BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781193|ref|YP_003065606.1| putative DNA polymerase from
bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62]
         (675 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040870|gb|ACT57666.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120755|gb|ADV02576.1| DNA polymerase A [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 675/675 (100%), Positives = 675/675 (100%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA
Sbjct: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS
Sbjct: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120

Query: 121 QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS 180
           QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS
Sbjct: 121 QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS 180

Query: 181 KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK 240
           KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK
Sbjct: 181 KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK 240

Query: 241 TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS 300
           TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS
Sbjct: 241 TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS 300

Query: 301 DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII 360
           DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII
Sbjct: 301 DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII 360

Query: 361 SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA 420
           SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA
Sbjct: 361 SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA 420

Query: 421 PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN 480
           PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN
Sbjct: 421 PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN 480

Query: 481 FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA 540
           FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA
Sbjct: 481 FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA 540

Query: 541 RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN 600
           RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN
Sbjct: 541 RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN 600

Query: 601 IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG 660
           IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG
Sbjct: 601 IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG 660

Query: 661 LPLKAEGYESKRYRK 675
           LPLKAEGYESKRYRK
Sbjct: 661 LPLKAEGYESKRYRK 675


>gi|313895585|ref|ZP_07829141.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975711|gb|EFR41170.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 645

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 216/697 (30%), Positives = 315/697 (45%), Gaps = 75/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S + L K G+ KYAE  D  ++LF +  D   V++ D  +   +P+ + 
Sbjct: 1   MKSISIDVETFSSVPLAKAGVYKYAESEDFEILLFGYSVDGGEVQVVDLANGEEIPKEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  VT  A N+ FER  L     + +  + W C+++ A + GLP +LK VG  L L
Sbjct: 61  AALTDETVTKWAFNAMFERVCLSRHLGIHLKPNAWRCSMIWAATLGLPLSLKDVGAVLWL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             QK+EEGK+LI  F   CK         RN P +  E W+LF EY K DV     I  R
Sbjct: 121 DRQKLEEGKDLIRYFCVPCKATRSNGGRTRNLPADAPEKWKLFTEYNKRDVETEMAIQAR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L+  P+   E E + +DQ INDRG  VD           +  +    +  ++LT   + +
Sbjct: 181 LKKFPVPESEWENYVIDQEINDRGILVDTTFVTQAICCDERSKAVCLERAQNLTD--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL +E L ++    V    K  T    +V   R + S+++V K  
Sbjct: 239 PNSPLQLMDWLHGK-GLSVESLAKS---EVTKMLKTATGDVREVLELRQQLSKTSVKKYM 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            +     +D R RG  QF GA+RTGR++G +   QNLP+   +  +  + +         
Sbjct: 295 AMEAVTGADHRARGLFQFYGANRTGRFAGRLIQLQNLPQNHLAQLKEVRTLVKDGDFELL 354

Query: 353 D---PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
           D        ++S  +R+  +     + VVAD A IEARVLAW+AGEQW L  F    D+Y
Sbjct: 355 DMLYDSTSDVLSQLIRTSFVPHPACRFVVADYAAIEARVLAWLAGEQWVLDVFREHGDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T +R F+    +     D R  GK   L+ GY G   A   M                
Sbjct: 415 CETASRMFHCKVEKHGENADLRQKGKQAVLSCGYGGSVGALVAMG--------------- 459

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+E        + +   WR  +  + + W ++ +A
Sbjct: 460 -------------------------AVESGMKEEELQPLVDLWRASNPHIVQFWWDVDRA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTT-- 583
            +  ++    +     R V           L + LPSGR L Y    +G NR    +   
Sbjct: 495 VKTCVKRRVEVETHGIRCV------YKSGVLFIRLPSGRELAYAKPRIGENRFGGESVTY 548

Query: 584 -----TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                T++  R  T+GGKL ENI Q  +RD+L   M      G+DIV+ VHDEIV E P 
Sbjct: 549 EGLGMTKKWERIETFGGKLVENITQGTARDLLVFAMKQLRNRGFDIVMHVHDEIVLEVPY 608

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +M  NP WAKGLPLKA+GYE + YRK
Sbjct: 609 G-VSSVEEICSIMAENPPWAKGLPLKADGYECEFYRK 644


>gi|293401134|ref|ZP_06645278.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305260|gb|EFE46505.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 646

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 203/702 (28%), Positives = 305/702 (43%), Gaps = 84/702 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L K G+ +Y E  +  ++LFA+  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDVQLPKTGVYRYCESDNFEILLFAYSIDSQPVQVVDLACGETIPEEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+  V   A N+ FER  L           +    W C+++ A + GLP +L+ VG 
Sbjct: 61  AALEDDTVIKWAFNAAFERICLSRFLGYPTGTYLSPESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W  F  Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIKYFCQPCAATKANGGRTRNRPFHAPDKWEAFKRYNIRDVETEMG 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  +L   P+ ++  E +++DQ INDRG  +D+ L      +    R +L   ++ +T  
Sbjct: 181 IQHKLRKFPVPNEVWEEYHIDQEINDRGVRLDMELVSQAIAMDTRSREELTAAIKDMT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL    G+  + L +     +L            V   R + ++S+V
Sbjct: 239 ELENPNSVQQMKQWLSD-NGIETDSLDKKAVAELLKDAPDN---LADVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT 348
            K   + + + SDGR RG  QF GA+RTGR+SG     QNLP+         + +     
Sbjct: 295 RKYQAMEKTVCSDGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLSEARSLVRSGD 354

Query: 349 ---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  I  E     VAD + IEARV+AW AGE W+ + FE G
Sbjct: 355 FDGVELLYEDVPDTLSQLIRTAFIPRENALFYVADFSAIEARVIAWFAGESWRQQVFEKG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTF 462
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M +   GLN    
Sbjct: 415 GDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGALDMGLNEEEL 474

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                                      +  AWRQ + R+ E W 
Sbjct: 475 PA-----------------------------------------LVDAWRQANPRIVEFWW 493

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN---- 576
            + +A  + ++               +        L + LPSGR L Y    +G N    
Sbjct: 494 AVDRAVMEAVKYKHTTTDYG------LTFSCKSGMLFITLPSGRKLAYVKPKIGTNKFGG 547

Query: 577 --RSYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
              +Y     T++  R  +YG K  ENIVQA +RDIL   M         IV+ +HDE+V
Sbjct: 548 SCITYEGVGGTKKWERLDSYGPKFVENIVQATARDILCYAMKTL--RCCSIVMHIHDELV 605

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E       +   +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 606 IEADPK--VSLDAICEQMGRTPPWAKGLLLRADGYTTPFYKK 645


>gi|167039879|ref|YP_001662864.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300915307|ref|ZP_07132621.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307724797|ref|YP_003904548.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
 gi|166854119|gb|ABY92528.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300888583|gb|EFK83731.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307581858|gb|ADN55257.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
          Length = 644

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 210/697 (30%), Positives = 327/697 (46%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+ +YAE  D  ++LF +  D  PV++ D      +P+ ++
Sbjct: 1   MRTLSIDIETFSSVDLAKSGVYRYAEAPDFEILLFGYSVDAGPVQVVDFACGEKIPKEIQ 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +A+ + +VT  A N+ FER  L   F + +    W CT+V +   GLP +L+        
Sbjct: 61  QAILDNNVTKWAFNAQFERICLSKYFGIHLAPDSWRCTMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             +K+ +GKELI  F   CK         RN P H  E W  F  Y   DV V   I ++
Sbjct: 121 DKKKLTKGKELIRYFSVPCKPTVTNGGRTRNLPEHAPEKWNSFKAYNLRDVEVELSIQEK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L+  P+  +E   + LDQ INDRG  +D+ L     Q  +  R +L   L+ LT   + +
Sbjct: 181 LQKFPMPEEEWNNYILDQQINDRGIQLDLELVKKAIQCDEKVREELTSRLKELTD--LDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + ++K+WL  + GL  + L + + + +L    +   +       R   ++S+V K  
Sbjct: 239 PNSVVQMKSWLSEK-GLETDSLDKASVKALLKEAPEHLSEV---LELRQLLAKSSVKKYT 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLPTS 349
            +  A+ +DGR RG LQF GA+RTGR++G +   QNLP+   S  E  + +    H    
Sbjct: 295 AMENAVCTDGRARGLLQFYGANRTGRFAGRLIQVQNLPQNHLSDLEQARRLVRGGHFDAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S+ +R+  +  +G K +VAD + IEARV+AW+AGE W+ + F T   +Y
Sbjct: 355 EILYDSIPGVLSELIRTAFVPKKGYKFIVADFSAIEARVIAWLAGETWRNEVFATHGKIY 414

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +VTK    R  GK+ ELALGY G   A + M +              
Sbjct: 415 EASASQMFKVPLEEVTKGSPLRQKGKIAELALGYGGSVGALKAMGA-------------- 460

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                     ++        + +  AWR  +  +  LW ++ +A
Sbjct: 461 --------------------------LDMGLTEEELKPLVYAWRNANPNIVRLWWDVDRA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG--------NNRSY 579
            ++ +         + R       +     L++ LPSGR L Y               +Y
Sbjct: 495 VKEAVTERCRTETHRIR------FEYRSGMLLIWLPSGRQLTYVKPRMGINSFGSEAVTY 548

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                T++  R  +YG K  ENIVQA+SRD+L   M N  ++G +IV+ VHDE+V E P 
Sbjct: 549 EGVGATKKWERIESYGPKFVENIVQAISRDLLCHSMRNLDESGLNIVMHVHDEVVLEVP- 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             E     +  LM   P WA GL L+A+G+E   Y+K
Sbjct: 608 -LEICVQDVCVLMGQVPPWAHGLLLRADGFECDFYKK 643


>gi|300764694|ref|ZP_07074685.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
 gi|300514580|gb|EFK41636.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
          Length = 645

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 212/700 (30%), Positives = 322/700 (46%), Gaps = 81/700 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L +D ET S +DL+KCG+ KY+E  D  ++LFA+  D  PVE+ D   D  +P  + 
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            +L +  V   A N+ FER  L     LD  +    W CT+V   + GLP +L  VG  L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFCK---GETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P+H    W  F  Y   DV V   I 
Sbjct: 121 GLDKQKLTEGKDLIRYFCVPCNPTKVNGGRTRNLPHHAPTKWSAFKTYNSRDVEVEIAIQ 180

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L   P+     + ++LDQ INDRG  +D        Q+ ++ +  L+Q+L+ LT   +
Sbjct: 181 GKLSNFPVLDSVWKEYWLDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQLQELTG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   + +++ WL    GL  E L +     +L     +     QV   R + ++S+V K
Sbjct: 239 ENPNSVLQMRGWLLDH-GLETESLGKKAVAELLEQ--PIDENLKQVLVLRQQLAKSSVKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL---P 347
              +     SD R RG  QF GA+RTGR++G     QNLP+   S     + +       
Sbjct: 296 YQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLSEARSLVKQSNFE 355

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +   ++S+ +R+  +  EG K +V+D + IEARV+AW++GE+W+ + F+ G D
Sbjct: 356 MLNILYGNVPNVLSELLRTAFVPREGMKFIVSDFSAIEARVIAWLSGEKWRQEVFKNGGD 415

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKM-ASTTGLNLNTFAH 464
           +Y  + ++ F V   +       R  GK+ ELALGY G   A + M A   GL  +    
Sbjct: 416 IYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMDALEMGLTED---- 471

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                                  + +  +WR  +  ++ELW  +
Sbjct: 472 -------------------------------------ELQPLVNSWRDSNINITELWWAV 494

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN- 581
            +A +  ++  ++           +  +     L + L SGR LVY    +G N+     
Sbjct: 495 DKAVKTCVKERRSTSTHG------IKFEYKSGFLFIQLLSGRKLVYVKPKIGENKFGGEA 548

Query: 582 ------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                   T++  R  +YG K  ENIVQA++RDIL   M N  K  Y IV  VHDE++ E
Sbjct: 549 VTYEGVGATKKWERLESYGPKFVENIVQAIARDILCFAMENLRK--YRIVGHVHDEVIIE 606

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P   E     +  LM+  P WA+GL L A+GYE + Y+K
Sbjct: 607 VP--MESKVEDICQLMSQTPKWAEGLLLNADGYECEFYQK 644


>gi|225573258|ref|ZP_03782013.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039390|gb|EEG49636.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
          Length = 645

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 214/697 (30%), Positives = 325/697 (46%), Gaps = 78/697 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL+KCG+ KYA      V+LF +  D   V + D      +P+ + 
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYTADGGDVRVVDLACGEQIPEEVI 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +T VT  A N+ FER  L       +    W CT+V + + GLP +L++ G AL L
Sbjct: 64  SALSDTSVTKWAFNAMFERVCLSNFLGEWLEPEGWHCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+ EGK+LI  F   C+         RN+P H  E W  F  Y   DV    +I KR
Sbjct: 124 EKQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHDPEKWERFKAYNLRDVETEMQIQKR 183

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+     E ++LDQ INDRG  VD+ L      +    R +L   L+ LT   + +
Sbjct: 184 LSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAMDARSREQLTDALQELTG--LDN 241

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              ++++K WL    GL  + L +     ++   +        V + R + ++S+V K  
Sbjct: 242 PNSVQQMKQWLADH-GLETDTLGKKVVAELV---RSAPEPLKTVLSLRQQLAKSSVKKYA 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            +  A+ +DGR  G  QF GA+RTGR+SG +   QNLP+   S     + +    +    
Sbjct: 298 AMENAVCADGRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMSDLAQARALMRGGNYEAI 357

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                D    +S  +R+  +  +G+K +VAD + IEARV+AW AGE+W+LK FE G+D+Y
Sbjct: 358 SMLYEDIPDTLSQLIRTAFVPQDGRKFIVADFSAIEARVIAWFAGERWRLKVFEDGDDIY 417

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F+V   +       R  GK+ ELALGY G   A + M                
Sbjct: 418 SASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG--------------- 462

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+E        + +  AWR  +  +++ W ++ +A
Sbjct: 463 -------------------------ALEMGLAEEELQPLVDAWRTSNPMITQFWWDVDRA 497

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR------SY 579
            ++ ++    + +        ++       L + LPSGR L Y    +G N+      +Y
Sbjct: 498 VKECVKKRVPMESHG------LHFDYRSAMLFITLPSGRRLAYVKPRIGENQFGRESVTY 551

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
           +  +  ++  R  +YG K  ENIVQ  +RDIL   M         IV  VHDEI+ E   
Sbjct: 552 MGVSGAKKWERLESYGPKFVENIVQGTARDILCYAMRTL--RNCAIVAHVHDEIIIEA-- 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               + S +   M   PSWAKGL L+A+GYE + Y+K
Sbjct: 608 DRRMSLSAVCEQMGRTPSWAKGLKLRADGYECEFYQK 644


>gi|313898058|ref|ZP_07831597.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
 gi|312957086|gb|EFR38715.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
          Length = 646

 Score =  541 bits (1394), Expect = e-151,   Method: Composition-based stats.
 Identities = 203/701 (28%), Positives = 316/701 (45%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  +  ++LFA+  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDHQPVQVIDLACGEQIPKEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+ DV   A N+ FER  L           +    W C++V A + GLP +L+ VG 
Sbjct: 61  LALEDEDVIKWAFNAAFERICLSRFLGYPTGEYLDPESWRCSMVWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W +F +Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETEMG 180

Query: 171 IFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I +R    P+ ++  + +++DQ INDRG  +D+ L     ++    RTKL + ++ +T  
Sbjct: 181 IQQRLARFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTKLTETMKEIT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL    GL  + L +     +L   K   P+  QV   R + ++S+V
Sbjct: 239 ELENPNSVQQMKAWLSD-NGLETDTLGKKAVAELL---KSAPPKLSQVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---H 345
            K   + + + +DGR RG  QF GA+RTGR+SG     QNLP+   S     + +    +
Sbjct: 295 RKYQAMEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLSDLAEARSLVRSGN 354

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  I  EG + +VAD + IEAR++AW AGE+W+   F  G
Sbjct: 355 FEAVELLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARIIAWFAGEKWRQDVFAKG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M +          
Sbjct: 415 GDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA---------- 464

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                         ++          +  AWRQ +  + + W  
Sbjct: 465 ------------------------------LDMGLTEDELPPLVDAWRQSNPNIVKFWWN 494

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           +  A  + ++               +        L + LPSGR L Y    +G N+    
Sbjct: 495 VDHAVMEAVKFKHTTSEYG------LTFSCRSGMLFITLPSGRKLAYVKPKIGTNKFGGQ 548

Query: 582 -------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
                   +T++  R  +YG K  ENIVQA +RDIL   M         IV+ +HDE+V 
Sbjct: 549 CITYEGIGSTKKWERLDSYGPKFVENIVQATARDILCYAMQTL--RCCSIVMHIHDEVVI 606

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E   +   +   +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 607 EADPS--MSLDAICEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|300853539|ref|YP_003778523.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300433654|gb|ADK13421.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 649

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 199/701 (28%), Positives = 317/701 (45%), Gaps = 79/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S ++L K G+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKFISIDIETFSSVNLQKSGVYRYAESEDFDILLFGYSVDGGEVKVIDLARGEKIPIEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            AL +  V   A N+ FER  L     +     +    W CT++ A + GLP +L+ VG 
Sbjct: 61  NALTDDSVIKWAFNAQFERICLSKWLGMKAGTYLSPKSWQCTMIWAATLGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L    QK+ +GK LI  FC             RN P+H  E W++F  Y K DV     
Sbjct: 121 VLGFKKQKLSQGKNLIKYFCIPCSPTKSNGGRTRNLPHHDIEKWKMFTFYNKRDVETEMA 180

Query: 171 IFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  +L        E + ++LDQ IND G  +D+          +  + +  ++ + LT  
Sbjct: 181 IQNKLSKFPVSKTEWQNYHLDQIINDGGINLDMDFVRQAISCDEKFKAENIKKAKELTG- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +     +LK WL L+ G+  + L++     +L        +  +  + R + ++S+V
Sbjct: 240 -LENPNSPAQLKDWL-LKQGMKTDSLSKAVVSELLQ---DSDGEIHEALSIRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP- 347
            K  ++   + SD R RG +QF GA+RTGR+SG +   QNLP+      +  + +     
Sbjct: 295 KKYTSMENVVCSDSRARGLIQFYGANRTGRYSGRLIQVQNLPQNHLPDLKQARSLVKSGN 354

Query: 348 --TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                        ++S+ +R+  I   G + +VAD + IEARV+AW+AGE+W++  F  G
Sbjct: 355 FTALDLLYDSIPSVLSELIRTAFIPRYGSRFIVADFSAIEARVIAWLAGERWRIDVFAGG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ FNV   +       R  GK+ ELALGY G   A + M +          
Sbjct: 415 GDIYCASASQMFNVPVKKNGINGHLRQKGKIAELALGYGGSVGALKAMGAIQ-------- 466

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                              +    + +  AWR  +  ++ LW  
Sbjct: 467 --------------------------------MGLVEDELKPIVDAWRNSNPNITSLWWR 494

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           + +A +  ++  + I                   L + LPSGR L Y    +G NR    
Sbjct: 495 IDRAVKTVVKTKQPIEIYGIGIF------YQSGILFIKLPSGRRLAYVKPLIGENRFGGE 548

Query: 582 TT-------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           +        T++  R  +YG K  ENIVQA+SRDILAE M+      + IV+ VHDE+V 
Sbjct: 549 SVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILAEAMLKLATHEFQIVMHVHDEVVI 608

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P+    +   +  +M+  P+WAKGL L A+GYE + Y+K
Sbjct: 609 EAPNK-VSSVEEICRIMSETPAWAKGLILNADGYECEFYKK 648


>gi|167757895|ref|ZP_02430022.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
 gi|167664549|gb|EDS08679.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
          Length = 645

 Score =  538 bits (1386), Expect = e-150,   Method: Composition-based stats.
 Identities = 211/697 (30%), Positives = 314/697 (45%), Gaps = 78/697 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL+KCG+ KYA      V+LF +  D   V + D      +P+   
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYAADGGDVHVVDLACGEQIPEEAI 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +T VT    N+  ER  L       +    W CT+V + + GLP +L++ G AL L
Sbjct: 64  SALSDTSVTKWTFNAMLERVCLSNFLGEWLEPEGWYCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+ EGK+LI  F   C+         RN+P H  E W  F  Y   DV    +I KR
Sbjct: 124 EKQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHAPEKWERFKAYNLRDVETEMQIQKR 183

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+     E ++LDQ INDRG  VD+ L      I    R +L   +  LT   + +
Sbjct: 184 LSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAIDTRSRERLTAAMRELT--ELEN 241

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
               +++K WL    GL  + L +     ++ +  +      +V + R + ++S+V K  
Sbjct: 242 PNSAQQMKQWLADH-GLETDTLGKKAVAELVKTAPEP---LREVLSLRQQLAKSSVKKYT 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLPTS 349
            +  A+ +D R  G  QF GA+RTGR+SG +   QNLP+         + +    +    
Sbjct: 298 AMENAVCADSRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMGDLAEARALVRSGNYEAL 357

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                D    +S  +R+  +  +G+K +VAD + IEARV+AW AGE+W+LK FE G D+Y
Sbjct: 358 SVLYEDIPDTLSQLIRTAYVPQDGRKFIVADFSAIEARVIAWFAGERWRLKVFEDGGDIY 417

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F+V   +       R  GK+ ELALGY G   A + M                
Sbjct: 418 CASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG--------------- 462

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+E        + +  AWR  +  +++ W ++ +A
Sbjct: 463 -------------------------ALEMGLAEEELQPLVDAWRGSNPMITQFWWDVDRA 497

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR------SY 579
            +  I           R             L + LPSGR L Y    +G N+      +Y
Sbjct: 498 VKDCIRQRIPTETHGLR------FDYRSAMLFINLPSGRRLAYVKPRIGENQFGGESVTY 551

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
           +  + T++  R  +YG K  ENIVQ  +RDIL   M         IV  VHDEI+ E   
Sbjct: 552 MGVSGTKKWERLESYGPKFVENIVQGTARDILCYAMQTL--KNCSIVAHVHDEIIIEA-- 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               + + +   M   P WAKGL L+A+GYE + Y+K
Sbjct: 608 DRRMSVAAVCEQMGRTPPWAKGLKLRADGYECEFYQK 644


>gi|323693311|ref|ZP_08107529.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
 gi|323502794|gb|EGB18638.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
          Length = 646

