PSIBLAST alignment of GI: 254781193 and protein with PDB id: 3hp6

>gi|299688922|pdb|3HP6|A Chain A, Crystal Structure Of Fragment Dna Polymerase I From Bacillus Stearothermophilus F710y Mutant Bound To G:t Mismatch Length = 580
>gi|299688923|pdb|3HP6|D Chain D, Crystal Structure Of Fragment Dna Polymerase I From Bacillus Stearothermophilus F710y Mutant Bound To G:t Mismatch Length = 580
 Score =  303 bits (776), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 87/668 (13%), Positives = 180/668 (26%), Gaps = 143/668 (21%)

Query: 26  EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFE---RTVLKA 82
            D  ++  A    +     +      +        L +         S F+     V   
Sbjct: 32  HDAPIVGIAVV--NEHGRFFLRPETALADPQFVAWLGDETKKK----SMFDSKRAAVALK 85

Query: 83  CFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECL 142
              +++    +   L+ A        +  V  A      KM++ + +             
Sbjct: 86  WKGIELXGVSFD-LLLAAYLLDPAQGVDDVAAA-----AKMKQYEAVRPDEAVYGKGA-- 137

Query: 143 YDRNKPNHREAWRLFGEYCKGDVTVTR----EIFKRLEPLS--SKEQELWYLDQTINDRG 196
             R  P+                 + R    E+ +  +       EQ L  +   +   G
Sbjct: 138 -KRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAG 196

Query: 197 YCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE 256
             VD      + + +  +   ++Q +  L      +    ++L   LF +  L +   T+
Sbjct: 197 VKVDTKRLEQMGKELAEQLGTVEQRIYELAGQ-EFNINSPKQLGVILFEKLQLPVLKKTK 255

Query: 257 ---TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGA 313
              +T   VL            + + R    +     +  L++ +    +   T+     
Sbjct: 256 TGYSTSADVLEKLAPYHEIVENILHYRQ-LGKLQSTYIEGLLKVVRPATKKVHTIFNQAL 314

Query: 314 SRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASE- 372
           ++TGR S      QN+P       +                         +R   + SE 
Sbjct: 315 TQTGRLSSTEPNLQNIPIRLEEGRK-------------------------IRQAFVPSES 349

Query: 373 GKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIG 432
              +  AD + IE RVLA +A +   ++AF    D++  T    F V+  +VT + R   
Sbjct: 350 DWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQA 409

Query: 433 KVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEH 492
           K +                    G++    A                             
Sbjct: 410 KAVNY--------------GIVYGISDYGLAQ---------------------------- 427

Query: 493 AIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMK 552
                          + + +    V           ++  + G                 
Sbjct: 428 --NLNISRKEAAEFIERYFESFPGVKRYM---ENIVQEAKQKGYVTTLLH---------- 472

Query: 553 KDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAE 612
                        R     D+ +             R            +Q  + DI+ +
Sbjct: 473 -------------RRRYLPDITSRNF---NVRSFAERMAMNTP------IQGSAADIIKK 510

Query: 613 GMMNA------TKAGYDIVLTVHDEIVCETPDTDEFNASMLY-HLMTSNPSWAKGLPLKA 665
            M++        +    ++L VHDE++ E P  +      L   +M    +    +PLK 
Sbjct: 511 AMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT--LRVPLKV 568

Query: 666 EGYESKRY 673
           + +    +
Sbjct: 569 DYHYGSTW 576