PSIBLAST alignment of GI: 254781193 and protein with PDB id: 5ktq

>gi|6730045|pdb|5KTQ|A Chain A, Large Fragment Of Taq Dna Polymerase Bound To Dctp Length = 543
>gi|157831628|pdb|1KTQ|A Chain A, Dna Polymerase Length = 543
 Score =  314 bits (805), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 104/610 (17%), Positives = 186/610 (30%), Gaps = 149/610 (24%)

Query: 76  ERTVLKACFNLDIPIHRWICTLVLARSNGLPSAL-KAVGEALKLSSQKMEEGKELIARFC 134
           + +VL     L +P       ++LA      +   + V                      
Sbjct: 66  DLSVLALREGLGLPPG--DDPMLLAYLLDPSNTTPEGVARRYG----------------- 106

Query: 135 KGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTIND 194
            GE  E   +R   + R    L+G          R ++         E+ L  +   +  
Sbjct: 107 -GEWTEEAGERAALSERLFANLWGRLEGE----ERLLWLYR----EVERPLSAVLAHMEA 157

Query: 195 RGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLH---- 250
            G  +DVA    L+  V  E  +L+ E+  L      +    ++L+  LF E GL     
Sbjct: 158 TGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHP-FNLNSRDQLERVLFDELGLPAIGK 216

Query: 251 LEDLTE-TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTL 308
            E   + +T   VL + ++  P   ++   R   ++     ++ L + ++   GRL    
Sbjct: 217 TEKTGKRSTSAAVLEALREAHPIVEKILQYR-ELTKLKSTYIDPLPDLIHPRTGRLHTRF 275

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
               A+ TGR S      QN+P  +                          +   +R   
Sbjct: 276 NQ-TATATGRLSSSDPNLQNIPVRTP-------------------------LGQRIRRAF 309

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           IA EG  LV  D + IE RVLA ++G++  ++ F+ G D++  T +  F V    V    
Sbjct: 310 IAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLM 369

Query: 429 RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQEN 488
           R   K +                    G++                              
Sbjct: 370 RRAAKTINF--------------GVLYGMS------------------------------ 385

Query: 489 HPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL 548
               + E        +   + + Q   +V      + +  E+    G             
Sbjct: 386 AHRLSQELAIPYEEAQAFIERYFQSFPKVRAW---IEKTLEEGRRRGYVETL-------- 434

Query: 549 VYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRD 608
                           GR     D+      + +      R            VQ  + D
Sbjct: 435 ---------------FGRRRYVPDLEAR---VKSVREAAERMAFNMP------VQGTAAD 470

Query: 609 ILAEGMM----NATKAGYDIVLTVHDEIVCETPDTDEFNASML-YHLMTSNPSWAKGLPL 663
           ++   M+       + G  ++L VHDE+V E P       + L   +M      A  +PL
Sbjct: 471 LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLA--VPL 528

Query: 664 KAEGYESKRY 673
           + E    + +
Sbjct: 529 EVEVGIGEDW 538