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 201/701 (28%), Positives = 315/701 (44%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  +  ++LFA+  D   V++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDSQSVQVIDLACGEQIPKEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALEN  V   A N+ FER  L           +    W C+++ A + GLP +L+ VG 
Sbjct: 61  LALENETVIKWAFNANFERICLSRFLGYPTGEYLDSESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W +F +Y   DV     
Sbjct: 121 VLGLEKQKLSEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETEMG 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I +RL   P+ ++  + +++DQ INDRG  +D+ L     ++    RT+L + ++ +T  
Sbjct: 181 IQQRLAKFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTELTETMKEIT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL    GL  + L +   + V    K  +P+  QV   R + ++S+V
Sbjct: 239 ELENPNSVQQMKAWLSD-NGLETDTLGK---KAVTELLKSASPKLSQVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---H 345
            K   + + + +DGR RG  QF GA+RTGR+SG     QNLP+         + +    +
Sbjct: 295 RKYQAIEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLAEARSLVRSGN 354

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  I  EG + +VAD + IEARV+AW AGE+W+ + F  G
Sbjct: 355 FEAVKLLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARVIAWFAGEKWRQEVFAKG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M +          
Sbjct: 415 GDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA---------- 464

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                         ++          +  AWRQ +  + + W  
Sbjct: 465 ------------------------------LDMGLTEEELPPLVDAWRQSNPNIVKFWWN 494

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           +  A  + ++      +        +        L + LPSGR L Y    +G N+    
Sbjct: 495 VDHAVMEAVKFKHTTSSYG------LTFSCRSGMLFITLPSGRKLAYVKPKLGTNKFGGQ 548

Query: 582 -------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
                    T++  R  +YG K  ENIVQA +RDIL   M         IV+ +HDE+V 
Sbjct: 549 CITYEGIGGTKKWERLDSYGPKFVENIVQATARDILCYAMKTL--RCCSIVMHIHDEVVI 606

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       +   +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 607 EA--DPRMSLEAVCEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|256617076|ref|ZP_05473922.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|257088361|ref|ZP_05582722.1| DNA polymerase I [Enterococcus faecalis D6]
 gi|256596603|gb|EEU15779.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|256996391|gb|EEU83693.1| DNA polymerase I [Enterococcus faecalis D6]
          Length = 645

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 205/699 (29%), Positives = 325/699 (46%), Gaps = 79/699 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID E+ S  D++KCG  KY+E  D  ++LFA+  D  PVE+ D      +P+ + 
Sbjct: 1   MKHLSIDIESFSSADISKCGAYKYSESSDFEILLFAYSVDGQPVEVVDLAQGETIPEDVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           ++L +  V   A N+ FER  L     L+  +    W CT+V A + GLP +L  VG  L
Sbjct: 61  KSLSDETVIKHAFNANFERVCLSRFLGLNGFLNPRGWHCTMVWAATLGLPLSLAGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+L+  FC             RN P H  + WR F  Y   DV V   I 
Sbjct: 121 GLDKQKLSEGKDLVRYFCMPCNATKVNQGRTRNLPRHSLDKWRDFVAYNIRDVEVEVAIQ 180

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++L   P++ +  E ++LDQ INDRG  +D+ LA +   + +V + +++++L+ LT   +
Sbjct: 181 QKLSNFPVTQEIWEEYWLDQEINDRGIEIDMILADSAVNLDEVSKNEINEQLKKLTG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   + ++++WL    GL +E L +   + ++        +  +V   R + ++S+V K
Sbjct: 239 ENPNSVLQMRSWLSQH-GLEVESLGKAAVKELIEQ--TNDDKLKEVLLLRQQLAKSSVRK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +      D R RG  QF GA+RTGR++G     QNLP+   S     + +       
Sbjct: 296 YQAMQNYACLDNRARGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLAEARELVRNGEYE 355

Query: 351 ---TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +  +++S+ +R+  I   G K +V+D + IEARV+AW+AGE+W+ + F  G D
Sbjct: 356 LLALLYDNVPEVLSELIRTAFIPKPGMKFIVSDFSAIEARVIAWLAGEKWRKEVFRNGGD 415

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ F V   +       R  GK+ ELALGY G   A   M              
Sbjct: 416 IYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAMG------------- 462

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A+         + +  +WR+ +  +++LW ++ 
Sbjct: 463 ---------------------------ALNMGLTEDELQPLVASWRETNPAITKLWWDID 495

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN-- 581
            A +  +  G             +  +     + + L SGR L Y    +G NR      
Sbjct: 496 SAAKGCVSVGAKTETHG------ITFEYKSGFMFIQLLSGRRLAYVKPRIGQNRFGGAAV 549

Query: 582 -----TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
                 TT++  R  +YG K  ENIVQA++RDIL   M N     Y IV  VHDE++ E 
Sbjct: 550 TYEGVGTTKKWERLESYGPKFVENIVQAMARDILCFAMQNL--KDYRIVGHVHDEVIIEV 607

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P         +  +M+  P+WAKGL L A+GYE   Y+K
Sbjct: 608 PKE--VTVEEVNSIMSQTPNWAKGLLLNADGYECDFYQK 644


>gi|254975142|ref|ZP_05271614.1| DNA polymerase [Clostridium difficile QCD-66c26]
 gi|255314269|ref|ZP_05355852.1| DNA polymerase [Clostridium difficile QCD-76w55]
 gi|255516949|ref|ZP_05384625.1| DNA polymerase [Clostridium difficile QCD-97b34]
 gi|255650051|ref|ZP_05396953.1| DNA polymerase [Clostridium difficile QCD-37x79]
 gi|260686788|ref|YP_003217921.1| dna-directed dna polymerase i [Clostridium difficile R20291]
 gi|306519586|ref|ZP_07405933.1| dna-directed dna polymerase i [Clostridium difficile QCD-32g58]
 gi|260212804|emb|CBE03971.1| dna-directed dna polymerase i [Clostridium difficile R20291]
          Length = 652

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 222/701 (31%), Positives = 336/701 (47%), Gaps = 76/701 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 --SSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V REI 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 173 KRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L    + E+E+  WYLDQ IND G  VD  L     +       KL +E   +T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           ++     +LK WL  + G  +  LT+ +   +L          +++   R   S++++ K
Sbjct: 239 NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDEN--VVRILELRKLMSKTSIKK 296

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A  +D R+RG LQF GA+RTGRW+G +   QNLP+      +L + +       
Sbjct: 297 YEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFD 356

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                      ++S  +R+  I SEG + +V+D + IEARV+AW AGE+W+L  F +   
Sbjct: 357 LIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWFAGEKWRLDVFNSHGK 416

Query: 408 LYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + +  F V     +     R  GK+ ELALGY G   A   M +            
Sbjct: 417 IYEASASHMFKVPIESIKKGDPLRQKGKISELALGYGGSIGALTSMGAIK---------- 466

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                                 + +   WR  +  +++ W ++ 
Sbjct: 467 ------------------------------MGLDEEELQPLVTTWRNANPNITKFWWDVD 496

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDV-------GNN 576
           +A ++ I++   +  +       +    +   L + LPSGR L Y    +       G+ 
Sbjct: 497 KAAKKAIKDRTIVKLQ-----HGIKFIYNPGVLFIELPSGRRLSYLRPKIEPHTTFSGDK 551

Query: 577 RSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
            +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T AGY IV+ VHDE+V 
Sbjct: 552 ITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVI 611

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +       +   +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 612 DVDKK-GGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|153938384|ref|YP_001391676.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
 gi|152934280|gb|ABS39778.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
          Length = 658

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 224/702 (31%), Positives = 323/702 (46%), Gaps = 76/702 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + TL ID ET S +D+   G  KY E  D  ++LFA+ F+D PV++ D  +   +P  + 
Sbjct: 5   IDTLSIDVETYSSMDIKTSGAYKYCESPDFEILLFAYAFNDEPVQIVDLANGEKLPSNVF 64

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + ++   A N+ FER  +K  +    P  +W CT+V A + GLPS+L  VG+ALK 
Sbjct: 65  YALTDPNIIKTAFNANFERNSIKNQYPALCPPEQWECTMVKALTLGLPSSLDMVGKALKF 124

Query: 119 --SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               QKM+EGK LI  F   CK         RN P H  E W  F EYCK DV V REI 
Sbjct: 125 EEDKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVEREIR 184

Query: 173 KRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
             L    +K +E   W LDQ INDRG   D+ L     +       +L +    LT   +
Sbjct: 185 NLLNRYETKVEEQKLWQLDQHINDRGIGTDLILIKQAIECDTNYTERLTKAAIELTG--L 242

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLT-PQAIQVFNNRMRASRSAVL 289
            +     ++K W+    G  ++ LT+T+   ++     L   + I++   R   +++++ 
Sbjct: 243 ENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEATSLNKSEVIKMLELRQLMAKTSIK 302

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HL 346
           K +T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP+      +  +        
Sbjct: 303 KYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVREGKF 362

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                        +S  +R+  I  EG + +V+D + IEARV+AW AGEQW+L  F T  
Sbjct: 363 QEVEFLFDSVPDTLSQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRLDVFSTHG 422

Query: 407 DLYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ F VA    +   + R  GK+ ELALGY G   A   M     +       
Sbjct: 423 KIYEASASQMFKVAIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKSIPEEELP- 481

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                                    + K+WR  +  +++ W ++
Sbjct: 482 ----------------------------------------GLVKSWRNANPNITKFWWDV 501

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS------ 578
            +A ++ I     +  +       +    D   L + LPSGR L Y              
Sbjct: 502 DKAAKKVIRERTTVNLQYG-----LKFIYDPGVLFIQLPSGRKLSYIRPKIEPHETFSGD 556

Query: 579 -----YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
                 +  T++Q  R  TYG KL ENIVQA SRD L E M    KAGYDIV+ VHDE+V
Sbjct: 557 KITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVDKAGYDIVMHVHDEVV 616

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P         +  LM     WA GLPLKA+GYE   Y+K
Sbjct: 617 LDIPKDRA-TVKEINELMGQPIEWAPGLPLKADGYECNYYQK 657


>gi|323484113|ref|ZP_08089483.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
 gi|323402555|gb|EGA94883.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
          Length = 646

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 215/695 (30%), Positives = 327/695 (47%), Gaps = 75/695 (10%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
            L ID ET S +DL KCG+  YA+     V+LFA+ FD    ++ D      +P  +  A
Sbjct: 4   ILEIDIETYSDVDLIKCGVYAYADSPAFEVLLFAYSFDGGETQVIDLAQGEELPGEVSAA 63

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           + + DV   A N+ FERT L   F   +    W C+ V A    LP +L+ VG  L L  
Sbjct: 64  IFDDDVMKTAFNANFERTCLSKHFGKQLSPESWHCSAVQAAMLALPRSLEEVGAVLGLEQ 123

Query: 121 QKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLE 176
           QKM+EGK+LI  F   CK         RN P +  E W LF  YC  DV V +EI ++L+
Sbjct: 124 QKMKEGKDLIRYFCMPCKPTKANGGRTRNLPCHAPEKWELFKSYCIRDVDVEKEIRRKLQ 183

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P+   E EL+ LDQ INDRG  VD  L         + +  + +    LT   + +  
Sbjct: 184 HFPIPESEMELYRLDQKINDRGVLVDRELVRQAVSCDLLYKDVVTKRAYELTG--LENPN 241

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
            + ++K+WL    G+ +E L++ T   ++        +  ++   R+  ++++V K   +
Sbjct: 242 SVAQIKSWLGE-NGVEMESLSKKTVAGLIEE---SDGEVQELLRLRLLMAKTSVKKYEAM 297

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL---PTSIT 351
             ++ SDGR+ G LQF GA+RTGRW+G +   QNLP+      E+ + +           
Sbjct: 298 ERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHILDLEMARNLVKQGRFEDVEL 357

Query: 352 SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
                  ++S+ +R+  I   G + VVAD + IEARVLAW++GE+W+L+ F +   +Y  
Sbjct: 358 LYDSTPNVLSELIRTAFIPKPGYRFVVADFSAIEARVLAWLSGERWRLEVFASHGKIYEA 417

Query: 412 TYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
           + +  F+V   +VTK       GK+ ELALGY G   A   M                  
Sbjct: 418 SASAMFHVPIEEVTKGSPFRQKGKISELALGYGGAVGALTSMG----------------- 460

Query: 470 SAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
                                  A++   +      +  AWR  +  +++ W ++  A  
Sbjct: 461 -----------------------ALDMGLVEEELAPLVSAWRSANPHITQFWWDVDAAAV 497

Query: 530 QTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT--- 584
           + +   K   A +      +  +     L + LPSGR L Y    +  N+   N  T   
Sbjct: 498 KAVTEKKKTRAGR------IVFEYKSGILFVELPSGRKLSYVKPRMALNKFGRNGLTYEG 551

Query: 585 ----RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
               ++  R  TYG KL ENIVQ  +RD+LAE M+   + GY IV+  HDEI+ E P+  
Sbjct: 552 IAENKKWDRIETYGPKLVENIVQGTARDLLAEAMLRVEEMGYPIVMHCHDEIIAEVPEGT 611

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +   +  +M   P WA GLPL+A+GYE   Y+K
Sbjct: 612 -GSVEEMCAVMAVQPEWADGLPLRADGYECAFYKK 645


>gi|284048474|ref|YP_003398813.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952695|gb|ADB47498.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 662

 Score =  531 bits (1368), Expect = e-148,   Method: Composition-based stats.
 Identities = 206/717 (28%), Positives = 315/717 (43%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ++L KCG+ KYAE     ++LF +  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGPVQVVDLAQGESIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF--------------------NLDIPIHRWICTLV 98
           +AL +  VT  A N+ FER  L                           +    W C++V
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRHLTDLGRSLDPFHDQHPLSKKCARFLNPAGWKCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAW 154
            +   GLP +L+ VG  L L +QKM+EG+ELI  F   CK         RN P H  + W
Sbjct: 121 WSAYLGLPLSLEGVGAVLNLDNQKMKEGRELIRYFCIPCKETKANGGRTRNLPQHALDKW 180

Query: 155 RLFGEYCKGDVTVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
            LF  Y K DV V   I +R    P+  +  E ++LDQ INDRG  +D+ LA     +  
Sbjct: 181 NLFKSYNKRDVEVEMAIQQRLQKYPVPKQVWEEYHLDQEINDRGIAIDLELAKQAVALDA 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R  L   L+  T   + +   + ++  WL  + GL  + L +   Q +L + ++    
Sbjct: 241 KSRESLMAALKERTG--LENPNSVIQMLDWL-EQHGLKTDSLGKKNVQELLKTAQEP--- 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
              V   R + ++S+V K   +      DGR RG  QF GA+RTGR++G     QNLP+ 
Sbjct: 295 LRSVLLLRQKLAKSSVKKYQAMEMTACKDGRARGMFQFYGANRTGRFAGRHIQLQNLPQN 354

Query: 333 SRSHEELDQIIT---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                   + +    +             ++S  +R+  +   G K VV+D + IEARV+
Sbjct: 355 HLPDLSEARELVRQGNYEALDLLYDSIPDVLSQLIRTAFVPRAGMKFVVSDFSAIEARVI 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           +W+AGE+WK + F  G+D+Y +T ++ F V   +     + R  GK+ ELA GY G   A
Sbjct: 415 SWLAGERWKSEDFAAGKDIYCSTASQMFGVPVVKHGINGNLRQKGKIAELACGYGGSVGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M                                         A++          + 
Sbjct: 475 LKAMG----------------------------------------ALDMGIPEEELGNLV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           ++WR  +  + + W ++  A + TI+    +       V  +        L + LPSGR 
Sbjct: 495 QSWRSANPHIVDFWWQVDGAVKTTIKQRIPV------WVNNIRFFCQSGMLFIELPSGRR 548

Query: 568 LVY--RDVGNNRSYLNT-------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +G NR    +        T++  +  +YG K  ENIVQ +SRDIL   M    
Sbjct: 549 LSYVKPRIGENRFGGESVTYEGIGATKKWEQLESYGPKFVENIVQGISRDILCYAMQTL- 607

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                IV  VHDE++ E P     +   +   M   P WA+GL L+A+GY  + Y+K
Sbjct: 608 -RCCAIVGHVHDELIIECPKD--TSVDAICEEMGRTPPWAEGLVLRADGYACEFYQK 661


>gi|167630957|ref|YP_001681456.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
 gi|167593697|gb|ABZ85445.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
          Length = 646

 Score =  530 bits (1365), Expect = e-148,   Method: Composition-based stats.
 Identities = 210/701 (29%), Positives = 315/701 (44%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL K G+ +Y E  D  ++LF +  D   V++ D +    +P  + 
Sbjct: 1   MRALNIDIETYSSVDLAKSGVYRYTESPDFAILLFGYSVDGGEVQVVDLMCSEAIPSKVV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
           +AL + DVT  A N+ FER  L     L     +    W CT+V +   GLP +L+  G 
Sbjct: 61  DALTDKDVTKWAFNAQFERICLSKWLGLPTGQYLDPMSWRCTMVWSAYMGLPLSLEGTGA 120

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  F   CK         RN P H  + W  F  Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIRHFSVPCKPTVSNEGRTRNLPIHAPDKWAAFKAYNLRDVETEMA 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++L   P+       ++LDQ INDRG  +D+ L     ++ +  R+KL   +  LT  
Sbjct: 181 IQQKLAKFPVPEGVWGEYHLDQEINDRGVALDMDLVRQAIEMDNRSRSKLTGMIRELT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   + ++K WL    GL  + L +     +L +  +      +V   R   ++S+V
Sbjct: 239 ELENPNSVVQMKQWLSDH-GLETDTLGKKAVVELLKTASEP---LGKVLELRQSLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP- 347
            K   +   + +DGR RG  QF GA+RTGRW+G +   QNLP+      E  + +     
Sbjct: 295 KKYTAMENVVCTDGRARGMFQFYGANRTGRWAGRLIQLQNLPQNHMPDLEQARSLVRSGN 354

Query: 348 --TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                       +++S+ +R+  +  +G K +VAD + IEARV+AW+AGE+W+ + FE+G
Sbjct: 355 FAALEMLYDSVPEVLSELIRTAFVPKKGCKFIVADFSAIEARVIAWLAGEKWRQEVFESG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F+V   +       R  GK+ ELALGY G   A + M            
Sbjct: 415 GDIYCASASQMFHVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKAMG----------- 463

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A+E        + +  AWR  + ++  LW +
Sbjct: 464 -----------------------------ALEMGLEEEELQPLVSAWRSSNPKIVRLWWD 494

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           + +A  + +           R               + LPSGR L Y    +G NR   +
Sbjct: 495 IDRAAMKAVRERTTTETHGIR------FSYQSGMFFITLPSGRRLAYVKPRIGQNRFGSD 548

Query: 582 -------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
                     ++  R  +YG KLTENIVQA SRDIL   M N       IV+ VHDEIV 
Sbjct: 549 CITYEGVGGAKKWERIESYGPKLTENIVQATSRDILCYAMRNLRH--CSIVMHVHDEIVI 606

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       +   +   M   P WAKGL L+A+GYE+  Y+K
Sbjct: 607 EA--DRRMSTEAVCKQMGQTPPWAKGLLLRADGYETDFYKK 645


>gi|205375254|ref|ZP_03228044.1| DNA-directed DNA polymerase [Bacillus coahuilensis m4-4]
          Length = 649

 Score =  530 bits (1365), Expect = e-148,   Method: Composition-based stats.
 Identities = 229/699 (32%), Positives = 338/699 (48%), Gaps = 75/699 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y+E  D  ++LFA+  DD  VE+ D      +P  + 
Sbjct: 1   MKTLIIDIETYSKVDLVKCGVYAYSESADFEILLFAYAVDDEEVEIVDLASGEKIPANIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +A+ +  V   A+N+ FERT L   F + +P  +W CT V A   GLP  L  V + LKL
Sbjct: 61  KAMIDPTVIKTAYNANFERTCLAKHFQIPMPPEQWRCTSVHALMLGLPGYLDGVAKCLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EGK LI  F   CK         RN P H    W  F +YCK DV V REI K+
Sbjct: 121 QGQKMKEGKALIRYFSIPCKPTKVNGGRTRNLPKHDPARWDTFKDYCKQDVEVEREIRKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  PL + EQELW LDQ IND G  +D  L +   +     + +L +E   LT   + +
Sbjct: 181 LEVFPLPTMEQELWELDQKINDEGVVIDTNLVNHAIKADKAFQDELIEEAVRLTG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL L+ GL ++ L +   + ++S  +   P+  ++   R   S+++V K  
Sbjct: 239 PNSPAQLKGWL-LKQGLEVDSLAKKNVEALMSEVEN--PEVKRLLELRRAMSKTSVKKYE 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            +  ++ SD R+RG LQF GASRTGRW+G +    NLPR S    ++ + +         
Sbjct: 296 AMERSVGSDQRVRGLLQFYGASRTGRWAGRLVQIHNLPRNSLKDLQVARELLESGKYEAL 355

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+G + VVAD + IEARV+AW+AGE+W++  F++   +Y
Sbjct: 356 EVLFESVSDVLSQLIRTAFIPSKGHRFVVADFSAIEARVIAWLAGERWRMDVFQSHGKIY 415

Query: 410 VTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + A+ F V           R  GK+ ELALGY G   A  +M                
Sbjct: 416 EASAAQMFKVPIETIDKGSPLRQKGKIAELALGYGGSKGALMQMG--------------- 460

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+E          +  AWR+ + ++ +LW  +  A
Sbjct: 461 -------------------------ALEMGLTEDELPELVSAWREANPKIVKLWWGIEAA 495

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---------GNNRS 578
             + ++    +     +    +     K  L + LPSGRSL Y                +
Sbjct: 496 AIKAVKEKAVV-----KMQHGLTFHYTKGILFITLPSGRSLAYVRPKIGIDERFGKEQLT 550

Query: 579 YLN--TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           Y      ++Q  R  TYGGKLTENI+QA++RD LA  M+   +AGY I   VHDE++ + 
Sbjct: 551 YEGTEQGSKQWGRIPTYGGKLTENIIQAIARDCLAVSMLRLDEAGYRINFHVHDEVILDV 610

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P     +   + ++M  +  WA GLPL A+ +E+  Y+K
Sbjct: 611 PI-ATGSMEEVENIMGQSIDWAPGLPLGADSFETFYYKK 648


>gi|255092532|ref|ZP_05322010.1| DNA polymerase [Clostridium difficile CIP 107932]
 gi|260683192|ref|YP_003214477.1| dna-directed dna polymerase i [Clostridium difficile CD196]
 gi|260209355|emb|CBA62784.1| dna-directed dna polymerase i [Clostridium difficile CD196]
          Length = 652

