PSIBLAST alignment of GI: 254781193 and protein with PDB id: 1kln

>gi|809180|pdb|1KLN|A Chain A, Dna Polymerase I Klenow Fragment (E.C.2.7.7.7) MutantDNA Complex Length = 605
 Score =  425 bits (1093), Expect = e-116,   Method: Composition-based stats.
 Identities = 101/701 (14%), Positives = 204/701 (29%), Gaps = 167/701 (23%)

Query: 8   FETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMPQVL 57
            ET S  +++            ++  +F  +          HD              ++L
Sbjct: 33  TETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELL 82

Query: 58  KEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKAVGE 114
           K  LE+     V  N  ++R +L     +++       T++ +           + ++ E
Sbjct: 83  KPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDSLAE 140

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
                         L  +    E            ++ A    G Y   D  VT ++  +
Sbjct: 141 R------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 188

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   K              L  +   I   G  +D  + H  ++ + +   +L+++  
Sbjct: 189 MWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH 248

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 249 EIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 307

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 308 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 365

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 366 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 401

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    VT +QR   K +                    G++ 
Sbjct: 402 TAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYGMS- 446

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 447 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 477

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 478 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 511

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+              +++ VHDE+V
Sbjct: 512 RRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELV 562

Query: 634 CETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    D    +  ++ LM +       +PL  E    + +
Sbjct: 563 FEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601