~l~~~~~~~~~~~~-----~~~d~  281 (391)
T pfam00940       207 FEAIKEVFPGAREIMDWLNECAKLIAKLNIPVVWTTPLGLPVVQPYRKSKKKRVKTSLQGVSRIKVITLT-----PVSDK  281 (391)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEECCCCCEEEEEEECCEEEECCCCCC-----CCCCH
T ss_conf             9999998574999999999999999828996599999999898641688757999861566886135666-----65675


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEEEECCCCHHHHHH
Q ss_conf             456777531456554536889999999999999679818899525899977924899999
Q gi|254781193|r  586 QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNAS  645 (675)
Q Consensus       586 ~~~r~~~~~~k~~n~~iQgtaadi~k~ami~l~~~g~~ivl~VHDEiv~evp~~~~~~~~  645 (675)
T Consensus       282 ~Kq~~a----~~PNf-IHSlDAshl~~t~~~~~~~gi~-f~~IHDsf~tha--~d~~~l~  333 (391)
T pfam00940       282 RKQKSA----FPPNF-IHSLDASHLMLTALACIKAGIP-FASVHDSFWTHA--NDVDKMN  333 (391)
T ss_pred             HHHHCC----CCCCH-HHHHHHHHHHHHHHHHHHCCCC-EEEEEECCCCCC--CCHHHHH
T ss_conf             654236----79741-3334489999999999856998-788710788772--1499999