 Score =  529 bits (1362), Expect = e-148,   Method: Composition-based stats.
 Identities = 219/701 (31%), Positives = 338/701 (48%), Gaps = 76/701 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 --SSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V REI 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 173 KRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L    + E+E+  WYLDQ IND G  VD  L     +       KL +E   +T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           ++     +LK WL  + G  +  LT+ +   +L          +++   R   S++++ K
Sbjct: 239 NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDEN--VVRILELRKLMSKTSIKK 296

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A  +D R+RG LQF GA+RTGRW+G +   QNLP+      +L + +       
Sbjct: 297 YEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFD 356

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                      ++S  +R+  I SEG + +V+D + IEARV+AW+AGE+W+L  F +   
Sbjct: 357 LIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLDVFNSHGK 416

Query: 408 LYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ F +     +   + R  GK+ EL+ GY G   A   M +            
Sbjct: 417 IYEASASQMFKIPIENIKKGSELRQKGKLAELSNGYGGSVGALISMGAIK---------- 466

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                                 + +  AWR  +  +++ W ++ 
Sbjct: 467 ------------------------------MGLKEEELQPIVTAWRNANPNITKFWWDVD 496

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDV-------GNN 576
           +A ++ I++   +  +       +    +   L + LPS R L Y    +       G+ 
Sbjct: 497 KAAKKAIKDRTIVEIQ-----HGIKFIYNPGVLFIELPSSRRLSYLRPKIEPHTTFSGDK 551

Query: 577 RSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
            +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T AGY IV+ VHDE+V 
Sbjct: 552 ITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVI 611

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +       +   +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 612 DVDKK-GGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|226949733|ref|YP_002804824.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
 gi|226841086|gb|ACO83752.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
          Length = 655

 Score =  528 bits (1361), Expect = e-147,   Method: Composition-based stats.
 Identities = 229/705 (32%), Positives = 325/705 (46%), Gaps = 81/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ID+   G  KY E  D  ++LFA+ F+D PV++ D      +PQ + 
Sbjct: 1   MTTLAIDVETYSSIDIKTSGAYKYCEAPDFEILLFAYAFNDEPVQIVDFTQHEALPQRVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNL---DIPIHRWICTLVLARSNGLPSALKAVGEA 115
           +AL + DV   A N+ FER+ +K  F +     P  +W CT++ A + GLPS+L  VG+A
Sbjct: 61  DALYDPDVIKTAFNANFERSAIK--FGVSSLPCPPGQWECTMIKALTLGLPSSLDMVGKA 118

Query: 116 LKL--SSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           LKL    QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V R
Sbjct: 119 LKLEEDKQKMKEGKALIQYFCKPCKPTKTNDKRTRNLPKHDMEKWETFKEYCKRDVEVER 178

Query: 170 EIFKRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           EI   L    +K +E   W LDQ INDRG   D+ L     +       +L +    LT 
Sbjct: 179 EIRNLLNRYETKAEEQKLWQLDQHINDRGIDTDLILIKQAIECDTNYTERLTKAAIKLTG 238

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLT-PQAIQVFNNRMRASRS 286
             + +     ++K W+    G  ++ LT+T+   ++   K L   + I++   R   +++
Sbjct: 239 --LENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEAKDLNKSEVIKMLELRQLMAKT 296

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT-- 344
           ++ K +T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP+      +  +     
Sbjct: 297 SIKKYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVRE 356

Query: 345 -HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
                           +S  +R+  I  EG + +V+D + IEARV+AW AGEQW+L  F 
Sbjct: 357 GKFEEVEFLFDSVPDTLSQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRLDVFS 416

Query: 404 TGEDLYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNT 461
           T   +Y  + ++ F V     +   + R  GK+ ELALGY G   A   M     +    
Sbjct: 417 THGKIYEASASQMFKVPIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKSIPEEE 476

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
                                                       + K+WR  +  +++ W
Sbjct: 477 LP-----------------------------------------GLVKSWRNANPNITKFW 495

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS--- 578
            ++ +A ++ I     +  +       +    D   L + LPSGR L Y           
Sbjct: 496 WDVDKAAKKAIRERTTVNLQYG-----LKFIYDPGVLFIQLPSGRKLSYIRPKIEPHETF 550

Query: 579 --------YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                    +  T++Q  R  TYG KL ENIVQA SRD L E M    K GYDIV+ VHD
Sbjct: 551 SGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVNKEGYDIVMHVHD 610

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E+V + P         +  LM     WA GLPLKA+GYE   Y K
Sbjct: 611 EVVLDIPKDRA-TVKEINELMGQPIKWAPGLPLKADGYECNYYMK 654


>gi|300856814|ref|YP_003781798.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300436929|gb|ADK16696.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 650

 Score =  528 bits (1360), Expect = e-147,   Method: Composition-based stats.
 Identities = 214/700 (30%), Positives = 310/700 (44%), Gaps = 76/700 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET   +D+ K G  KY E     ++LFA+ F+D PVE+ D      +PQ +K
Sbjct: 1   MDTLAIDVETYCELDIKKVGAYKYCEHPSFQILLFAYAFNDEPVEVIDFAQGEELPQKVK 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL N  +   A N+ FE   LK      I    W CT+V +   GLP +L  VG+ L+ 
Sbjct: 61  TALLNPGILKTAFNANFEINALKKYLINGIDAEDWQCTMVQSLILGLPGSLDMVGKVLRF 120

Query: 119 --SSQKMEEGKELIARFCKG---ETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
               QKM+EGK LI  FCK            RN P H  E W +F +Y K DV V R I 
Sbjct: 121 EEDKQKMKEGKALIQYFCKPCKPTKSNGGRTRNLPEHAPEKWEIFKKYNKQDVEVERAIR 180

Query: 173 KR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +    P +  EQ LW LDQ INDRG   D+ L     +  +    +L +E   LT   +
Sbjct: 181 NKLNRYPTTENEQRLWELDQCINDRGVGADIELIEKAIECNNSYNKRLTKEATELTG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           S+     +LK W+    G  ++ LT+ +   ++        +  ++   R   +++++ K
Sbjct: 239 SNPNSPTQLKRWIGERVGHEVKSLTKDSIPTLIKE--SKDEKVKKILELRQLMAKTSIKK 296

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLP 347
             T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP+      +  +         
Sbjct: 297 YETMQRARCEDGRMRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDDARNFIRTGQFD 356

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +S  +R+  I  EG + +VAD + IEARV+AW AGEQW+L  F    D
Sbjct: 357 KVEFLYDSIPDTLSQLIRTAFIPKEGNRFIVADFSAIEARVIAWYAGEQWRLDVFNNNGD 416

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ F V   +       R  GK+ ELALGY G   A   M     +  +     
Sbjct: 417 IYCASASKMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALMSMDKKKNIPEDELP-- 474

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                                   + K WR     +++ W ++ 
Sbjct: 475 ---------------------------------------GLVKDWRDASPHITKFWWDVD 495

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN--------R 577
           +A ++ I     ++ +       +    D   L + LPSGR L Y               
Sbjct: 496 KAAKKAIRERTTVVLQ-----FGLKFIYDPGVLFIQLPSGRKLAYIRPKIEPGPYDKPII 550

Query: 578 SYLN--TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
           +Y     T++Q T   TYG K+ ENIVQA +RD L   M      G+ IV+ VHDE++C+
Sbjct: 551 TYEGLQQTSKQWTTLETYGPKIVENIVQATARDCLGITMQRVEDKGFHIVMHVHDELICD 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P   +     +  +      WA GLPLKA+GYE   Y K
Sbjct: 611 VPKG-KGTVEEICDIFGEPIEWAPGLPLKADGYECNYYMK 649


>gi|153955279|ref|YP_001396044.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219855702|ref|YP_002472824.1| hypothetical protein CKR_2359 [Clostridium kluyveri NBRC 12016]
 gi|146348137|gb|EDK34673.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219569426|dbj|BAH07410.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 644

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 206/699 (29%), Positives = 318/699 (45%), Gaps = 80/699 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S  +L KCG+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MNSISIDIETFSSANLQKCGVYRYAESDDFEILLFGYSVDGGAVQVVDLACGEKIPNEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL +  VT  A N+ FER  L    NL   +    W C++V +   GLP +L+ VG  L
Sbjct: 61  NALMDNSVTKWAFNAMFERVCLSKWLNLTDYLDPTSWKCSMVWSAYMGLPLSLEGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFCK---GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I 
Sbjct: 121 GLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPKHDMDKWERFKAYNIRDVEAEMSIQ 180

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+       ++LDQ INDRG  +D+A      ++ +  R KL   ++ +T   +
Sbjct: 181 QRLSKFPIPENIWSEYHLDQKINDRGIAIDMAFVKQAVKMDEQSREKLMALMQDITN--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   ++++K WL  + GL  + L +     +L +  +           R + ++S++ K
Sbjct: 239 ENPNSIQQMKEWL-ADNGLETDSLGKKAVAEMLKTAPEPLGTV---LELRQQLAKSSIKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLP 347
              +  A+ +DGR RG  QF GA+RTGR+SG +   QNLP+      E  + +    +  
Sbjct: 295 YTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNFD 354

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                     +++S+ +R+  +  EG K +VAD + IEARV+AW+AGE+W++  F+ G D
Sbjct: 355 ALTLIYDSIPEVLSELIRTAFVPQEGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNGGD 414

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ FNV   +       R  GK+ ELALGY G   A + M              
Sbjct: 415 IYCASASQMFNVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKSMG------------- 461

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A+E        + +  AWRQ +  +++LW ++ 
Sbjct: 462 ---------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDVD 494

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GNNR 577
            A +  ++               +        L ++LPSGR L Y           G + 
Sbjct: 495 HAVKTCVKQKIPTETHG------IKFIYQSGMLFIVLPSGRRLSYVKPRMGENVFGGESV 548

Query: 578 SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           +Y     T++  R  +YG K  ENIVQA+SRDIL   M         IV  VHDEI+ E 
Sbjct: 549 TYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIEA 606

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 + S +   M   P+WA GL L A+GYE + Y+K
Sbjct: 607 --DMRMSLSTICEQMARTPTWANGLLLSADGYECQFYQK 643


>gi|220930425|ref|YP_002507334.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000753|gb|ACL77354.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 652

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 217/699 (31%), Positives = 331/699 (47%), Gaps = 75/699 (10%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
             L ID ET S +DL KCG+ +Y E  D  ++LFA+ +DD P+ + D      +P+ + +
Sbjct: 3   KILSIDIETYSSVDLIKCGVYRYVEAPDFEILLFAYAYDDEPITVIDLADFEELPEQVTK 62

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
            L + DV   A+N+ FERT +   +N  +P  +W CT V A + GLP  L  V + L L 
Sbjct: 63  DLTDPDVIKAAYNANFERTCIAKFYNKPMPPEQWRCTSVHALTLGLPGNLDGVAKVLGLD 122

Query: 120 SQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKRL 175
           +QK   GK LI  F   CK         RN P+H  + W+ F +YCK DV V R I K++
Sbjct: 123 AQKDTAGKNLIKYFSVPCKPTKVNGGRTRNFPHHAPDKWKQFKDYCKQDVVVERAIRKKI 182

Query: 176 --EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
              P+   E +LW LDQ IND G  +D  L     +      T+LD E + LT   + + 
Sbjct: 183 EKYPVPEHEWKLWTLDQKINDAGVRLDPVLVQQALKCDLQYATRLDAEAKELTG--LDNP 240

Query: 234 RCLEKLKTWLFLETGLHLEDL-TETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
               +L  WL  + GL +++   +     +L    K      ++   R   S+++  K  
Sbjct: 241 NSTTQLTVWL-KKQGLTVDNGLGKDYIPGLLDQ-AKGDETVTRMLELRKEMSKTSTKKYE 298

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            +  AM SD R RG LQF GA+RT RW+G +   QNLP+       + + +         
Sbjct: 299 AMERAMCSDDRARGLLQFCGANRTWRWAGRLIQVQNLPQNKIPDLGVARELLHSGKFEAI 358

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                 P  ++S  +R+  I S+G + +V+D + IEARV+AW+AGE W++K F++   +Y
Sbjct: 359 ELLFNSPPFVLSQLIRTAFIPSDGCRFIVSDFSAIEARVIAWLAGESWRMKVFKSHGKIY 418

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + +  F+V   ++TK    R  GK+ ELALGY G   A + M +   GL+ +      
Sbjct: 419 EASASHMFHVPIEEITKGNPLRQKGKIAELALGYGGSIGALEAMGALKMGLDADELP--- 475

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                  +  AWR  + ++ +LW ++ +
Sbjct: 476 --------------------------------------DLVTAWRNSNPKIVKLWWDVDK 497

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS-------- 578
           A    +     +     R    +        L + LPSGR L Y                
Sbjct: 498 AAMTAVREHMPV-----RIQYGITFSYKDGFLFIKLPSGRKLAYVKPKIKDGKFGRPALT 552

Query: 579 --YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
              ++   +   R  TYG KL ENIVQAV+RD LA  M+    AGYDI + VHDE++ + 
Sbjct: 553 YEGMDQIKKTWERIDTYGPKLVENIVQAVARDCLAVNMLRLDDAGYDIRMHVHDEVILDV 612

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P+TD    + +  +M+    WA GLPL+A+GYE++ Y+K
Sbjct: 613 PNTDTDALAQVNEIMSQPIDWAPGLPLRADGYETEFYKK 651


>gi|57234138|ref|YP_181815.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224586|gb|AAW39643.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 662

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 209/717 (29%), Positives = 316/717 (44%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S IDL KCG+ KYAE  +  ++LF +  D   V++ D      +PQ + 
Sbjct: 1   MKNISIDIETFSDIDLNKCGVYKYAESPNFEILLFGYAVDGGKVQVIDLAQGEHIPQEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC---FNLD-----------------IPIHRWICTLV 98
           +AL + +VT  A N+ FER  L        +                  +    W C++V
Sbjct: 61  DALTDDEVTKWAFNANFERVCLSRYLSDLGVSLDPFHDNHPLSTECARFLNPEGWRCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAW 154
            A + GLP +LK VG+ LKL  QKM+EGK LI  F   C          RN P H  E W
Sbjct: 121 WAATMGLPLSLKGVGQVLKLEDQKMDEGKALIKYFSVPCAPTKANGGRTRNMPFHDPEKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             F  Y K DV V   I +RL   P+     + + +DQ INDRG  +D+ L     ++  
Sbjct: 181 ETFKAYNKRDVEVEMAIQQRLTNFPVPDFVWDEYRIDQEINDRGVRLDMDLVAKAIEMDT 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             RT+L   ++ +T   + +   ++++K WL    GL  + L +     ++ +      +
Sbjct: 241 RSRTELTTAMKDIT--ELDNPNSVQQMKQWLSD-NGLETDSLGKKVVAELIKTAPS---E 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
              V   R + ++S+V K  T+  A+  DGR RG   F GA+RTGRW+G +   QNLP+ 
Sbjct: 295 LQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFMFYGANRTGRWAGRLIQLQNLPQN 354

Query: 333 SRSHEELDQIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                   + +              D    +S  +R+  I  +G +L V+D + IEARV+
Sbjct: 355 HLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQLYVSDFSAIEARVI 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           AW AGE W+ K F  G D+Y  + ++ F+V   +       R  GK+ ELALGY G   A
Sbjct: 415 AWYAGEMWRQKVFADGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M +                                         E          + 
Sbjct: 475 LKAMGAI----------------------------------------EMGLSEDELPPLV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            AWRQ +  + + W ++ +A  + +++     +        +        L + LPSGR+
Sbjct: 495 DAWRQTNPHIVKFWWDVDRAVMEAVKHKHTTSSYG------LTFSCRSGMLFITLPSGRN 548

Query: 568 LVYRDV--------GNNRSYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y           G   +Y     T++  R  +YG K  ENIVQA SRDIL   M    
Sbjct: 549 LAYVKPKVGTNKFGGECITYEGVGATKKWERLDSYGPKFVENIVQATSRDILCYAMKTL- 607

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +IV+ +HDE+V E       +  +L   M   P WA+GL L+A+GY +  Y+K
Sbjct: 608 -RNCEIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWARGLQLRADGYTTPFYKK 661


>gi|42779458|ref|NP_976705.1| DNA polymerase I [Bacillus cereus ATCC 10987]
 gi|42735374|gb|AAS39313.1| DNA polymerase I [Bacillus cereus ATCC 10987]
          Length = 644

 Score =  526 bits (1354), Expect = e-147,   Method: Composition-based stats.
 Identities = 204/699 (29%), Positives = 313/699 (44%), Gaps = 80/699 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S  +L K G+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MNSISIDIETFSGANLQKSGVYRYAESDDFEILLFGYSVDGGEVQVVDLACGEEIPDEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL +  VT  A N+ FER  L    NL   +    W C+++ +   GLP +L+ VG  L
Sbjct: 61  NALLDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMIWSAYMGLPLSLEGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFCK---GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I 
Sbjct: 121 GLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKAYNLRDVEAEMSIQ 180

Query: 173 KRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +R           E ++LDQ INDRG  +D+        + +  R KL   ++ +T   +
Sbjct: 181 QRFSKFLVPENIWEEYHLDQEINDRGIAIDMTFVKQAVVMDEHSREKLMALMQDITN--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   ++++K WL  + GL  + L +     +L +  +           R + ++S+V K
Sbjct: 239 ENPNSVQQMKDWL-ADNGLETDTLGKKAVAEMLKTAPEPLGTV---LELRQQLAKSSVKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLP 347
              +  A+ +DGR RG  QF GA+RTGR+SG +   QNLP+      E  + +    +  
Sbjct: 295 YTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNFD 354

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                     +++S+ +R+  I  EG K +VAD + IEARV+AW+AGE+W++  F+ G D
Sbjct: 355 ALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNGGD 414

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ FNV   +       R  GK+ ELALGY G   A + M              
Sbjct: 415 IYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG------------- 461

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A+E        + +  AWRQ +  +++LW ++ 
Sbjct: 462 ---------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDVD 494

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GNNR 577
           +A +  ++               +        L + LPSGR L Y           G + 
Sbjct: 495 RAVKTCVKQKTPTETHG------IKFIYQSGMLFIALPSGRRLAYVKPRMGENMFGGESV 548

Query: 578 SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           +Y     T++  R  +YG K  ENIVQA+SRDIL   M         IV  VHDEI+ E 
Sbjct: 549 TYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIEA 606

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 + S +   M   P+WA GL L A+GYE + Y+K
Sbjct: 607 --DMGTSLSAICEQMAKMPTWANGLLLSADGYECQFYQK 643


>gi|255306559|ref|ZP_05350730.1| DNA polymerase [Clostridium difficile ATCC 43255]
          Length = 652

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 219/701 (31%), Positives = 336/701 (47%), Gaps = 76/701 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 --SSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V REI 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 173 KRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L    + E+E+  WYLDQ IND G  VD  L     +       KL +E   +T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           ++     +LK WL  +    +  LT+ +   +L          ++    R   S++++ K
Sbjct: 239 NNPNSPAQLKKWLSDKVSFEITSLTKESIPEILKQVDDEN--VVRTLELRKLMSKTSIKK 296

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A  +D R+RG LQF GA+RTGRW+G +   QNLP+      +L + +       
Sbjct: 297 YEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFD 356

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                      ++S  +R+  I SEG + +V+D + IEARV+AW+AGE+W+L  F +   
Sbjct: 357 LIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLDVFNSHGK 416

Query: 408 LYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ F V     +   + R  GK+ EL+ GY G   A   M +            
Sbjct: 417 IYEASASQMFKVPIESIKKGSELRQKGKLAELSNGYGGSVGALISMGAIK---------- 466

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                                 + +  AWR  +  +++ W ++ 
Sbjct: 467 ------------------------------MGLKEEELQPIVTAWRNANPNITKFWWDVD 496

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDV-------GNN 576
           +A ++ I++   +  +       +    +   L + LPS R L Y    +       G+ 
Sbjct: 497 KAAKKAIKDRTIVEIQ-----HGIKFIYNPGVLFIELPSSRRLSYLRPKIEPHTTFSGDK 551

Query: 577 RSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
            +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T AGY IV+ VHDE+V 
Sbjct: 552 ITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVI 611

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +       +   +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 612 DVDKK-GGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|134299054|ref|YP_001112550.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
 gi|134051754|gb|ABO49725.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
          Length = 650

 Score =  525 bits (1351), Expect = e-146,   Method: Composition-based stats.
 Identities = 229/699 (32%), Positives = 322/699 (46%), Gaps = 74/699 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DLTK G+  YAE  D  ++LF + FDD PV+L D      +P  + 
Sbjct: 1   MTILGIDIETYSRVDLTKSGVYAYAEAEDFEILLFGYAFDDEPVQLIDLASGEQLPDNVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + ++   A N+ FERT +   FN  +P  +W CT V A + GLP  L  V + L L
Sbjct: 61  NALTDPEIIKTAFNANFERTCIAKHFNRPMPPEQWRCTHVHALTLGLPGHLGDVAKVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK   GK LI  F   CK         RN P H  + W  F  YCK DV V R+I K 
Sbjct: 121 KQQKDTAGKALIRYFSMPCKPTKVNGQRTRNLPEHDPDRWAKFKSYCKQDVAVERDIRKT 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  P+   E +LW LDQ IND G  VD  L           + KL  +   LT   + +
Sbjct: 181 LERFPVIEAEHKLWCLDQRINDGGVLVDSQLVTNAIACDTQYQDKLMAKAAKLTG--LDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
            + + +LK WL    GL +E L + +   +L   +  T    Q+   R   ++++V K  
Sbjct: 239 PKSVSQLKQWLLKTDGLEVESLNKESVPELLKQTESST--VKQMLELRQEMAKTSVKKYL 296

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            +  A   DGR+RG LQF GA+RTGRW+G +   QNLPR S    +  + +         
Sbjct: 297 AMERAKGKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPRNSIKDLDQARQLLKAGDYEML 356

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  +  EG + +VAD + IEARV+AW+A E+W++  F T   +Y
Sbjct: 357 ELLFESVPTVLSQLIRTAFVPKEGHRFIVADFSAIEARVIAWLADEKWRMDVFRTHGKIY 416

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + +  F+V   ++TK    R  GKV ELALGYQGG  A   M                
Sbjct: 417 EASASAMFHVPIEEITKGNPLRQKGKVSELALGYQGGPGALIAMG--------------- 461

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+++         + K WRQ    + + W +   A
Sbjct: 462 -------------------------ALKEGLTEEELPGLVKLWRQSSPNIVKFWYDTEAA 496

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS--------- 578
             + ++    +          ++   +   L + LPSGR L Y       +         
Sbjct: 497 AIKAVKEKTTVELH-----HGIHFIYESGILFIRLPSGRRLAYIKPRIQNNPRLDKPALT 551

Query: 579 --YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
                  T+Q  R YTYGGKL ENIVQAV+RD LAE ++    AGY  V+ VHDE V E 
Sbjct: 552 YEGQEQGTKQWGRLYTYGGKLVENIVQAVARDCLAEALLRLDVAGYKTVMHVHDESVMEM 611

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P     +      +M     WA GLP++A+G+ES  Y+K
Sbjct: 612 PHG-VGSLEDACRIMEQPIPWAPGLPMRADGFESNYYKK 649


>gi|332983347|ref|YP_004464788.1| DNA-directed DNA polymerase [Mahella australiensis 50-1 BON]
 gi|332701025|gb|AEE97966.1| DNA-directed DNA polymerase [Mahella australiensis 50-1 BON]
          Length = 657

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 208/710 (29%), Positives = 323/710 (45%), Gaps = 89/710 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET S  DL K G+ +Y+E  D  V+LF +  DD  V + D      +P  + 
Sbjct: 1   MRELFIDIETYSGTDLGKSGVYRYSEAPDFEVLLFGYCADDDEVRVIDLASGEALPTEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF---NLDIP----------IHRWICTLVLARSNGL 105
           +AL +  V   AHN+ FER  L        +++              W CT+V +   GL
Sbjct: 61  DALTDETVVKWAHNAQFERVCLSRWLERQGINLKALNGNSNFLNPASWRCTMVWSAYLGL 120

Query: 106 PSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYC 161
           P +L+          QK+ EGKELI  F   CK         RN P H  + W  + EY 
Sbjct: 121 PLSLEGAALVTGAEKQKLTEGKELIRYFSSPCKPTKSNGGRTRNLPVHAPDKWEKYKEYN 180

Query: 162 KGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
             DV     I KRL   P+   E + + LDQ INDRG C+D+ L     +     RT L 
Sbjct: 181 ARDVETEMAIMKRLSKFPVPEDEWKYYILDQEINDRGICLDMDLIREAIRCDRRSRTVLT 240

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNN 279
           + +  +T   + +   + ++K W F E GL  E L +   + +L +  +   +       
Sbjct: 241 EAVRDITD--LDNPNSVAQMKAW-FAENGLETETLGKAAVKELLKTAPESFREV---LAL 294

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++S+V K   +  A+ SDGR+RG LQF GA+RTGR++G +   QNLP+        
Sbjct: 295 RQDLAKSSVKKYTAMENAVCSDGRVRGLLQFYGANRTGRFAGRLIQVQNLPQNHLPDLVQ 354

Query: 340 DQIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
            + +                  ++S+ +R+  +   G K +VAD + IEARV+AW+AGEQ
Sbjct: 355 ARQLVKSGDFDALEILYDSVPGVLSELIRTAFVPMPGYKFIVADFSAIEARVIAWLAGEQ 414

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAST 454
           W+ + F +   +Y  + ++ F V   ++TK    R  GK+ ELALGY G   A + M   
Sbjct: 415 WRNEVFASHGKIYEASASQMFRVPIEEITKGSPLRQKGKIAELALGYGGSVGALKAMG-- 472

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
                                                 A++        + +  AWR  +
Sbjct: 473 --------------------------------------ALDMGLAEDELQPLVTAWRAAN 494

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RD 572
             ++ LW ++ +A +  +    A           +  +     L + LPSGR L Y    
Sbjct: 495 PNITRLWWDVDRAAKTAVREKTAEQT------HNILFEYRSGFLFITLPSGRKLAYVKPR 548

Query: 573 VGNNRSYLNT-------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
           +  NR   ++        +++  R  +YG K  ENIVQA+SRDIL   M   +  G+ IV
Sbjct: 549 IEANRFGSDSITYEGVGASKKWERIESYGPKFVENIVQAISRDILCYAMQRLSSMGFSIV 608

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + +HDE+V ET  + + +  ++  +M+  P WA+GL L A+G+E + Y+K
Sbjct: 609 MHIHDEVVIET--SCDVSPEIVCRIMSETPPWAEGLFLCADGFECQFYKK 656


>gi|297587100|ref|ZP_06945745.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
 gi|297575081|gb|EFH93800.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
          Length = 643

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 225/697 (32%), Positives = 334/697 (47%), Gaps = 77/697 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL K G+ KYAE  D  ++LFA+  +D  V++ D  +  ++P+ + 
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSINDGEVKVIDLANGEIIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + +V   A N+ FER  L       +    W CT++ +   GLP +L+ VGE LKL
Sbjct: 61  SALSDENVEKWAFNANFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM EGK LI  F   CK      +  RN  +H  E W  F EY + DV     I K+
Sbjct: 121 DKQKMNEGKALIRYFSTPCKPTKTNGMRIRNLSHHDLEKWSTFKEYNQRDVETEMAIKKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+S  E E +++DQ INDRG  +D  L  +  +   + R +       LT   + +
Sbjct: 181 LSAFPMSHSEWENYWIDQNINDRGILIDEVLVDSAIKFDGILREENMDRAIELTG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + GL ++ L +   + V S+ K       +V   R   S+S+V K +
Sbjct: 239 PNSPLQLKEWLNKK-GLEIDSLAK---KDVESALKNTEGDIKEVLELRQELSKSSVRKYD 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            +      D R RG +QF GA+RTGR+SG +   QNL R +    +L + +       T 
Sbjct: 295 AMKNVKGKDNRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARSLVKNRDYETM 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                 P  I+S  +R+  IA EG + +++D + IEARVLAW+AGEQW L AFE GED+Y
Sbjct: 355 EILYESPSDILSQLIRTAFIAKEGTRFIISDFSAIEARVLAWLAGEQWVLDAFENGEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T +R F V   +       R  GK+  LA GYQG   A + M                
Sbjct: 415 CRTASRMFGVPVEKHGVNGHLRQKGKIATLACGYQGALGALKAMG--------------- 459

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                     IE        + +  +WR+ +  +  LW ++   
Sbjct: 460 -------------------------GIEMGLSEDELQSIVDSWREANPNIVSLWWDIDSV 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR--DVGNNRSYLNTT-- 583
            ++ ++         +     + +  +K  L + LPS R L Y    +G NR    +   
Sbjct: 495 VKRVVKTRT------KEKYKSLVISYEKGILFIELPSKRRLAYPKAKIGTNRFGGESIVY 548

Query: 584 -----TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                  +  +  +YGGK  ENIVQA++RDILAE MM   K G++IV+ +HDE+V E   
Sbjct: 549 EGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIE--- 605

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +D  +   +  +M+  PSWA GL L A+G+ES+ Y+K
Sbjct: 606 SDSSSIEEINQIMSLVPSWAPGLILDADGFESEFYKK 642


>gi|153814242|ref|ZP_01966910.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
 gi|145848638|gb|EDK25556.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
          Length = 644

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 206/697 (29%), Positives = 320/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P ++ D      MP+ + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTKIIDIASGQTMPEEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A N+ FER  +   F L +    W CT V A    LP +L+ VGEAL L
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P +  E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+  +EQEL+ +DQ INDRG  VD  L         + +    +    ++   + +
Sbjct: 181 LAKFPIPDREQELYCMDQRINDRGIMVDRELISNAVACDLLYKEAASKRAYEISG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  + G+ ++ L +   + ++        +  ++   R+  S+++V K  
Sbjct: 239 PNSVSQLKDWLNEK-GIEVDSLAKAAVEELVEK---TEGEVSEMMKLRLSMSKTSVKKYE 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---S 349
            +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + I         
Sbjct: 295 AMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRYDLV 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                   +++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     +Y
Sbjct: 355 ELLYDSTPEVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKIY 414

Query: 410 VTTYARSFNVAPAQVTKDQRAIG--KVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T ++ F++   ++TK        KV  LA  Y G   A   M +   +          
Sbjct: 415 EQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEE------- 467

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                               + + ++WR  +  +   W E+  A
Sbjct: 468 ----------------------------------ELKGLVQSWRTANPHIVNYWYEIDGA 493

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG--------NNRSY 579
            +  ++  K     +      V +      L + LPSGR L Y             + SY
Sbjct: 494 VKAAVKERKMTTVGR------VTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFGSESVSY 547

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
               T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+V E P+
Sbjct: 548 EGVGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEVVLEVPE 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +M   P W +GLPLKA G+ES  Y+K
Sbjct: 608 GT-SSVEEVNEIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|116630096|ref|YP_815268.1| DNA polymerase I [Lactobacillus gasseri ATCC 33323]
 gi|238854131|ref|ZP_04644478.1| DNA polymerase [Lactobacillus gasseri 202-4]
 gi|116095678|gb|ABJ60830.1| DNA polymerase I - 3'-5' exonuclease and polymerase domain
           [Lactobacillus gasseri ATCC 33323]
 gi|238833207|gb|EEQ25497.1| DNA polymerase [Lactobacillus gasseri 202-4]
          Length = 644

 Score =  523 bits (1347), Expect = e-146,   Method: Composition-based stats.
 Identities = 208/697 (29%), Positives = 321/697 (46%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +PQ + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDLGPVKVVDLTQGEKIPQPIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L       +    W C+ V + + GLP +L  VG  L L
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLSDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKSNQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE       E E +++DQ INDRG  +D  L +   +  +    +  Q  + LT     +
Sbjct: 181 LERFPVSQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQENFHDQYLQVSQKLTGLA--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL    G++++ L++ +  ++L +    T +  QV + R   S+S+V K  
Sbjct: 239 PNSPLQLKDWLNQR-GMNIDSLSKASVAQLLQT---TTGKVHQVLSLRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP---TS 349
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    E  + +         
Sbjct: 295 AMQKAMCRDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNTTAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+G    VAD + +EARV+AW++GE+W+ KAF   ED+Y
Sbjct: 355 SMLYDSVPDVLSQLIRTAFIPSQGHHFYVADFSAVEARVIAWLSGEEWRQKAFANNEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +     + R  GK+ ELALGY G   A + M +T             
Sbjct: 415 CASASQMFGVPVVKHGVNGELRQKGKIAELALGYGGSIGALKAMGAT------------- 461

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                                 + + WR     + + W ++ +A
Sbjct: 462 ---------------------------NLGLTEEELHSLVQMWRNASPHIVQFWWDIDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT- 584
            ++ I++              +        + L L SGR L Y    +G NR    + T 
Sbjct: 495 AKECIKSHLPQATHG------IKFIYRSGCMFLRLRSGRKLCYSKPKIGINRFGSESITF 548

Query: 585 ------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                 ++  R  TYG KL ENIVQA SRD+LAE M     AG  +V+ +HDE V + P 
Sbjct: 549 MGINAVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEDAGNPVVMHIHDEAVIDAP- 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              ++   +  +MT  P WA GL L A G+ S  Y+K
Sbjct: 608 -ANYSLEKMVKIMTEVPRWADGLILNAAGFVSDFYKK 643


>gi|295114921|emb|CBL35768.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [butyrate-producing bacterium SM4/1]
          Length = 646

 Score =  523 bits (1347), Expect = e-146,   Method: Composition-based stats.
 Identities = 206/702 (29%), Positives = 308/702 (43%), Gaps = 84/702 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  D  ++LFA+  D  PV+  D      +P  + 
Sbjct: 1   MQTLSIDLETYSDQPLAKTGVYRYVESPDFEILLFAYSVDGAPVQQIDLACGEKIPSEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+  VT  A N+ FER  L           +    W C++V A   GLP +L+  G 
Sbjct: 61  CALEDDKVTKWAFNANFERICLSRFLGYPTGDYLEPDSWKCSMVWAAYMGLPLSLEGAGA 120

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN P H  + W  F +Y   DV     
Sbjct: 121 VLGLEKQKLAEGKDLIKYFCQPCAPTKSNGQRTRNLPKHSPDKWLAFKKYNIRDVETEMS 180

Query: 171 IFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  R    P+     E ++LDQ INDRG  +D+ L     Q+    R++L Q ++ LT  
Sbjct: 181 IQARLLKYPVPDSVWEEYHLDQEINDRGVGLDMELVRQAIQMDGRSRSELTQAMKELT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL  + G+  + L +     +L +      Q  +V   R + ++S+V
Sbjct: 239 SLDNPNSVQQMKQWL-ADNGVETDTLGKKAVAELLKT---APQQLQKVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH--- 345
            K   +  A+ +DGR RG  QF GA+RTGRW+G +   QNLP+         + +     
Sbjct: 295 KKYQAMETAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNHLDDLTEARGLVRAGG 354

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  +    +K +VAD + IEARV+AW+A E+W+   F  G
Sbjct: 355 FDALEMLYEDVPDTLSQLIRTAFVPQGNRKFIVADFSAIEARVIAWLADEKWRQDVFAEG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTF 462
           +D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M +   GL+ +  
Sbjct: 415 KDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGALEMGLSEDEL 474

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                                      +  AWRQ + ++ + W 
Sbjct: 475 PA-----------------------------------------LVSAWRQANPKIVQFWW 493

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYL 580
            + +A    +                +        L + LPSGRSL Y    +G NR   
Sbjct: 494 AVDRAVMDAVTRKTTTKTHG------IIFSARNGMLFITLPSGRSLSYVKPKIGENRFGG 547

Query: 581 N-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
           +         T++  R  +YG K  ENIVQA SRDIL   M         IV+ +HDE+V
Sbjct: 548 DCITYEGVGGTKKWERIDSYGPKFVENIVQATSRDILCYAMKTL--RCCSIVMHIHDEVV 605

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E       +   +   M   P WA GL L+A+GYE+  Y+K
Sbjct: 606 IEA--DRRMSLQAVCDQMGRTPPWANGLQLRADGYETDFYKK 645


>gi|331083931|ref|ZP_08333040.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330403356|gb|EGG82916.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 646

 Score =  522 bits (1345), Expect = e-146,   Method: Composition-based stats.
 Identities = 203/701 (28%), Positives = 308/701 (43%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L+K G+ +Y E  D  +ILF +  D   V++ D      +P+ + 
Sbjct: 1   MKNLEIDIETYSSANLSKSGVYRYVESPDFEIILFGYSIDGGEVKVVDLACGETIPKEVY 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
           +ALE+  VT  A N+ FER  L           +    W C++V +   GLP +L+ VG 
Sbjct: 61  DALEDDSVTKWAFNAQFERICLSKFLGYKQGTYLEPDSWKCSMVWSAYMGLPLSLEGVGV 120

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGKELI  F   C          RN P+H  E W  F  Y   DV    +
Sbjct: 121 VLGLEKQKLTEGKELIKYFCTPCNPTKVNGGRMRNLPHHDTEKWERFKAYNIRDVEAEMQ 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  RL+  P+     + ++LDQ INDRG  VD+       +I +V R  L  +++ LT  
Sbjct: 181 IQSRLQKFPVPDFVWDEYHLDQEINDRGIKVDMDFVEKCLEIDNVSRESLMTKMQVLTSL 240

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
              +   + ++K WL    G+  E L +     ++    ++  +  ++   R + ++S+V
Sbjct: 241 T--NPNSVVQMKGWLSD-NGIETETLGKKAVAALI---DEVPDEMSEILALRQKLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT 348
            K   +  ++  DGR+RG  QF GA+RTGR++G +   QNLP+         + +     
Sbjct: 295 RKYQAMQNSVCEDGRVRGMFQFYGANRTGRFAGRLVQLQNLPQNHMEDLAEARGLVRSGD 354

Query: 349 ---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  I +  +  +VAD + IEARV+AW AGE W+   F  G
Sbjct: 355 YDSLDLLYDDIPDTLSQLIRTAFIPTVNESFIVADFSAIEARVIAWFAGESWRADVFAKG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M            
Sbjct: 415 GDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTGALKAMG----------- 463

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A+E          +  AWR  +  +   W +
Sbjct: 464 -----------------------------ALEMGLAEEELPELVSAWRCSNPNIVRFWWD 494

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GN 575
           +  A ++ I++  +           V+       L + LPSGR L Y           G 
Sbjct: 495 VDSAVKKAIKSKTSTATHG------VHFSCRSGMLFITLPSGRVLSYVKPCMGENKFGGE 548

Query: 576 NRSYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           + +Y    +T++  R  +YG K  ENIVQA SRDIL   M         IV  VHDEI+ 
Sbjct: 549 SVTYEGVGSTKKWERLESYGPKFVENIVQATSRDILMYAMKTL--RCCSIVAHVHDEIII 606

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       +   +   M   P WA+GL L+A+GYE + Y+K
Sbjct: 607 EA--DPRMSLDAICEQMGRTPPWAEGLLLRADGYECQFYKK 645


>gi|57233569|ref|YP_180826.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224017|gb|AAW39074.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 646

 Score =  521 bits (1341), Expect = e-145,   Method: Composition-based stats.
 Identities = 200/702 (28%), Positives = 309/702 (44%), Gaps = 84/702 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L ID ET S  +L K G+ +Y E  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKSLSIDIETYSSANLAKSGVYRYVESPDFEILLFGYSVDGGEVQVVDLTSGEKLPSDVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            AL +  V   A N+ FER  L     L     I    W C++V A + GLP +L+ VG 
Sbjct: 61  TALTDETVIKWAFNANFERICLSRFLGLPTGKYINPASWKCSMVWAATMGLPLSLEGVGS 120

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRN-KPNHREAWRLFGEYCKGDVTVTRE 170
            LKL  QK+ EGK+LI  F   C          RN   +  + W  F +Y   D+     
Sbjct: 121 VLKLDKQKLTEGKDLIKYFSQPCAPTKSNGQRTRNHLYHAPDKWSAFKKYNIRDIETEMS 180

Query: 171 IFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++    P+     + ++LDQ INDRG  +D+ L      +    R++L   ++ LT  
Sbjct: 181 IQEKLTRFPVQDSIWDEYHLDQEINDRGVALDMTLVQEAIAMDGRSRSELTTAMKHLT-- 238

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL  + G+  + L +     +L +          V + R + ++S+V
Sbjct: 239 ELDNPNSVQQMKQWL-ADNGMETDTLGKKIVAELLKTAPLD---LADVLSLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---H 345
            K   +  A+ +DGR RG  QF GA+RTGRW+G +   QNLP+         + +     
Sbjct: 295 RKYQAMENAVCTDGRARGMFQFFGANRTGRWAGRLIQMQNLPQNHLEDLAEARALVRFGD 354

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  +   G +L+V+D + IEARV+AWMAGE+W+   F  G
Sbjct: 355 FDALEMLYEDVPDTLSQLIRTAFVPKAGARLIVSDFSAIEARVIAWMAGEEWRQDVFAKG 414

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTF 462
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M +   GL  +  
Sbjct: 415 GDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGALDMGLEEDEL 474

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                                      +  AWRQ +  + + W 
Sbjct: 475 PQ-----------------------------------------LVDAWRQANPCIVKFWW 493

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYL 580
           ++ +A  +       +  ++      +        L + LPSGR L Y    +G N+   
Sbjct: 494 DVDKAAMEA------VRYKRTNSTHGITFSCQSGMLFITLPSGRRLAYVKPRIGENKFGG 547

Query: 581 N-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
                     T++  R  +YG K  ENIVQA +RDIL   M         IV+ VHDEIV
Sbjct: 548 QCITYEGVGATKKWERLDSYGPKFVENIVQATARDILCNAMQTLQH--CSIVMHVHDEIV 605

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E       +   +   M   PSWAKGL L+A+GYE+  Y+K
Sbjct: 606 IEA--DPRMSLKAVCEQMGRTPSWAKGLLLRADGYETDFYKK 645


>gi|154504839|ref|ZP_02041577.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
 gi|153794722|gb|EDN77142.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
          Length = 644

 Score =  521 bits (1341), Expect = e-145,   Method: Composition-based stats.
 Identities = 205/697 (29%), Positives = 322/697 (46%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P ++ D      +P  + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTQIIDLASGEKIPDEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A+N+ FER  +   F L +    W CTLV A    LP +L+ VGEAL L
Sbjct: 61  EYLTDDSVIKTAYNAAFERNCINRFFGLSLKPEGWRCTLVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P +  E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCTRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+  +EQ+L+ +DQ INDRG  VD  L         + +  + ++   ++   + +
Sbjct: 181 LAKFPIPDREQKLYCMDQRINDRGIMVDQELIGHAVACDLLYKETVTKKAYEISG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  + G+ ++ L +   + ++           ++   R+  S+++V K  
Sbjct: 239 PNSVSQLKDWLNEK-GIEVDSLAKAAVEELVE---NTQGDVAEMMKLRLAMSKTSVKKYE 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---S 349
            +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + +         
Sbjct: 295 AMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSLVKEGRYDLV 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     +Y
Sbjct: 355 ELLYDSTPDVLSELIRTAFVARPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKIY 414

Query: 410 VTTYARSFNVAPAQVTKDQRAIG--KVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T ++ F++   ++TK        KV  LA  Y G   A   M +   +          
Sbjct: 415 EQTASKMFHIPIGEITKGSPYRARGKVASLACQYGGAEGALISMGALNFVEEE------- 467

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                               + + ++WR  +  +   W E+  A
Sbjct: 468 ----------------------------------ELKGLVQSWRTANPHIVNYWYEIDGA 493

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG--------NNRSY 579
            +  ++  K         V +V +      L + LPSGR L Y             + SY
Sbjct: 494 VKAAVKERKMT------KVGMVTVYYQSGMLKITLPSGRVLSYVRPRMTVNRFGSESVSY 547

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
               T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+V E P+
Sbjct: 548 EGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEVVLEVPE 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +M   P W +GLPLKA G+ES  Y+K
Sbjct: 608 GT-SSVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|291556513|emb|CBL33630.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Eubacterium siraeum V10Sc8a]
          Length = 660

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 212/715 (29%), Positives = 314/715 (43%), Gaps = 96/715 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+ KY E  D  ++LF +  D  PV++ D      +PQ + 
Sbjct: 1   MKTLSIDIETYSSVDLAKCGVYKYTEATDFDILLFGYSTDGGPVQVVDLACGETIPQEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF------------------NLDIPIHRWICTLVLA 100
            AL N +VT  A N+ FER  L                         +    W CT++ +
Sbjct: 61  AALTNDNVTKWAFNAQFERICLSRWLRDHGGFDNACYSIPEDTVGNYLDPASWKCTMIWS 120

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPN-HREAWRL 156
              GLP +L+ VG  L L  QK+ EGKELI  FC+            RN P    + W  
Sbjct: 121 AYMGLPLSLEGVGAVLGLGKQKLTEGKELIKYFCQPCAPTKANSGRTRNLPENAPDKWAS 180

Query: 157 FGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE 214
           F  Y   DV V   I ++L   P+     E ++LDQ INDRG  +D+ L      +    
Sbjct: 181 FKRYNARDVEVEMSIQEKLAKFPVPDVVWEQYHLDQEINDRGVALDMDLVRQAIDMDTRS 240

Query: 215 RTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI 274
           R +L   ++ LT   + +   ++++K WL    GL+++ L +   + V    K    +  
Sbjct: 241 RAELTAAMKKLTA--LDNPNSVQQMKQWLSD-NGLNVDSLGK---KEVAEMLKTAPAELQ 294

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           QV   R + ++S+V K   + +A+ +DGR RG  QF GA+RTGRW+G +   QNLP+   
Sbjct: 295 QVLLLRQQLAKSSVKKYQAMEKAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNHL 354

Query: 335 SHEELDQIIT---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAW 391
                 + +              D    +S  +R+  +   G K +V+D + IEARVLAW
Sbjct: 355 PDLAEARALVRCGDFDGVELLYEDVPDTLSQLIRTAFVPRPGYKFIVSDFSAIEARVLAW 414

Query: 392 MAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQ 449
            AGE W+ + FE G D+Y  + ++ F V   +       R  GK+ ELALGY G   A +
Sbjct: 415 FAGETWRQEVFEKGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALK 474

Query: 450 KMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
            M                                         A+E        + +  A
Sbjct: 475 AMG----------------------------------------ALEMGLSEGELQPLVTA 494

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR  +  + + W ++ +A    ++           ++  +        L + LPSGR L 
Sbjct: 495 WRNSNQNIVKFWWDIDRAAMNAVK------YHMDSEICGIKFSYKSGMLFITLPSGRRLS 548

Query: 570 Y--RDVGNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
           Y    +G N+             T++  R  TYG KL ENIVQA SRDIL   M   +  
Sbjct: 549 YVKPKLGTNQFGGECITYEGIGGTKKWERLDTYGPKLVENIVQATSRDILCYAMRTLSH- 607

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              I + +HDE+V E       N   +   M   P+WA GL L+A+GYE+  Y+K
Sbjct: 608 -CFITMHIHDELVIEASLG--VNLKSICEQMGRTPTWANGLKLRADGYETMFYKK 659


>gi|167761124|ref|ZP_02433251.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
 gi|167661243|gb|EDS05373.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
          Length = 662

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 205/717 (28%), Positives = 310/717 (43%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S I+L+KCG+ KYAE  D  ++LF +  D   V++ D      +PQ L 
Sbjct: 1   MQTLSIDIETYSSINLSKCGVYKYAEAPDFEILLFGYSVDGCDVKVIDLAQGEHLPQELI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC---FNLDIPI-----------------HRWICTLV 98
           +AL +  +   A N+ FER  L        + +                     W C++V
Sbjct: 61  DALTDDSIIKWAFNANFERVCLSRYLRDLGISLDPFHDSHHLSQECSHFLNSESWRCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAW 154
            A + GLP +L+ VG  L L  QK+ EGKELI  F   C          RN+P H  E W
Sbjct: 121 WAATMGLPLSLEGVGSVLGLEKQKLTEGKELIKYFSVPCAPTKANGGRTRNRPFHDPEKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             F  Y   DV     I  RL   P+       +++DQ INDRG  +D+ L     ++  
Sbjct: 181 DAFKRYNIRDVETEMGIKDRLSKFPVPEAVWYEYHIDQEINDRGVRIDMDLVTEAIEMDT 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             RT+L   ++ +T   + +   ++++K WL    GL  + L +     ++ +     P+
Sbjct: 241 RSRTELTSAIKKMTD--LENPNSVQQMKQWLSN-NGLETDSLGKKVVAELIKT---APPE 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
              V   R + ++S+V K  T+  A+  DGR RG   F GA+RTGRW+G +   QNLP+ 
Sbjct: 295 LQNVLELRQQLAKSSVRKYQTMERAVCDDGRARGMFAFYGANRTGRWAGRLIQLQNLPQN 354

Query: 333 SRSHEELDQIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                   + +              D    +S  +R+  I     +  V+D + IEARV+
Sbjct: 355 HLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKSDTQFYVSDFSAIEARVI 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           AW AGE W+ K F  G D+Y  + ++ F+V   +       R  GK+ ELALGY G   A
Sbjct: 415 AWYAGETWRQKVFAEGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALGYGGSIGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M +                                         E          + 
Sbjct: 475 LKAMGAI----------------------------------------EMGLSEDELPPLV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            AWRQ +  + + W ++ +A  + +++              +        L + LPSGR+
Sbjct: 495 DAWRQTNPNIVKFWWDVDRAVMEAVKHKHTTS------CYGLTFSCRSGMLFITLPSGRN 548

Query: 568 LVY--RDVGNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +G N+            +T++  R  +YG K  ENIVQA SRDIL   M    
Sbjct: 549 LAYVKPKIGTNKFGGECITYEGVGSTKKWERLDSYGPKFVENIVQATSRDILCYAMKTL- 607

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +IV+ +HDE+V E       +  +L   M   P WA+GL L+A+GY    Y+K
Sbjct: 608 -RNCEIVMHIHDELVIEA--DPCMSLDVLCEQMGRTPPWARGLKLRADGYTCPFYKK 661


>gi|308174986|ref|YP_003921691.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607850|emb|CBI44221.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
          Length = 648

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 230/699 (32%), Positives = 329/699 (47%), Gaps = 76/699 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y E  D  ++LFA+ FD+ P+++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEASDFEILLFAYAFDEEPIKVIDLAQGEALPHEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FN  +P  +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           S QK +EGK LI  F   CK         RN P H  + W  F  YC  DV V R I  R
Sbjct: 121 SEQKDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKTYCGQDVEVERSIKNR 180

Query: 175 LEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +        EQELW LDQ INDRG  +D  L        +  +  L  E + LT     +
Sbjct: 181 ISKFEPLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELTGLP--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + GL +  L +   + ++      +    +V   R   ++++V K  
Sbjct: 239 PNSTAQLKKWLEDK-GLSVSSLAKDKIEELIEKTDDAS--VHRVLRLRQEMAKTSVKKYL 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            + +A+  D R+RG LQF GASRTGRW+G +   QNLP+   +  +  + +    H    
Sbjct: 296 AMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLLKGGHYEAI 355

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  VR+  I SEG +  V+D + IEARV+AW+AGE W+L  F T   +Y
Sbjct: 356 ELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHGKIY 415

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + A+ F V    +TK    R  GKV ELALGYQGG  A  +M + T GL+ +      
Sbjct: 416 EASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLDEDELP--- 472

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                  + KAWR  + ++ + W ++  
Sbjct: 473 --------------------------------------GLVKAWRTANKKIVQFWYDVEA 494

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR--------- 577
           A  + ++  K +     +    +    +   L + LPSGR L Y                
Sbjct: 495 AAVKAVKERKPV-----KIQHGLTFLCESGILFVQLPSGRRLAYAKPKLEIDDRFGKEAL 549

Query: 578 SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           +Y     + +  R  TYGGKL ENIVQAV+RD LA  ++    AGY  V+ VHDE V + 
Sbjct: 550 TYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDETVLDV 609

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P   +     +  +M     WAKGLPL A+G+ +  Y+K
Sbjct: 610 PRG-KNELDKVESIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|118852|sp|P06225|DPOL_BPSP2 RecName: Full=DNA polymerase
 gi|216151|gb|AAA32600.1| DNA polymerase (gene L; ttg start codon) [Bacillus phage SPO2]
 gi|579197|emb|CAA25691.1| unnamed protein product [Bacillus phage SPO2]
          Length = 648

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 229/698 (32%), Positives = 325/698 (46%), Gaps = 74/698 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+  Y E  D  ++LFA+ FDD PV++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKAGVYAYTEAPDFEILLFAYAFDDDPVKIIDLAQGDTLPHEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FNL +   +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNLMLLPAQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           S+QK + GK LI  F   CK         RN P H  E W  F  YC  DV V R I  R
Sbjct: 121 SAQKDKAGKALIRYFSVPCKPTKANGQRVRNLPEHDPEKWEKFKVYCIQDVEVERAIKNR 180

Query: 175 LEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +        E +LW LDQ INDRG  +DV L        +  +  L  E + LT     +
Sbjct: 181 ISKFEPLESEHKLWALDQEINDRGVRIDVDLVKHAIACDEQYQAGLIAEAKKLTGLP--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + GL +  L +   + ++ +         +V   R   ++++V K  
Sbjct: 239 PNSTAQLKKWLEEK-GLTISSLAKDKIEELIEN--TNDETVHRVLRLRQEMAKTSVKKYL 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            + +A+  D R+RG LQF GASRTGRW+G +   QNLP+      +  + +    H    
Sbjct: 296 AMEKALCPDNRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIEDLDTARNLLKGGHYEAI 355

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  VR+  I SEG +  V+D + IEARV+AW+AGE+W+L+ F T   +Y
Sbjct: 356 ELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEEWRLEVFNTHGKIY 415

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + A+ F V    +TK    R  GKV ELALGYQGG  A  +M                
Sbjct: 416 EASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMG--------------- 460

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+           + KAWR  + ++ + W ++  A
Sbjct: 461 -------------------------ALNMGLAEGELPELVKAWRTANKKIVKFWYDVEAA 495

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---------GNNRS 578
             + ++  K +  +       +    +   L + LPSGR L Y                +
Sbjct: 496 AIKAVKERKPVKLQ-----HGLTFLYESGILFVQLPSGRRLAYAKPKLELDERFGKEALT 550

Query: 579 YLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
           Y     + +  R  TYGGKL ENIVQA +RD LA  +M    AGY  V+ VHDE V + P
Sbjct: 551 YEGKLESGKWGRLNTYGGKLVENIVQATARDCLAITLMRLDNAGYKTVMHVHDEAVLDVP 610

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              +     +  +M    SWAKGLPL A+G+ +  Y+K
Sbjct: 611 RG-KNELDKVEAIMGEPISWAKGLPLTADGFVTDYYKK 647


>gi|302876795|ref|YP_003845428.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307687477|ref|ZP_07629923.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302579652|gb|ADL53664.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 663

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 206/713 (28%), Positives = 317/713 (44%), Gaps = 96/713 (13%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           TL ID ET S IDL KCG+ KY+E  D  V+LFA+  D   V + D  +   +P  + +A
Sbjct: 6   TLSIDIETYSSIDLAKCGVYKYSESSDSEVLLFAYSVDGGSVIVIDVANGESIPDEILQA 65

Query: 61  LENTDVTIVAHNSYFERT----VLKACF--------------NLDIPIHRWICTLVLARS 102
           L +  V   A N+ FER      LK  +                 +    W C+++ +  
Sbjct: 66  LVDDSVIKWAFNAAFERVFLSIWLKRNYPELFCSYSIPEDSVGNYLDPSAWRCSMIWSAY 125

Query: 103 NGLPSALKAVGEALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNH-REAWRLFG 158
            GLP +L+ VG  L L  QK++EGK+LI  FCK            RN P H  + W LF 
Sbjct: 126 MGLPLSLEGVGAVLGLEEQKLKEGKDLIRYFCKPCAATKVNGGRTRNLPEHAPDKWELFK 185

Query: 159 EYCKGDVTVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT 216
            Y K DV V   I K+    P+     E ++LDQ INDRG  +D+ +     +I  + + 
Sbjct: 186 AYNKRDVEVEMNIQKKLSHYPVPEFVWEEYHLDQEINDRGIALDMDVVENAIRIDAISKA 245

Query: 217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQV 276
            L   ++ LT   + +   + ++K WL  + G+  + L +   + V+   K +      V
Sbjct: 246 TLMATMQDLTD--LENPNSVAQMKGWLAAK-GVDTDSLDK---KAVIELLKTVPTDVADV 299

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R + ++S+V K   +  A+  DGR RG  QF GA+R+GRW+G +   QNLP+     
Sbjct: 300 LTLRQQLAKSSVKKYQAMQNAVCDDGRARGMFQFYGANRSGRWAGRIIQLQNLPQNHMED 359

Query: 337 EELDQIITHLPTSI---TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
            ++ + I              +   ++S+ +R+  I  EG K  VAD + IEARV+A +A
Sbjct: 360 LDVARDIVKSGDYEILNMFYDNVPGVLSELIRTAFIPREGYKFAVADFSAIEARVIAHLA 419

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKM 451
            E+W++K F    D+Y  + +  F V   +       R  GK+ ELALGY G   A   M
Sbjct: 420 KERWRMKVFADNGDIYCASASAMFGVPVEKHGQNAHLRQKGKIAELALGYGGSVGALTSM 479

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                                                    A++        + +  AWR
Sbjct: 480 G----------------------------------------ALDMGLAEEELQPLVDAWR 499

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY- 570
             +  + + W ++  A ++ I+   A      R             L ++LPSGR L Y 
Sbjct: 500 AANPNIVQFWWDVDNAVKRAIKERTATKTHGIR------FIYKSAMLFIVLPSGRRLAYV 553

Query: 571 -RDVGNNRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G N+    + T       ++  R  +YG K  ENIVQA+SRDIL   +   +    
Sbjct: 554 KPRIGENKFGGESVTYEGVGTNKKWERIESYGPKFVENIVQAISRDILCYALRTLSH--C 611

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV  VHDE++ E       +   +   M   P W +GL L+A+GYE++ Y+K
Sbjct: 612 FIVGHVHDEVIIECRQDA--SLEAICEQMGRVPEWIEGLLLRADGYETQFYKK 662


>gi|332800352|ref|YP_004461851.1| DNA-directed DNA polymerase [Tepidanaerobacter sp. Re1]
 gi|332698087|gb|AEE92544.1| DNA-directed DNA polymerase [Tepidanaerobacter sp. Re1]
          Length = 652

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 223/702 (31%), Positives = 331/702 (47%), Gaps = 78/702 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DLTKCG+  Y  AED  ++LF + F++ PVE+ D      +P  + 
Sbjct: 1   MTILSIDIETYSSVDLTKCGVYAYTQAEDFEILLFGYAFNNDPVEVIDLASGEQIPDEVT 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            A+ ++ V   A N+ FERT L    N  +P   W C+   A + GLP  L  V + L L
Sbjct: 61  NAITDSAVIKTAFNANFERTCLAKYLNKPMPPEEWRCSQAHALTLGLPLNLAGVAKCLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
           + QKM EGK LI  F   CK         RN P+H  E W  F  YCK DV V R I KR
Sbjct: 121 ADQKMSEGKALIRYFSIPCKPTKANGGRTRNLPHHDREKWETFKAYCKQDVVVERSIRKR 180

Query: 175 L--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P++ KE +LW LDQ IND G  VD  L         + + +L  E   LT   + +
Sbjct: 181 LENYPMTDKELKLWSLDQKINDYGVRVDRQLVENAICCDGIHQKELMAEAIDLTG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LKTWL     + ++ L++   + +L+      P   +V   R   S+++V K  
Sbjct: 239 PNSPAQLKTWLKGNHNIQVDSLSKANVEELLNKI--NHPTVTRVLELRQDMSKTSVRKYE 296

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            +  AM  DGR+RG LQ+ GA+RTGRW+G +   QNLPR +    +L + +       + 
Sbjct: 297 AMDRAMGGDGRIRGLLQYYGANRTGRWAGRLVQVQNLPRNNMKDLDLARKLLLAGDYESL 356

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  + S G + +++D + IEARV+AW+AGE+W +  F+    +Y
Sbjct: 357 ELLFDSVPDVLSQLIRTAFVPSPGHRFIISDFSAIEARVIAWLAGEKWVVDTFKGHGKIY 416

Query: 410 VTTYARSFNVAPA-----QVTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
             T ++ F V            + R  GKV  LA GYQG   A + M +   GL  +   
Sbjct: 417 EMTASKMFGVPMELIVKGNPEYELRQKGKVAVLACGYQGSVGALKAMGALNMGLKEDELP 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                                     +  AWR+ +  + +LW +
Sbjct: 477 A-----------------------------------------IVAAWRESNPNIVKLWWD 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTT 583
           +  A  + +++  +I  +       +        L + LPSGR+L Y             
Sbjct: 496 VEDAAIRAVKDRTSITMQYG-----LKFYYKSGVLFIRLPSGRNLAYVKPRIELDTRFNK 550

Query: 584 TR----------QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
            +          +  R  TYGGKLTENI+QA++RD LAE ++   KAGY I   VHDE+V
Sbjct: 551 DKLTYEGIMLGNKWARIDTYGGKLTENIIQAIARDCLAESLLRLDKAGYKIAFHVHDEVV 610

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P     +   +  +M+ + +WAKGLPL+AEG+E+  Y K
Sbjct: 611 LDVPQGF-GSLKEVEEIMSQDINWAKGLPLRAEGFETNYYMK 651


>gi|328913309|gb|AEB64905.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           LL3]
          Length = 648

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 231/699 (33%), Positives = 330/699 (47%), Gaps = 76/699 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y E  D  ++LFA+ FD+ P+++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEAPDFEILLFAYAFDEEPIKVIDLAQGEALPHEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FN  +P  +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           S QK +EGK LI  F   CK         RN P H  + W  F  YC  DV V R I  R
Sbjct: 121 SEQKDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKAYCGQDVEVERSIKNR 180

Query: 175 LEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +        EQELW LDQ INDRG  +D  L        +  +  L  E + LT     +
Sbjct: 181 ISKFELLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELTGLP--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LKTWL  + GL +  L +   + ++      +    +V   R   ++++V K  
Sbjct: 239 PNSTAQLKTWLEDK-GLSVSSLAKDKIEELIEKTDDAS--VHRVLRLRQEMAKTSVKKYL 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTS 349
            + +A+  D R+RG LQF GASRTGRW+G +   QNLP+   +  +  + +    H    
Sbjct: 296 AMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLLKGGHYEAI 355

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  VR+  I SEG +  V+D + IEARV+AW+AGE W+L  F T   +Y
Sbjct: 356 ELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHGKIY 415

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + A+ F V    +TK    R  GKV ELALGYQGG  A  +M + T GL+ +      
Sbjct: 416 EASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLDEDELP--- 472

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                  + KAWR  + ++ + W ++  
Sbjct: 473 --------------------------------------GLVKAWRTANKKIVQFWYDVEA 494

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR--------- 577
           A  + ++  K +     +    +    +   L + LPSGR L Y                
Sbjct: 495 AAVKAVKERKPV-----KIQHGLTFLCESGILFVQLPSGRRLAYAKPKLEIDDRFGKEAL 549

Query: 578 SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           +Y     + +  R  TYGGKL ENIVQAV+RD LA  ++    AGY  V+ VHDE V + 
Sbjct: 550 TYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDEAVLDV 609

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P   +     +  +M     WAKGLPL A+G+ +  Y+K
Sbjct: 610 PRG-KNELDKVEAIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|302873662|ref|YP_003842295.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307686614|ref|ZP_07629060.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302576519|gb|ADL50531.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 645

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 215/697 (30%), Positives = 337/697 (48%), Gaps = 75/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+  Y    +  ++LFA+ FD   V++ D      +P  + 
Sbjct: 1   MQTLSIDIETFSDVDLIKSGVYAYTASPNFEILLFAYAFDSDEVKIIDFASGEELPAEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL N ++   A N+ FER  L    N  +  + W CT V A + G P +L  V + L L
Sbjct: 61  EALLNENIIKSAFNAQFERICLSRHLNKKLTANAWQCTAVQAATLGFPLSLDGVAQVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           + QKM+EGKELI  F   CK         RN P H  E W  F +YC  DV V R I K+
Sbjct: 121 TEQKMKEGKELIRYFSIPCKPTRVNEGRTRNLPQHSSEKWNDFKKYCIRDVEVERAIRKK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+S  EQ  + LD  INDRG  VD+ L     +   + +     E + LT   + +
Sbjct: 181 LSRYPISENEQRNYILDHEINDRGVFVDLDLVARAMECDRLHKEDTFTEAQRLTG--LDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL +E G+ ++ L++     +    K+   +  ++ N R++ +++++ K  
Sbjct: 239 PNSVAQLKQWL-IENGVEVDSLSKKAVSDL---AKEADGEVERLLNLRLQLAKTSIKKYE 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---S 349
            +  A+  D R+RG LQF GA+RTGRW+G +   QNLP+       L + +         
Sbjct: 295 AIERAVCPDKRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLKDLTLARNLVKSGDFDTL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S+ +R+  I     + +VAD + IEARV+AW+AGE+W++  F T   +Y
Sbjct: 355 ALLFESVPHVLSELIRTAFIPKSNHRFIVADFSAIEARVIAWLAGEKWRMDVFATHGKIY 414

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   ++TK    R  GK+ ELALGY G   A   M                
Sbjct: 415 EASASQMFKVPIEEITKTSALRQKGKISELALGYGGSVGALTAMG--------------- 459

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A++        + +  AWRQ +  +++LW ++ +A
Sbjct: 460 -------------------------ALDMGVAEDELQGLVTAWRQANPNITKLWWDIDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN--------RSY 579
             + ++    ++  K      + ++ +   + + LPSGR L Y               +Y
Sbjct: 495 AIKAVKKKTTVMVGK------IKLQYESGIMFITLPSGRRLSYIKPRIEPNKFERDAVTY 548

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                T++  R  TYG KL ENIVQA++RD+LAE M+   + GY+IV+ +HDEIV E P 
Sbjct: 549 EGIGATKKWERIETYGPKLVENIVQAIARDLLAEAMLRVAENGYEIVMHIHDEIVIEAPL 608

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +M   P+WA+ LPL+A+G+E + YRK
Sbjct: 609 NF-GSLKDVCEVMAIAPTWAESLPLRADGFECEYYRK 644


>gi|300909419|ref|ZP_07126880.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893284|gb|EFK86643.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  520 bits (1338), Expect = e-145,   Method: Composition-based stats.
 Identities = 204/697 (29%), Positives = 309/697 (44%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L + G  +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L       +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTSCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +       +  Q  + LT     +
Sbjct: 181 FSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQTSQQLTGLA--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + G+  + L + +  ++L +    T    QV   R   S+S+V K  
Sbjct: 239 PNSPLQLKNWLHQQ-GVETDSLAKASVAQLLQT---TTGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP---TS 349
            + +AM  DG + G LQF GA+RTGRW+G +   QNLPR S    E  + +         
Sbjct: 295 AMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARALVKQGNTTAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+G    VAD + +EARV+AW++GE+W+  AF   ED+Y
Sbjct: 355 AMLYESVPDVLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEWRQAAFAKNEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +     + R  GK+ ELALGY G   A + M +T             
Sbjct: 415 CASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK------------ 462

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                                 + + WR     + + W ++ +A
Sbjct: 463 ----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR-------S 578
            ++ I+          +             + L L SGR L Y    +G NR        
Sbjct: 495 AKECIKTHLPQTTHGMK------FIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESITF 548

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
             N T ++  R  TYG KL ENIVQA SRD+LA  M     AG  +V+ +HDE V + P 
Sbjct: 549 MGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAPT 608

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +MT  P WA GL L A G+    Y+K
Sbjct: 609 D--RSLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|227496457|ref|ZP_03926741.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226834039|gb|EEH66422.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 651

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 230/695 (33%), Positives = 323/695 (46%), Gaps = 73/695 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L   G+ +YA D    ++LFA+  D   V++ D      +P  + 
Sbjct: 9   MRTLSIDIETFSKASLPSVGVYRYAADESFEILLFAYAVDGGEVQIVDLARGEQIPGDVL 68

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +ALE+  V   A N+ FER  L A     +    W C++V A   G+P  L  V +AL L
Sbjct: 69  DALEDPGVVKSAFNAAFERVCLSAHLGHRLDPEGWRCSMVWASFAGVPLDLAGVAKALHL 128

Query: 119 SSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREI--F 172
            ++KM EGK LI  F    K        +RN P H  + W  F  YCK DV V   I   
Sbjct: 129 ETEKMGEGKNLIRYFSLPAKPTKANGGRERNLPEHAPDDWETFKAYCKRDVEVELAITKR 188

Query: 173 KRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+ ++E + ++ DQ INDRG  +D  LA       +  R    + +  LT   V +
Sbjct: 189 LHAMPMPAREWDNYWDDQRINDRGVRIDADLATAAVDADNTGRASALERMRELT--RVDN 246

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +L  WL  + GL ++ L +      L    +      +V   R   ++S+V K  
Sbjct: 247 PASVTQLLAWLRSQ-GLQIDSLAKADVAAALEGALE--GDVAEVLALRQEMAKSSVKKYE 303

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLPTS 349
            ++     DGR  G LQF+GA RTGRW+G +   QNLPR S S  E    +    H    
Sbjct: 304 RMLACRCPDGRAHGLLQFMGAGRTGRWAGRLVQVQNLPRQSISDLEAAADLVRTGHADML 363

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
            T      Q++S+ +R+  +A  G + +VAD + IEAR +AW+AGEQW L  FE G D+Y
Sbjct: 364 ETLWGSAPQVLSELIRAAFVAEPGSRFLVADYSAIEARTIAWLAGEQWVLDLFEAGGDIY 423

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
             T  R F     + +   R   KV  LA GYQGG  A + M                  
Sbjct: 424 CETGTRMFRQVVEKHSP-LRQRAKVAVLACGYQGGVGALKTMG----------------- 465

Query: 470 SAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
                                    +          +  AWR  + ++++LW +++ A  
Sbjct: 466 -----------------------GEKLGLSEDEMADIVAAWRAANPKIAQLWWDINAAAI 502

Query: 530 QTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT--- 584
             I++G A    + R         DK  LI+ LPSGR LVY    +G NR    + T   
Sbjct: 503 AVIKDGGARAVGRIRLAH------DKGALIITLPSGRPLVYPSPRIGENRFGGESITHMG 556

Query: 585 ----RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
               R+  R  TYGGKLTENIVQA +RDILA  +    ++GY +V+ +HDE+V E P+  
Sbjct: 557 VGVNRKWGRIETYGGKLTENIVQATARDILAHAIARLERSGYPVVMHIHDEVVTEVPEG- 615

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +   L  LM+  P WA GLPL AEG+ES  YRK
Sbjct: 616 RGSVEELCALMSQAPPWADGLPLAAEGFESTYYRK 650


>gi|220930221|ref|YP_002507130.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000549|gb|ACL77150.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 647

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 205/699 (29%), Positives = 316/699 (45%), Gaps = 80/699 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + +L +D ET S ++L K G+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 4   INSLSLDLETYSSVNLQKSGVYRYAESDDFEILLFGYSVDSGEVQVVDLAGGEEIPDEII 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL +  VT  A N+ FER  L    NL   +    W C++V +   GLP +L+ VG  L
Sbjct: 64  NALMDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMVWSAYMGLPLSLEGVGAVL 123

Query: 117 KLSSQKMEEGKELIARFCK---GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I 
Sbjct: 124 GLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKVYNIRDVESEMLIQ 183

Query: 173 KRLEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL          + ++LDQ INDRG  +D+       ++ +  R KL   ++ +T   +
Sbjct: 184 QRLSKFQVPENIWKEYHLDQVINDRGIAIDMTFVKQAVEMDEHSREKLIALMQDITN--L 241

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   ++++K WL  + GL  + L +     +L +  +           R + ++S+V K
Sbjct: 242 ENPNSVQQMKDWL-ADNGLETDSLGKKVVAEMLKTAPEPLGTV---LELRQQLAKSSVKK 297

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLP 347
              +  A+ SDGR RG  QF GA+RTGR+SG +   QNLP+      E  + +    +  
Sbjct: 298 YTAMENAVCSDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNFD 357

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                     +++S+ +R+  I  EG K +VAD + IEARV+AW+AGE+W+L  F+ G D
Sbjct: 358 ALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRLNVFQKGGD 417

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ FNV   +       R  GK+ ELALGY G   A + M              
Sbjct: 418 IYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGAVGALKSMG------------- 464

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A+E        + +  AWRQ +  +++LW ++ 
Sbjct: 465 ---------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDVD 497

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG--------NNR 577
           +A +  ++               +        L ++LPSGR L Y             + 
Sbjct: 498 RAVKTCVKQKTPTATHG------IKFIYQSGMLFIVLPSGRRLAYVKPRMGENMFGSESV 551

Query: 578 SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           +Y     T++  R  +YG K  ENIVQA+SRDIL   M         IV  VHDEI+ E 
Sbjct: 552 TYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIEA 609

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 + S +   M   P+WA GL L A+GYE + Y+K
Sbjct: 610 --DMGMSLSAICEQMAKTPTWANGLLLSADGYECQFYQK 646


>gi|227498331|ref|ZP_03928481.1| DNA polymerase I [Acidaminococcus sp. D21]
 gi|226903793|gb|EEH89711.1| DNA polymerase I [Acidaminococcus sp. D21]
          Length = 662

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 201/717 (28%), Positives = 304/717 (42%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ET S ++L KCG+ KYAE     ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKTISIDIETFSDVNLAKCGVYKYAESPAFEILLFGYAIDGGKVQVVDLARGERIPDDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFN--------------------LDIPIHRWICTLV 98
           +AL +  VT  A N+ FER  L                           +    W C+++
Sbjct: 61  DALTDESVTKWAFNASFERVCLSRYLRDLRISLDPFHDHHPLSRDCARFLNPAGWKCSMI 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAW 154
            +   GLP +L+  G  LKL SQKM+EGK+LI  F   CK         RN P H  + W
Sbjct: 121 WSAYMGLPLSLEGAGAVLKLDSQKMKEGKDLIRYFCVPCKETKLNGGRTRNLPRHAPDKW 180

Query: 155 RLFGEYCKGDVTVTREIFK--RLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
            LF  Y K DV V   I +  +  P+     + ++LDQ INDRG  +D  LA     I  
Sbjct: 181 TLFKSYNKRDVEVEMVIQERLKKYPVPEPIWDEYHLDQEINDRGIAIDRTLAENAIVIDA 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R  L   L+  T   + +   + ++  WL  + G+  + L +   Q +L + ++    
Sbjct: 241 RSRDSLMAVLKGKTG--LENPNSVIQMIGWL-EQHGMKTDSLGKKQVQELLKTAEEP--- 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
              V   R + ++S+V K   +      D R RG  QF GA+RTGR++G     QNLP+ 
Sbjct: 295 LRSVLLLRQKLAKSSVKKYQAMEMTACEDSRARGMFQFYGANRTGRFAGRHIQLQNLPQN 354

Query: 333 SRSHEELDQIIT---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                   + +    +             ++S  +R+  +  +G K VV+D + IEARVL
Sbjct: 355 HLPDLAEARELVRQGNYEALELLYDSIPDVLSQLIRTAFVPRKGMKFVVSDFSAIEARVL 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           +W+AGE W+L  F    D+Y  + +  F V   +       R  GK+ ELALGY G   A
Sbjct: 415 SWLAGETWRLDVFARNGDIYCASASSMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M                                         A++          + 
Sbjct: 475 LKAMG----------------------------------------ALDMGLTENELYPLV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           ++WR  +  + + W ++    +  I+    + A   R             L + LPSGR 
Sbjct: 495 QSWRSANPHIVDFWWQVDATVKTAIKEQIPMRAGCIR------FLCQSGMLFIQLPSGRR 548

Query: 568 LVY--RDVGNNRSYLNT-------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +G NR    +        T++  R  +YG K  ENIVQ +SRDIL   M    
Sbjct: 549 LSYVKPRIGENRFGGESVTYEGIGATKKWERLESYGPKFVENIVQGISRDILCYAMQTL- 607

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                IV  VHDE++ E       +   +   M   P WA+GL L+A+GYE + Y+K
Sbjct: 608 -RCCAIVGHVHDELIIECSRDA--SVDAICEQMGRTPPWAEGLLLRADGYECEFYQK 661


>gi|313618507|gb|EFR90506.1| DNA polymerase [Listeria innocua FSL S4-378]
          Length = 684

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 206/701 (29%), Positives = 321/701 (45%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L K G+ +Y  A+D  VILF +  D   V++ D +    +P+ + 
Sbjct: 39  MKNLEIDIETYSSTNLQKSGVYRYVEADDFEVILFGYAVDGDEVKVIDLMDGEKIPKEIL 98

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
           +AL +  +T  A N+ FER  L           +    W C++V +   GL  +L+ VG 
Sbjct: 99  DALTDETITKWAFNAQFERVCLSRYLGYPTGTYLNPSSWKCSMVWSAYMGLALSLEGVGA 158

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  F   C          RN        W+ F  Y K DV    +
Sbjct: 159 VLGLEKQKLTEGKDLIRYFCLPCTPTKINGGRTRNLSTDEIDKWQQFKAYNKRDVEAEIQ 218

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I +RL   P+     + ++LDQ INDRG  VD+        + D+   KL   ++ +T  
Sbjct: 219 IQQRLIKFPVPEDIWDEYHLDQEINDRGIKVDMDFVKQAIAMDDISHEKLLTVMQQITN- 277

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K+WL    GL +E L +          K+   +  +V + R + ++S+V
Sbjct: 278 -LDNPNSVQQMKSWLCE-NGLEMETLGKKAVA---EKLKETDGELNEVLSLRQQLAKSSV 332

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---H 345
            K   +  A+ SD R RG  QF GA+RTGR++G +   QNLP+      +  + I     
Sbjct: 333 KKYTAMENAVCSDSRARGMFQFYGANRTGRFAGRLVQLQNLPQNHMPDLKEARNIVRNGD 392

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           + T      D    +S  +R+  +   G K +VAD + IEARVL+W+AGE W+ K F +G
Sbjct: 393 VETLEMLYEDIPDTLSQLIRTAFVPRVGHKFIVADFSAIEARVLSWLAGETWRTKVFASG 452

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M            
Sbjct: 453 GDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG----------- 501

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A+E        + +  AWR  +  +++ W +
Sbjct: 502 -----------------------------ALEMGLEEEELKPLVNAWRMSNPNITQFWWD 532

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           + +A +Q ++  K+       +   +        L ++LPSGR L Y    +G N+    
Sbjct: 533 VDRAAKQCVKENKSQ------ETHSIEFHCFSGMLFIVLPSGRRLAYVKPRIGENQFGGE 586

Query: 582 TT-------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           +        T++  R  +YG K  ENIVQA+SRDIL   M +     Y IV  VHDE++ 
Sbjct: 587 SVTYEGVGGTKKWERLESYGPKFVENIVQAISRDILMHAMKSLRH--YRIVAHVHDEVII 644

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ET    + + + +   M+  P WAKGL L A+GYE   Y+K
Sbjct: 645 ET--NPQISVTEVCKQMSQVPPWAKGLLLDADGYECDFYQK 683


>gi|218133416|ref|ZP_03462220.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990791|gb|EEC56797.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
          Length = 644

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 206/697 (29%), Positives = 317/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P  + D      MP  + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTRIIDLASGQTMPDEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A N+ FER  +   F L +    W CT V A    LP +L+ VGEAL L
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P +  E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+  +EQEL+ +DQ INDRG  VD  L         + +    +    ++   + +
Sbjct: 181 LAKFPIPDREQELYCMDQRINDRGIMVDRELISHAVTCDLLYKEAASKRAYEISG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  + G+ ++ L +   + ++        +  ++   R+  S+++V K  
Sbjct: 239 PNSVSQLKEWLNEK-GIEVDSLAKAAVEELVEK---TEGEISEMMKLRLSMSKTSVKKYE 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---S 349
            +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + I         
Sbjct: 295 AMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRYDLV 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     +Y
Sbjct: 355 ELLYDSTPDVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKIY 414

Query: 410 VTTYARSFNVAPAQVTKDQRAIG--KVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T ++ F++   ++TK        KV  LA  Y G   A   M +   +          
Sbjct: 415 EQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEE------- 467

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                               + + ++WR  +  +   W E+  A
Sbjct: 468 ----------------------------------ELKGLVQSWRTANPHIVNYWYEIDGA 493

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG--------NNRSY 579
            +  ++  K     +      V +      L + LPSGR L Y             + SY
Sbjct: 494 VKAAVKERKMTTVGR------VTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFGSESVSY 547

Query: 580 LN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
               T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+V E P+
Sbjct: 548 EGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLCLEKKGFDIVCHIHDEVVLEVPE 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +M   P W +GLPLKA G+ES  Y+K
Sbjct: 608 GT-SSVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|317132759|ref|YP_004092073.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
 gi|315470738|gb|ADU27342.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
          Length = 662

 Score =  518 bits (1333), Expect = e-144,   Method: Composition-based stats.
 Identities = 208/717 (29%), Positives = 322/717 (44%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ET S +DL KCG+ +Y       ++LF +  D  PV++ D      +P+ + 
Sbjct: 1   MKTISIDIETFSDVDLGKCGVYRYCSSPAFEILLFGYSVDGGPVKVVDLACGEKIPEDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-----NLD---------------IPIHRWICTLV 98
           +AL +  V   A N+ FER  L          LD               +    W C++V
Sbjct: 61  DALTDDTVLKWAFNANFERVCLSRYLRDMGRGLDPFHDNHPLSLEHARFLNPEGWRCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAW 154
            A + GLP +LK VG  L+L+ QKM+EGK LI  F   C          RN P +    W
Sbjct: 121 WAATMGLPLSLKGVGAVLQLADQKMDEGKALIKYFSVPCAPTKANGGRTRNLPSDDPGKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             F +Y + DV V   I ++L   P+     + +++DQ INDRG  +D+ L      +  
Sbjct: 181 ATFKKYNQRDVEVEMMIQRKLRSFPVPDFVWDEYHIDQEINDRGVRIDMDLVEKAIDMDT 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R++L ++++++T   + +   ++++K WL    G+ ++ L +   + V +  K   P+
Sbjct: 241 RSRSELTEKMQAITN--LENPNSVQQMKQWLSD-NGMEVDSLGK---KAVTALLKTAPPE 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
             +V   R + ++S+V K  T+  A+ SD R RG   F GA+RTGRW+G +   QNLP+ 
Sbjct: 295 LTEVLELRQQLAKSSVKKYQTMQRAVCSDSRARGMFMFYGANRTGRWAGRLIQLQNLPQN 354

Query: 333 SRSHEELDQIITHL---PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                +  + +              D    +S  +R+  I  +G +  VAD + IEARV+
Sbjct: 355 HLPDLDAARALVKSGDYEAVKMIYEDVPDTLSQLIRTAFIPKDGCRFYVADFSAIEARVI 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           AW AGE+WK  AF  GED+Y +T  R F+    +     + RA GK+ ELA GY G   A
Sbjct: 415 AWYAGEKWKSDAFANGEDIYCSTARRMFHKPVVKHGVNGELRAKGKIAELACGYGGSTGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M                                         A+E          + 
Sbjct: 475 LKAMG----------------------------------------ALEMGLSEDELPDIV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            +WR  + ++ + W ++ +A    ++N K     +      +        L + LPSGR+
Sbjct: 495 SSWRDANQQIVKFWWDVDKAVMAAVKNHKTTRLGR------LAFFWQAGMLFITLPSGRN 548

Query: 568 LVY--RDVGNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    VG NR             T++  R  +YG K  ENIVQA SRDIL   M    
Sbjct: 549 LAYVKPKVGMNRFGGECITYEGVGGTKKWERLESYGPKFVENIVQATSRDILCNSMKMLR 608

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               D+ + +HDE+V E       +   L   M   P+WA GL L+A+GY    Y+K
Sbjct: 609 H--CDVCMHIHDELVIEA--DPRVSLDTLCEQMGRVPAWADGLVLRADGYVCDFYKK 661


>gi|256847832|ref|ZP_05553277.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
 gi|256715521|gb|EEU30497.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
          Length = 644

 Score =  517 bits (1331), Expect = e-144,   Method: Composition-based stats.
 Identities = 203/697 (29%), Positives = 316/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQLSIDIETYSNTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L    +  +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT     +
Sbjct: 181 LECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKKLTGLA--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + G+  + L++ +  ++L +    T    QV   R   S+S++ K  
Sbjct: 239 PNSPLQLKDWLHQQ-GIKTDSLSKASVAQLLQT---TTGTVHQVLALRQLLSKSSIKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    E  + +     +P  
Sbjct: 295 AMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   ED+Y
Sbjct: 355 AMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +     + R  GK+ ELALGY G   A + M +T             
Sbjct: 415 CASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGAT------------- 461

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                                 + + WR     + + W ++ +A
Sbjct: 462 ---------------------------NLGLTDDELPPLVQMWRNASPHIVQFWWDVDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR-------S 578
            ++ I+          +             + L L SGR L Y    +G NR        
Sbjct: 495 AKECIKTHLPQTTHGMK------FIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESITF 548

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
             N T ++  R  TYG KL ENIVQA SRD+LA  M     AG  +V+ +HDE V + P 
Sbjct: 549 MGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAPT 608

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  +MT  P WA GL L A G+    Y+K
Sbjct: 609 D--RSLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|317501098|ref|ZP_07959304.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897485|gb|EFV19550.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 662

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 202/717 (28%), Positives = 312/717 (43%), Gaps = 98/717 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ++L+KCG+ KYAE  D  ++LF +  D   V + D      +PQ + 
Sbjct: 1   MQTLSIDIETYSDVNLSKCGVYKYAESPDFEILLFGYSADGSEVTVIDLAQGEHLPQKII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFN--------------------LDIPIHRWICTLV 98
           +AL +  V   A N+ FER  L                           +    W C++V
Sbjct: 61  DALTDDTVIKWAFNANFERVCLSRYLRDLGVSLDPFHDNHPLSTECARFLNPESWRCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAW 154
            A + GLP +L+ VG  L L  QK+ EGK+LI  F   C          RN P H  + W
Sbjct: 121 WAATMGLPLSLEGVGAVLGLEKQKLTEGKDLIKYFSVPCAPTKANGGRTRNHPFHAPDKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             F +Y   DV     I  RL   P+     + +++DQ INDRG  +D+ L     ++  
Sbjct: 181 EAFKKYNIRDVETEIGIKDRLAKFPVPEAVWDEYHIDQEINDRGVRLDMDLVKEAIEMDT 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R++L   ++ +T   + +   ++++K WL    GL  + L +     ++ +     P+
Sbjct: 241 RSRSELTAAMKDMTA--LDNPNSVQQMKQWLSD-NGLETDSLGKKVVAELIKT---APPE 294

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
              V   R + ++S+V K  T+  A+  DGR RG   F G +RTGRW+G +   QNLP+ 
Sbjct: 295 LQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFAFYGVNRTGRWAGRLIQLQNLPQN 354

Query: 333 SRSHEELDQIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                   + +              D    +S  +R+  I  +G +  V+D + IEARV+
Sbjct: 355 HLPDLADARALVKSGNFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQFYVSDFSAIEARVI 414

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKA 447
           AW AGE W+ K FETG D+Y  + ++ F+V   +       R  GK+ ELALGY G   A
Sbjct: 415 AWYAGETWRQKVFETGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALGYGGSVGA 474

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M +                                         E          + 
Sbjct: 475 LKAMGAI----------------------------------------EMGLSEDELPPLV 494

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            AWRQ +  + + W ++ ++  + ++      +        +        L + LPSGR+
Sbjct: 495 DAWRQTNPNIVKFWWDVDRSVMEAVKYKHTTSSYG------LTFSCRSGMLFITLPSGRN 548

Query: 568 LVY--RDVGNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +G N+            +T++  +  +YG K  ENIVQA SRDIL   M    
Sbjct: 549 LAYVKPKIGTNKFGGECVTYEGIGSTKKWEQLDSYGPKFVENIVQATSRDILCYAMKTL- 607

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                IV+ +HDE+V E       +  +L   M   P WAKGL L+A+GY +  Y+K
Sbjct: 608 -RCCSIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWAKGLKLRADGYVTPFYKK 661


>gi|315654969|ref|ZP_07907874.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
 gi|315490930|gb|EFU80550.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
          Length = 640

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 218/693 (31%), Positives = 317/693 (45%), Gaps = 72/693 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET SP+ L K G+ KY    D  ++LF++  D   V   D      +P  + 
Sbjct: 1   MRTLSIDIETYSPVILAKAGVYKYCNHPDFKILLFSYAIDSCTVRTVDLASGEQLPDAVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL ++ VT  A+N+ FERT L A     +    W C++V A + GLP +LK VG+ L L
Sbjct: 61  DALADSAVTKWAYNASFERTCLSAYLGRLLDPAGWRCSMVWAATLGLPLSLKDVGKVLNL 120

Query: 119 SSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLE-- 176
            +QKM+EGK+LI  FC  + +     R   +    W+LF  Y   DV V   I ++L   
Sbjct: 121 DAQKMDEGKDLIKHFCVPDDNS--QRRLPSSDPAGWKLFKMYNARDVEVETAIRQKLADF 178

Query: 177 PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCL 236
           P+     E + +DQ INDRG  +D  LA     I +  R +       LT   + +    
Sbjct: 179 PVPDYLWEQYEVDQRINDRGIRIDTTLAANAIAIDEEHRAQALARAHKLTG--LDNPASP 236

Query: 237 EKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVE 296
            +L+ WL    G  +E + + +    L      T Q  +    R   SRS+V K   +++
Sbjct: 237 LQLQEWLNQH-GCPIESMAKESVDDAL---ANATGQVREALELRQELSRSSVAKYRKMID 292

Query: 297 AMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSD 353
              +D R  G LQF GA+RTGRW+G +   QNLPR         + +             
Sbjct: 293 VTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLTQARGLVRDGNGETLEMLY 352

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
                 +S  +R+  I S   + +VAD + IEARVLAW+AGE+  L AF+ GEDLY  T 
Sbjct: 353 SSVPDTLSQLIRTAFIPSGAHRFIVADYSAIEARVLAWLAGEETTLAAFKNGEDLYCATA 412

Query: 414 ARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSA 471
           +  F V   +     + R  GK+  LA GY G   A + M +                  
Sbjct: 413 SAMFGVPVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMGALK---------------- 456

Query: 472 PEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQT 531
                                           + +  AWRQ +  + +LW+++  A  + 
Sbjct: 457 ------------------------MGLSEDELQPIVDAWRQANPNIVQLWHKVDNAATRA 492

Query: 532 IENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT----- 584
           I  G+ +  R       +  +K    L + LPSGR L Y    +G NR    + T     
Sbjct: 493 ISTGRPLTLR------NLGFEKKSGILFITLPSGRRLAYVKPGIGVNRFGGTSITYWGQG 546

Query: 585 --RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEF 642
             R+  +  TYGGKL ENIVQA +RD+LAE +     AG+ IV+ +HDE+V + P     
Sbjct: 547 VARKWQKLETYGGKLVENIVQATARDLLAEAITRIENAGHQIVMHIHDEVVIDEPINSGT 606

Query: 643 NASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             + +  LM   P WA+GLP+ A GYE   Y+K
Sbjct: 607 TVADICALMNELPQWAEGLPIDAAGYECGFYQK 639


>gi|298253796|ref|ZP_06977385.1| DNA polymerase I [Gardnerella vaginalis 5-1]
 gi|297532132|gb|EFH71105.1| DNA polymerase I [Gardnerella vaginalis 5-1]
          Length = 674

 Score =  515 bits (1326), Expect = e-143,   Method: Composition-based stats.
 Identities = 206/710 (29%), Positives = 319/710 (44%), Gaps = 94/710 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L +D ET S ++L KCG+ KYAE  D  ++LF +  D   V++ D      +P+V+  AL
Sbjct: 20  LSVDLETFSSVNLGKCGVYKYAESEDFEILLFGYSVDGSEVQVVDLAQGETIPEVVLSAL 79

Query: 62  ENTDVTIVAHNSYFERTVLKACF----------------NLDIPIHRWICTLVLARSNGL 105
            +  VT  A N+ FER  L                     L +    W CT++ + + GL
Sbjct: 80  TDETVTKWAFNAQFERICLSRYLRDKGINVNPGQTGKSEGLFLNPSSWHCTMIWSATLGL 139

Query: 106 PSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYC 161
           P +L+ VG  L L  QK+ EGK LI  F   C          RNK  H  E W  F  Y 
Sbjct: 140 PMSLENVGIVLGLDKQKLTEGKNLIKYFCLPCNPTKVNGGRTRNKYFHDKEKWEQFKSYN 199

Query: 162 KGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           K DV V   I ++L   P+     + +YLDQ INDRG  +D     +  ++    +T L 
Sbjct: 200 KRDVEVEMSIQEKLSRFPVPDFLWQEFYLDQEINDRGIGIDSLFVESAIKLDLEVKTHLM 259

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNN 279
            EL+ +T   + +   + ++++WL  + GL +E L +   + V    K +  +  +V   
Sbjct: 260 SELKRVTG--LENPNSVLQMRSWL-KKHGLEMESLGK---KEVAKELKTVGKELAEVLRL 313

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R + ++S+V K   +  A   D R RG  +F GA+RTGR++G +   QNLP+        
Sbjct: 314 RQQLAKSSVKKYTAMKNAACMDYRERGMFRFYGANRTGRFAGRLVQLQNLPQNHLPDLAE 373

Query: 340 DQIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
            + +     +        D    +S  +R+  I   G K +VAD + IEARVLAW+AGE+
Sbjct: 374 ARSLVKQGNVEALEMLYEDIPDTLSQLIRTAFIPRTGLKFIVADFSAIEARVLAWLAGEK 433

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           W+++ F  G+D+Y ++ ++ F+V   +       R  GK+ ELALGY G   A + M + 
Sbjct: 434 WRMRVFAEGKDIYCSSASQMFSVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGA- 492

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
                                                  ++        + +  AWR  +
Sbjct: 493 ---------------------------------------LDMGLTEDELQPLVDAWRSSN 513

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V+ LW ++ +A +Q +    ++          +        LI+ LPS R L Y    
Sbjct: 514 PMVTTLWWDVDRAVKQCVHEHVSVRT------HNIVFTYKSGFLIIKLPSKRCLYYVKPR 567

Query: 575 -NNRSYLN--------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
                Y           +T++  R  +YG K  ENI QA++RDIL   M       Y IV
Sbjct: 568 VEENKYGGESVTYEGVGSTKKWERLESYGPKFVENITQAIARDILIYAMQTL--KEYRIV 625

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             VHDE + ET  +   +   +  LM   P WA+GL L+A+GYE + Y+K
Sbjct: 626 AHVHDEAIIETDKS--VSVQSVCELMGRTPPWAEGLLLRADGYECEFYKK 673


>gi|300909464|ref|ZP_07126925.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893329|gb|EFK86688.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  513 bits (1322), Expect = e-143,   Method: Composition-based stats.
 Identities = 204/697 (29%), Positives = 315/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L+N ++   A N+ FER  L       +    W C+ V + + GLP +L+ +G  L L
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT     +
Sbjct: 181 LECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELTGLA--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + G+    L++ +  ++L +    T    QV   R   S+S+V K  
Sbjct: 239 PNSPLQLKDWLQQQ-GIKTNSLSKASVAQLLQT---TTGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    E  + +     +P  
Sbjct: 295 AMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   ED+Y
Sbjct: 355 AMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +     + R  GK+ ELALGY G   A + M +T             
Sbjct: 415 CASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK------------ 462

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                                 + + WR     + + W ++ +A
Sbjct: 463 ----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT- 584
            ++ I+          +             + L L SGR L Y    +G NR    + T 
Sbjct: 495 AKECIKTHLPQTTHGMK------FIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESITF 548

Query: 585 ------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                 ++  R  TYG KL ENIVQA SRD+LAE M      G  +V+ +HDE V + P 
Sbjct: 549 MGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTVVMHIHDEAVIDAP- 607

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 608 -FNRSLDTMVQLMTKVPDWANGLILNAAGFVSDFYKK 643


>gi|303239094|ref|ZP_07325624.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
 gi|302593432|gb|EFL63150.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
          Length = 649

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 225/701 (32%), Positives = 332/701 (47%), Gaps = 79/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLT CG+  Y  A D  ++LF + +DD PVEL D      +P  + 
Sbjct: 1   MRTLAIDIETFSSVDLTSCGVYTYTAAPDFQILLFGYAWDDDPVELIDLACGERLPDAIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            A+E+ +V   A N+ FER  L    N  +    W CT + A   GLP  L  VG ALKL
Sbjct: 61  NAIESPEVIKTAFNAGFERICLSKHLNKHLKADSWRCTAIQAAMLGLPLHLDGVGTALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK   GK+LI  F   CK         RN P+H  E W+ F +YC  DV V RE+ ++
Sbjct: 121 KVQKDRAGKDLIRYFSIPCKSTKSNGGRTRNLPHHAPEKWQKFKDYCVRDVEVEREVRRK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+  KE +LW LDQ IND G  VD+AL +   +      ++L+ E ++LT   + +
Sbjct: 181 IERYPIPEKELKLWLLDQKINDTGVLVDMALVNQAVKCDTQYSSRLEVEAKTLT--KLDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  + GL +E L++   Q +L+       +  ++   R   ++S++ K  
Sbjct: 239 PNSVAQLKEWLKEQ-GLEVESLSKQAVQNLLT---DADGEIERLLTLRQEMAKSSIAKYA 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL---PTS 349
            +  ++  D R+RG  QF GA+RTGRW+G +F  QNLP+      E+ +++         
Sbjct: 295 AVQRSVCPDSRVRGLFQFYGANRTGRWAGRIFQIQNLPQNHMKDLEIARMLVKQGRFKEL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S+ +R+ +I  +G + +VAD + IEARVLAW+A E W L  F+    +Y
Sbjct: 355 ELLYESVPIVLSELIRTVLIPEQGCRFIVADFSAIEARVLAWLANEAWVLDTFKGHGKIY 414

Query: 410 VTTYARSFNVAPAQVTK-----DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
             T +R F V   ++ K     + RA GKV  LA GYQGG  A + M +           
Sbjct: 415 EQTASRMFGVPVEKIAKGNPEYELRAKGKVAVLACGYQGGVNALKAMGADK--------- 465

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                               T  + + +AWR  + R+   W ++
Sbjct: 466 -------------------------------MGLSDTELDDIVRAWRSANQRIVRFWYDV 494

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR------- 577
            +A    +   +       R       K +   L + LPSGR L Y      +       
Sbjct: 495 EKAAVLAVREREPQRVGILR------FKVENGILFITLPSGRRLAYIRPKIEKDLRFDKD 548

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             +Y      +Q  R+ TYGG+L ENIVQ  +RD LAE M+     GY IV  VHDEI+ 
Sbjct: 549 GLTYEGLGINKQWWRQKTYGGRLVENIVQGAARDCLAEAMLRVDAKGYKIVGHVHDEIIT 608

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E     + +   L  +M     WA GLPL+A+G+E+  Y+K
Sbjct: 609 EMRKG-QGSLEELCGIMGQEIPWALGLPLRADGFETMFYKK 648


>gi|197303496|ref|ZP_03168535.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
 gi|197297494|gb|EDY32055.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
          Length = 661

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 198/715 (27%), Positives = 310/715 (43%), Gaps = 96/715 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S ID++KCG  KYAE  +  ++LF    D+ PV ++D      +P  + 
Sbjct: 2   MKELSIDLETYSDIDISKCGAYKYAESNNFEILLFGVSVDNGPVVVYDLASGDEIPAEIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD------------------IPIHRWICTLVLA 100
            AL + ++   A N+ FER  L                         +    W CT++ +
Sbjct: 62  AALSDENIIKWAFNASFERVCLSNWLRKHHPEYFKTYNTQGDPVQNFLDPASWKCTMIWS 121

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRL 156
              GLP +L+ VG  LKL  QKM+EGK+LI  FC   K         RN P H  + W  
Sbjct: 122 AYMGLPLSLEGVGAVLKLQDQKMKEGKDLIKYFCSPCKPTKVNGGRTRNLPEHAPDKWET 181

Query: 157 FGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE 214
           F  Y + DV V   I +RL   P+       +++DQ IND G  +D+ +        +  
Sbjct: 182 FKTYNRRDVEVELAIKQRLSKFPVPDSVWHEYHIDQEINDSGIMLDMDVVENAIAFDERS 241

Query: 215 RTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI 274
           ++ L   ++++T   + +   + ++K WL    G+  E L +     ++   K+      
Sbjct: 242 KSALITAMKNITN--LDNPNSVVQMKQWLSD-NGVETESLGKKEVAGLI---KETDGDIS 295

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           +    R++ ++S+V K   +  A+  DGR  G  QF GA+R+GRW+G +   QNLP+   
Sbjct: 296 KALKLRLQLAKSSVKKYQAMQNAVCKDGRAHGMFQFYGANRSGRWAGRLIQLQNLPQNHM 355

Query: 335 SHEELDQIITHLPT---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAW 391
           S     + +              D    +S  +R+  IA  G K +V+D + IEARVLA 
Sbjct: 356 SDLTEARELVRTGDYDTLDMLYDDIPDTLSQLIRTAFIARPGYKFIVSDYSAIEARVLAH 415

Query: 392 MAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQ 449
           +AGE W+ K F  G+D+Y  + ++ F V   +       R  GK+ ELALGY G   A +
Sbjct: 416 LAGETWRSKVFAEGKDIYCASASQMFGVPVKKHGINSHLRQKGKIAELALGYGGSVGALK 475

Query: 450 KMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
            M +                                        +E        + +  +
Sbjct: 476 SMGA----------------------------------------LEMGLTEEELQPLVDS 495

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR  +  ++  W  +  A +  I+           +V  ++       L++  PSGR L 
Sbjct: 496 WRSSNPMITAFWWNVDNAIKTAIKMHIPT------EVNGIHFCYKSGMLLIKRPSGRVLS 549

Query: 570 Y--RDVGNNRSYLNTT-------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
           Y    +G NR    +        T++  R  +YG K  ENIVQAVSRDIL   M      
Sbjct: 550 YVKPKIGENRFGGESVTYEGIGSTKKWERIESYGPKFVENIVQAVSRDILCNAMKTLRH- 608

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              IV  VHDE++ E     +   + +   M  +  W  G+ L+A+GYE+  Y+K
Sbjct: 609 -CFIVGHVHDELIIECSSGVD--LNEICKQMGRSLDWMPGILLRADGYETNFYKK 660


>gi|304439199|ref|ZP_07399117.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372331|gb|EFM25919.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 643

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 220/697 (31%), Positives = 332/697 (47%), Gaps = 77/697 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S +DL K G+ KYAE  D  ++LFA+  DD  V++ D     ++P+ + 
Sbjct: 1   MKKISIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGEVKVIDLASGEIIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT++ +   GLP +L+ VGE LKL
Sbjct: 61  SALSDESIEKWAFNANFERVCLSRFLEERLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHRE-AWRLFGEYCKGDVTVTREIFKR 174
             QKM EGK LI  F   CK      +  RN P+H    W +F EY + DV    EI K+
Sbjct: 121 DKQKMNEGKALIRYFSIPCKPTKTNGMRTRNLPHHDLGKWYIFKEYNQRDVETEMEIKKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+   E E +++DQ INDRG  +D  L  +  +  ++ R +       LT   + +
Sbjct: 181 LSVFPMPQSEWENYWVDQNINDRGILIDEILVDSAIKFDEILREENMDRAIELTG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  + GL ++ L +   + V S+ K       +V   R   S+S+V K +
Sbjct: 239 PNSPLQLKEWLNKK-GLEIDSLAK---KDVESAIKNAEGDIKEVLELRQELSKSSVRKYD 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            +      + R RG +QF GA+RTGR+SG +   QNL R +    +L + +       T 
Sbjct: 295 AMKNVKGKENRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARSLVKNRDYETM 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                 P  I+S  +R+  I  EG + +++D + IEARVLAW+A EQW L AFE GED+Y
Sbjct: 355 EFLYESPSDILSQLIRTAFIPKEGTRFIISDFSAIEARVLAWIAEEQWVLDAFENGEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             T +R F V   +       R  GK+  LA GYQG   A + M                
Sbjct: 415 CRTASRMFGVPVEKHGINGHLRQKGKIATLACGYQGALGALKAMG--------------- 459

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                     IE        + +  +WR+ +  +  LW ++   
Sbjct: 460 -------------------------GIEMGLSEDELQSIVDSWREANPNIVSLWWDIDSV 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR--DVGNNRSYLNT--- 582
            ++ ++         + +   + +  +K  L + LPS R L Y    +G NR    +   
Sbjct: 495 VKRVVKTRS------KEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGMNRFGGESVVY 548

Query: 583 ----TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                  +  +  +YGGK  ENIVQA++RDILAE MM   K G++IV+ +HDE+V E   
Sbjct: 549 EGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIE--- 605

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +D  +   +  +M+  P WA GL L A+G+ES+ Y+K
Sbjct: 606 SDSSSIEEVNQIMSIVPGWASGLILDADGFESEFYKK 642


>gi|315122935|ref|YP_004063424.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496337|gb|ADR52936.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 675

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 397/677 (58%), Positives = 488/677 (72%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M  LFID ETRSP  L K G+  YAE+  + L A+  +D  ++LWDC  +PVMP  L + 
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L++  V  VAHNS FER + K   N+ IP  RWICT  LAR NGLP++LK    ALK   
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG   E  YD  + NH +AW+LFGEYCK DV  TRE++KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E+ LW LDQ INDRGY +D+ L   L +++  ER +LD+E + LT G++ S+R  + 
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFERERLDEEFKELTAGVIGSARKTDL 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L  +LFL TGL L D+ E+T    LS    +   +  + NNR+ +S+SA+LKLNTL  A+
Sbjct: 241 LNKYLFLYTGLDLPDMAESTVLTALSQ-PDIPQLSKAILNNRLSSSQSAILKLNTLSGAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           + D RLRGTLQF GASRTGRWSGCVF PQNLPR + + +E++++I  L +      DPL+
Sbjct: 300 SPDNRLRGTLQFFGASRTGRWSGCVFQPQNLPRQTLAVDEIERLIRGLDSG-VPIKDPLR 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
             SDCVRSC+IAS GKKL+VADLAGIEARVLAW+AGEQWKL AF  GED+Y T Y+++FN
Sbjct: 359 FASDCVRSCIIASPGKKLIVADLAGIEARVLAWVAGEQWKLNAFANGEDIYKTAYSKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
           V  + VTKDQRAIGKVMELALGYQGGA+ FQKMAST GLNL  F+  +K  +  E+WE A
Sbjct: 419 VPLSDVTKDQRAIGKVMELALGYQGGARVFQKMASTLGLNLQQFSKSIKNTATSEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           +  C WMQE HPE A+ D FIGTACE VK+AWR KH  V +LW +  +AF+  I++G++I
Sbjct: 479 QRRCLWMQETHPEFAVPDPFIGTACELVKEAWRAKHKGVVQLWKDCEEAFDCVIKDGRSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+   VP + MKK   N+ + LPS R LVYRDV ++RSYLNT T Q+ RE TYGGKLT
Sbjct: 539 SARRVLGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDILA GM+NATKAGYDIVLTVHDEIVCE PDT EF++  L  LMT NP+WA
Sbjct: 599 ENIVQAISRDILATGMINATKAGYDIVLTVHDEIVCEVPDTPEFSSDDLCSLMTRNPTWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+ RYRK
Sbjct: 659 KGLPLKAEGYEAVRYRK 675


>gi|327461124|gb|EGF07457.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK1057]
          Length = 643

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 218/698 (31%), Positives = 330/698 (47%), Gaps = 79/698 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y +     ++LFA+  D++  ++ D V    +P+ + 
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT VLA S GLP +L+ VG  L +
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG  LI  F   CK      + +RN P+H  E W LF  YCK DV V + I  R
Sbjct: 121 EEQKMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIRVR 180

Query: 175 L--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   PL   EQ  + LDQ INDRG  VD  L           + ++ +    L+   + +
Sbjct: 181 LRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  E G+ ++ L +   + V    K+   + +++   R+  S+++V K  
Sbjct: 239 PNSVSQLKGWL-EEQGVFMDSLGK---KEVAKHLKEADGEVLEMLKLRLLMSKTSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            +   + SDGR+ G LQF GA+RTGRW+G +   QNLP+       L + +     + T 
Sbjct: 295 AIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQVETL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
            T   +   ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G D+Y
Sbjct: 355 DTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGGDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + +  F V   +       R  GK+ ELALGY G   A   M +   GL         
Sbjct: 415 CASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEE------ 468

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                + +   WR  +  +   W E+ +
Sbjct: 469 -----------------------------------ELQPLVNQWRSANPHIVAFWWEIDK 493

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTT--- 583
             +Q  E  +       + +  + +      L + LPSGR L Y       +        
Sbjct: 494 VAKQVYETREP------KKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKPGLT 547

Query: 584 ------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
                 +++ TR  TYG KL ENIVQ ++RD+LA GM+   + G  IVL VHDE V E  
Sbjct: 548 YEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVVEVR 607

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +    + + +  L+ + P WA+GLPL+A+GY  + Y+K
Sbjct: 608 E---ESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|325687766|gb|EGD29787.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK72]
          Length = 643

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 218/698 (31%), Positives = 329/698 (47%), Gaps = 79/698 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y +     ++LFA+  D++  ++ D V    +P+ + 
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT VLA S GLP +L+ VG  L +
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG  LI  F   CK      + +RN P+H  E W LF  YCK DV V + I  R
Sbjct: 121 EEQKMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIRVR 180

Query: 175 L--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   PL   EQ  + LDQ INDRG  VD  L           + ++ +    L+   + +
Sbjct: 181 LRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSG--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL  E G+ ++ L +   + V    K+   + +++   R+  S+++V K  
Sbjct: 239 PNSVSQLKGWL-EEQGVFMDSLGK---KEVAKHLKEADGEVLEMLKLRLLMSKTSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL---PTS 349
            +   + SDGR+ G LQF GA+RTGRW+G +   QNLP+       L + +       T 
Sbjct: 295 AIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQFETL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
            T   +   ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G D+Y
Sbjct: 355 DTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGGDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + +  F V   +       R  GK+ ELALGY G   A   M +   GL         
Sbjct: 415 CASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEE------ 468

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                + +   WR  +  +   W E+ +
Sbjct: 469 -----------------------------------ELQPLVNQWRSANPHIVAFWWEIDK 493

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTT--- 583
             +Q  E  +       + +  + +      L + LPSGR L Y       +        
Sbjct: 494 VAKQVYETREP------KKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKPGLT 547

Query: 584 ------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
                 +++ TR  TYG KL ENIVQ ++RD+LA GM+   + G  IVL VHDE V E  
Sbjct: 548 YEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVVEVR 607

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +    + + +  L+ + P WA+GLPL+A+GY  + Y+K
Sbjct: 608 E---ESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|227530261|ref|ZP_03960310.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
 gi|227349815|gb|EEJ40106.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
          Length = 644

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 202/697 (28%), Positives = 314/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L    +  +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGSVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT     +
Sbjct: 181 LECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELTGLA--N 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LK WL  +  +    L++ +  ++L +    T    QV   R   S+S++ K  
Sbjct: 239 PNSPLQLKDWLQQQ-DIKTNSLSKASVAQLLQT---TTGTVHQVLALRQLLSKSSIKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    E  + +     +P  
Sbjct: 295 AMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                    ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   ED+Y
Sbjct: 355 AMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ F V   +     + R  GK+ ELALGY G   A + M +T             
Sbjct: 415 CASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGAT------------- 461

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                                 + + WR     + + W ++ +A
Sbjct: 462 ---------------------------NLGLTDDELPPLVQMWRNASPHIVQFWWDVDKA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR-------S 578
            ++ I+          +             + L L SGR L Y    +G NR        
Sbjct: 495 AKECIKTHLPQTTHGMK------FIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESITF 548

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
             N T ++  R  TYG KL ENIVQA SRD+LAE M         +V+ +HDE V + P 
Sbjct: 549 MGNNTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENTVVMHIHDEAVIDAPS 608

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +   +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 609 N--RSLDTMVQLMTEVPDWANGLILNAAGFVSDFYKK 643


>gi|167746061|ref|ZP_02418188.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
 gi|167654576|gb|EDR98705.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
          Length = 663

 Score =  511 bits (1315), Expect = e-142,   Method: Composition-based stats.
 Identities = 190/715 (26%), Positives = 314/715 (43%), Gaps = 96/715 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + T+ ID ET S +DL KCG+ KY  ++   ++LF +  D   V + D      +P  + 
Sbjct: 4   IKTISIDIETYSDVDLQKCGVYKYVQSDSFEILLFGYSVDGGEVSVVDLKQGEKIPMEII 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACF------------------NLDIPIHRWICTLVLA 100
            AL + ++T  A N+ FER  L                         +    W C++V +
Sbjct: 64  MALTDENITKWAFNANFERVCLSEYLRRFYPKKFVSYSIPEDSVGNYLDPSSWKCSMVWS 123

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRL 156
              GLP  L   G  L L  QK+ EGKELI  FC   K         RN P H    W +
Sbjct: 124 AYMGLPLLLAGAGAVLGLEEQKLTEGKELIRYFCVPCKPTKVNGGRTRNLPQHDMIKWEM 183

Query: 157 FGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE 214
           F +Y K DV V   I  +L   P+ +   E ++LDQ INDRG  +D+ +        +  
Sbjct: 184 FKKYNKRDVEVEMSIQDKLRHFPVPNFVWEEYHLDQEINDRGITLDMDVVTNAIAFDEKS 243

Query: 215 RTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI 274
           +  L  +++ +T   + +   ++++K WL    GL ++ L +     VL++  +      
Sbjct: 244 KAVLADKMQEMTG--LENPNSVQQMKQWLSC-NGLEMDSLGKKEVAAVLNTAPEP---LK 297

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
            V   R + ++S+V K   +  A+ SDGR RG   F GA+R+GRW+G +   QNLP+   
Sbjct: 298 TVLTLRQQLAKSSVKKYQAMANAVCSDGRARGMFMFYGANRSGRWAGRLIQLQNLPQNHM 357

Query: 335 SHEELDQIITHLPTSIT---SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAW 391
           S  E  + +              D    +S  +R+  +  +G + +V+D + IEARVL+ 
Sbjct: 358 SDLEEARSLVKQGNYEAMNMLYDDVPDTLSQLIRTAFVPRKGMEFIVSDFSAIEARVLSH 417

Query: 392 MAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQ 449
           +AGE+W+   F +G D+Y  + ++ F V   +       R  GK+ ELALGY G   A +
Sbjct: 418 LAGEKWRTDVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALK 477

Query: 450 KMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
            M +                                        ++        + +   
Sbjct: 478 SMGA----------------------------------------LDMGLEEDELKPLVDM 497

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR+ +  + +LW ++ +A ++ ++  +         +  +        L + LPSGR L 
Sbjct: 498 WREANPNIVKLWWDVDRAVKKAVKQREP------SSIGSITFSYKSGMLFIGLPSGRCLS 551

Query: 570 YRDVG--------NNRSYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
           Y             + +Y     T++  R  +YG K  ENIVQA+SRDIL   +   +  
Sbjct: 552 YVKPKMGINQFGSESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILMYAIRTLSH- 610

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              I   VHDE++ E   +   +  ++   M   P W +G+ L+A+GYE++ Y+K
Sbjct: 611 -CFICGHVHDELIIECSKS--VSLDVICEQMGRTPPWIEGILLRADGYETEFYKK 662


>gi|304436359|ref|ZP_07396335.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370628|gb|EFM24277.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 641

 Score =  510 bits (1314), Expect = e-142,   Method: Composition-based stats.
 Identities = 199/704 (28%), Positives = 304/704 (43%), Gaps = 93/704 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L +D ETRS +D+ + G+ +Y  AED  ++LF +  D   V++ D V    +PQ + 
Sbjct: 1   MKSLSVDLETRSSVDIGQSGVYRYTEAEDFAILLFGYSVDGGAVQVIDLVRGERIPQEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-----------NLDIPIHRWICTLVLARSNGLPS 107
           +AL +  V   A N+ FER  L                  +    W CT+V +   GLP 
Sbjct: 61  DALADDSVIKWAFNANFERVCLSRYLSDLGMLHTTERAHFLSPRSWRCTMVWSAYMGLPL 120

Query: 108 ALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTV 167
           +L  V   L L  QKM EGK LI  F     HE           E W LF  Y + DV V
Sbjct: 121 SLAVVARVLGLEEQKMTEGKALIRYFSTPPFHEPTG--------EKWELFKSYNRRDVEV 172

Query: 168 TREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESL 225
              I +R    P+     E + LDQ INDRG C+D+       +I    + K+   L++L
Sbjct: 173 EMAIQQRLFKYPVPQSVWEEYVLDQEINDRGICLDMPFVENAVKIDAHTKEKMTDRLKTL 232

Query: 226 TYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASR 285
           T   + +   + ++K WL  + G+  E L + T   +L++         +V   R + ++
Sbjct: 233 TG--LENPNSVAQMKAWLKEQ-GVETESLDKKTVAALLTNVSA---LLKEVLELRQQLAK 286

Query: 286 SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           S+V K   +   + +D R RG  QF GA+RTGR+SG     QNLP+   ++ E  + +  
Sbjct: 287 SSVKKYQAMQNTVCADNRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLANLEYARSLVR 346

Query: 346 LP---TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
                           ++S  +R+  I  EG+K +VAD + IEARVL+W+A E+W++  F
Sbjct: 347 QGNFAALELLYESVSDVLSQLIRTAFIPKEGRKFIVADFSAIEARVLSWLAKERWRMDVF 406

Query: 403 ETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
               D+Y  T  R F+    +       R  GK  ELA GY G   A +           
Sbjct: 407 ANDGDIYCATAGRMFHCNVVKHGENGHLRQKGKQAELACGYGGSVGALKAFG-------- 458

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E        + +  AWR  +  + + 
Sbjct: 459 --------------------------------ALESGMKEDELKPLVDAWRTANPNIVDF 486

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRS 578
           W  + +A +  I+               +        + + LPSGR L Y    +G N+ 
Sbjct: 487 WWAVDRAAKDCIKERSITGTHG------IKFIYQSGMMFIELPSGRRLAYVKPRIGENQF 540

Query: 579 YLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
              + T       ++  R  +YG KL ENI QA+SRD+L   M         IV  VHDE
Sbjct: 541 GGESITYMGLDLSKKWARIESYGPKLVENITQAISRDLLCYAMQTLRSMD--IVAHVHDE 598

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++ E    +  + S     M   P WA+GL L+A+G+E + Y+K
Sbjct: 599 LIIEC--DERVSLSSACEQMARTPLWAEGLLLRADGFECQFYQK 640


>gi|313896425|ref|ZP_07829976.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974849|gb|EFR40313.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 650

 Score =  510 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 205/713 (28%), Positives = 311/713 (43%), Gaps = 102/713 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L ID ETRS +D+ K G+ +YAE  D  ++LF +  D   V++ D  +   +PQ + 
Sbjct: 1   MESLSIDLETRSSVDIGKSGVYRYAEAEDFAILLFGYSVDGGAVQVIDIANGEQIPQEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC---FNLDIP-----------------IHRWICTLV 98
           +AL +  V   A N+ FER  L        + +                   H W CT+V
Sbjct: 61  DALTDESVIKWAFNANFERVCLSRYLSDLGIALDPFHDNHPLSTECARFLSPHSWRCTMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFG 158
            +   GLP +L  VG  L L  QKM EGK LI  F     HE    +        W LF 
Sbjct: 121 WSAYMGLPLSLAGVGRVLGLEEQKMNEGKALIRYFSTPPFHEPTGAK--------WDLFK 172

Query: 159 EYCKGDVTVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT 216
            Y + DV V   I KR    P+     E + LDQ INDRG  +D+ L     QI    + 
Sbjct: 173 SYNRRDVEVEMAIQKRLSKYPVPQSVWEEYVLDQEINDRGIRLDMPLVENAVQIDVRTKE 232

Query: 217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQV 276
           KL   L++LT   + +   + ++K WL  + G+  E L +   + V +    +     +V
Sbjct: 233 KLTDRLKTLT--SLENPNSVTQMKAWLKEQ-GVETESLDK---KSVTALLANVPDPLKEV 286

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R + ++S+V K   +   + SDGR RG  QF GA+RTGR+SG     QNLP+   + 
Sbjct: 287 LELRQQLAKSSVKKYQAMQNTVCSDGRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLAD 346

Query: 337 EELDQIITHLP---TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
            E  + +                  ++S  +R+  I+ EG+K +VAD + IEARVL+W+A
Sbjct: 347 LEYARSLVRQGSFAALELLYESVPDVLSQLIRTAFISKEGRKFIVADFSAIEARVLSWLA 406

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKM 451
            E+W++  F    D+Y  T  R F+    +       R  GK+ EL+ GY G   A +  
Sbjct: 407 KERWRMDVFANDGDIYCATAGRMFHCNVVKHGENGHLRQYGKLAELSSGYGGSVGALKAF 466

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                                                    A+E          +  AWR
Sbjct: 467 G----------------------------------------ALESGMKEEELNPLVDAWR 486

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY- 570
             +  + + W  + +A +  I+     +    R           + + + LP GR L Y 
Sbjct: 487 AANPNIVDFWWAVDRATKDCIKERSTKVTHGIR------FIYQGSMMFIELPCGRRLAYV 540

Query: 571 -RDVGNNR------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G N+      +Y+    +++  R  +YG KL EN+ QA+SRDIL   M        
Sbjct: 541 KPRIGENQFGGESVTYMGLNLSKKWARIESYGPKLVENVTQAISRDILCYAMQTLRTMD- 599

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV  VHDE++ E    +  + S +   M   P WA GLPL+A+G+E + Y+K
Sbjct: 600 -IVAHVHDELIIEC--DERVSLSAICEQMARTPPWADGLPLRADGFECQFYQK 649


>gi|150391701|ref|YP_001321750.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
 gi|149951563|gb|ABR50091.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
          Length = 649

 Score =  510 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 208/701 (29%), Positives = 314/701 (44%), Gaps = 82/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + TL  D ET S ++L KCG+ +Y  A+D  ++LFA+  D   V++ D      +P ++ 
Sbjct: 4   IKTLHCDIETYSSVNLAKCGVYRYVQADDFEILLFAYSTDGSEVKIIDLARGEKIPPLIL 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+  V   AHN+ FER              I    W CT+  A   GLP +L  VG 
Sbjct: 64  SALEDDKVIKYAHNASFERICFSRFLGYPVGKYISPESWRCTMTWAAYMGLPLSLVGVGA 123

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTRE 170
            L L  QKM EGK+LI  FC             RN P +  E W  F  Y   DV    E
Sbjct: 124 VLGLGKQKMTEGKDLIRFFCGPCSPTKTNGNRTRNLPSDDPEKWERFKSYNIRDVEAEME 183

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++L   P+     + ++L + IND G  VD+        + ++  TKL  +++ +T  
Sbjct: 184 IEQKLIKFPVPDFIWDEYHLSERINDSGIKVDMDFVKQAIAMNEISHTKLMDQMQEIT-- 241

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL    GL  + L +     +L   K       +V   R + ++S+V
Sbjct: 242 ELDNPNSVQQMKDWLSD-NGLETDTLGKKAVAELL---KDAPEHLAEVLKLRQQLAKSSV 297

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH--- 345
            K   +  A+ SDGR+RG   FLGA+RTGR+S  +   QNLP+      +  + I     
Sbjct: 298 KKYTAMENAVCSDGRIRGMFTFLGANRTGRFSSKIVQLQNLPQNHMMDLKEARSIVKNGD 357

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    D    +S  +R+  +  EG K +VAD + IEARVL+W+AGEQW+ + F  G
Sbjct: 358 SEALELLYEDIPDTLSQLIRTAFVPKEGNKFIVADFSAIEARVLSWLAGEQWRNEVFANG 417

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F V   +       R  GK+ ELALGY G   A + M            
Sbjct: 418 GDIYCASASQMFRVPVEKHGVNAHLRQKGKIAELALGYGGSVGALKAMG----------- 466

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A+E        + +  AWR  +  + + W +
Sbjct: 467 -----------------------------ALEMGLEEEELKPLVNAWRASNPNIVKFWWD 497

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN 581
           + +  ++ I+  K+       +V  +        L ++LPSGR L Y   ++G N     
Sbjct: 498 VDREVKKCIKEKKSQ------EVQNIKFHYMSGMLFIVLPSGRKLAYVKPNIGENIFGGE 551

Query: 582 T-------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           +        T++  R  +YG K  ENIVQA+SRDIL   M   +     IV  VHDE++ 
Sbjct: 552 SVTYEGVGATKKWERIESYGPKFVENIVQAISRDILMYAMKTLS--TCSIVAHVHDEVII 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       +  M+   M   P WAKGL L A+GYE   Y+K
Sbjct: 610 EA--DQSLSLDMVCKQMGRVPPWAKGLLLDADGYECDFYKK 648


>gi|297585291|ref|YP_003701071.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297143748|gb|ADI00506.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 655

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 215/698 (30%), Positives = 324/698 (46%), Gaps = 77/698 (11%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
            L ID ET S +DL + G+  YAE     ++L A+ FDD  V + D V D  +P  + +A
Sbjct: 9   VLSIDIETFSNVDLKESGVYAYAEGEGFTILLLAYAFDDEEVIVVDLVQDEPIPTTVLKA 68

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  +   A+N+ FERT L A  N  +P  +W C+ V A + GLP  L  V   L L  
Sbjct: 69  LIDPSIMKTAYNANFERTCLAAYLNQPMPTEQWHCSSVHALTLGLPGHLDGVANVLNLGD 128

Query: 121 QKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR-- 174
           QK   GK LI  F   CK         RN P H  E W  +  YC+ DV V R + KR  
Sbjct: 129 QKDNAGKALIRYFSVPCKPTASNGHRTRNLPEHDLEKWHAYKAYCRQDVEVERALRKRLA 188

Query: 175 LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P+  KEQ LW LDQ +ND G  +D  L     Q+   E+  L +E + +T   + +  
Sbjct: 189 SNPIPEKEQRLWELDQRMNDEGVRIDTDLVRQAIQLDAKEQALLLEEAKQITG--LENPN 246

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
            + +L+ WL    G+    L +     +L +   L     +V   R   S+++V K   +
Sbjct: 247 SVAQLRDWLTSR-GIETSGLAKKQVSDLLQT--DLPGDVRRVLILRQMMSKTSVKKYEAM 303

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS-- 352
             ++  DG +RG LQF GA+RTGRW+G +    NLP+      +  + +           
Sbjct: 304 DRSICKDGHIRGLLQFYGANRTGRWAGRIVQAHNLPKHRIGDLDEARQLVKTGNYELITT 363

Query: 353 -DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
                  ++S   R+  I  +G + VV+D + IEARV+AW+AGE+W++K FE    +Y  
Sbjct: 364 LYGSLADLLSQLTRTAFIPKKGYRFVVSDFSAIEARVIAWLAGERWRMKVFEGHGKIYEA 423

Query: 412 TYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKT 468
           + ++ F V   ++TK    R  GK+ ELALGY G   A  +M +   GL+ +        
Sbjct: 424 SASQMFGVPIEEITKASPLRQKGKIAELALGYGGAKGALTQMGALEMGLSEDELPA---- 479

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
                                                + KAWR+ +  +  LW +L ++ 
Sbjct: 480 -------------------------------------LVKAWRKANPNIVNLWYDLEKSA 502

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---------GNNRSY 579
            + ++  K + A+       +        L   LPSGRSL Y                +Y
Sbjct: 503 FEAVKWQKVVTAK-----SGIQFYGGSGLLRARLPSGRSLSYVRPQIGIDERFGREEITY 557

Query: 580 LN--TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
                 ++Q  R  TYGGK+ EN+VQA++RD LAE M+    AGY I   VHDE+V E P
Sbjct: 558 EGVMQGSKQWGRISTYGGKIAENMVQAIARDCLAEAMLRLDAAGYQIRFHVHDEVVIEVP 617

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             ++   + +  +M+    WA GLP+ A+ +E+  Y+K
Sbjct: 618 -NEQDAKADIERIMSEPIDWAPGLPMNADSFETGYYKK 654


>gi|331085755|ref|ZP_08334838.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406678|gb|EGG86183.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 646

 Score =  508 bits (1309), Expect = e-141,   Method: Composition-based stats.
 Identities = 219/696 (31%), Positives = 320/696 (45%), Gaps = 75/696 (10%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
            TL ID ET S +DL  CG+ KY+      ++L A+  DD      D  +    P+   E
Sbjct: 3   RTLAIDIETYSDVDLISCGVYKYSSSPHFEILLIAYSVDDEETVCIDVANGEEPPKEFIE 62

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
            L +  VT  A N+ FERT     ++       W CT V A    LP +L+ VG  L L 
Sbjct: 63  MLFDDTVTKTAFNANFERTCFSNYYHHSFRPEAWRCTAVQATMLALPLSLEGVGAVLGLD 122

Query: 120 SQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKRL 175
            QKM EGKELI  F   CK         RN P    E WR F  YC  DV V ++I +RL
Sbjct: 123 KQKMTEGKELIKYFCSPCKATKSNGGRTRNLPKDAPEKWRWFKTYCIRDVDVEKQIRQRL 182

Query: 176 E--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
              P+  +EQE++ LDQ INDRG  VD  L +       + +         LT   + + 
Sbjct: 183 AKFPIPKREQEIYCLDQRINDRGIMVDRNLVNHAVACDLLYKETATARAYELTG--LENP 240

Query: 234 RCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT 293
             + +LK WL  + GL ++ L + T + +    +       +V   R+  S+++V K   
Sbjct: 241 NSVSQLKLWLKEK-GLEVDSLAKDTVKDLSMKAEGD---VQEVLKLRLATSKTSVKKYEA 296

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---SI 350
           +  ++ ++ R+ G LQF GA+RTGRW+G +    NLP+      EL + +          
Sbjct: 297 IDRSVCAENRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHLPDLELARALVSEGRYEEVE 356

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
                   ++S+ +R+  +A  G + +++D + IEARVLAW+AGE+W+L+ FET   +Y 
Sbjct: 357 LFYESTPNVLSELIRTAFVAKPGCRFIISDYSAIEARVLAWLAGEEWRLQVFETHGKIYE 416

Query: 411 TTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
            + +  F+VA  ++TK    R  GK+ ELALGY G   A   M                 
Sbjct: 417 ASASAMFHVAIEEITKTSPLRQKGKISELALGYGGAVGALTSMG---------------- 460

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
                                   A++          +   WR  +  ++  W  + +A 
Sbjct: 461 ------------------------ALKMGLTEEELPGLVSTWRSANPHITAFWWAVDEAA 496

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GNNRSYL 580
              + + K     +      V  +     L + LPSGR L Y               +Y 
Sbjct: 497 VTAVRDKKPSKVGR------VSFEYKSGILFVTLPSGRKLSYVKPRMMLNKFGREGLTYE 550

Query: 581 N-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               +++  R  TYG KL ENIVQA SRDILAE M+   K G+DIV  VHDE+V E PD 
Sbjct: 551 GIGESKKWMRLETYGPKLVENIVQAASRDILAEAMLRLEKEGFDIVCHVHDEVVLEVPDG 610

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + +   +  +M  NP W +GLPLKA G+ES  Y+K
Sbjct: 611 -KSSVEEVNEIMAVNPVWTEGLPLKAAGFESPFYKK 645


>gi|304389855|ref|ZP_07371814.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304327031|gb|EFL94270.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 655

 Score =  507 bits (1306), Expect = e-141,   Method: Composition-based stats.
 Identities = 226/706 (32%), Positives = 317/706 (44%), Gaps = 83/706 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D E+ SP  L K G+  YAE  D  ++LF +  D  PV++ D      MP  + 
Sbjct: 1   MRTLFCDIESFSPAQLAKTGVYLYAEHPDFDLLLFGYSIDGGPVKVVDLAGGQSMPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD---------IPIHRWICTLVLARSNGLPSAL 109
            AL ++ V   AHN+ FER  L A              +   +W CT++ +   GLP +L
Sbjct: 61  AALVDSSVVKWAHNAAFERVCLSAWLRAHHSELLGEGFLDPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGE---THECLYDRNKPN-HREAWRLFGEYCKGDV 165
            AV   LKL  QK   GK+LI +FC             RN P+     W  F +Y + DV
Sbjct: 121 DAVAAVLKLDVQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRRDV 180

Query: 166 TVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  R    P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVELAIHDRLAFFPMPEAEWDTYALDQCINDAGILLDHTLVDNAVAVDEHHRNASLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT   + +     +LK WL    G  LE L +     V ++    T    +V   R   
Sbjct: 241 KLTG--LDNLNSPIQLKQWLVTR-GCELESLAK---AEVDAALDTATGVVKEVLELRGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     +DGR RG +QF GA RTGR++G +   QNLPR      +  + +
Sbjct: 295 AKSSVKKYQAMHNVAGADGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARSL 354

Query: 344 T---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
               +L             +S  +R+  I S G + +VAD + IEARV+AW+AGE   L 
Sbjct: 355 VQTGNLDALELLYESVPDTLSQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGETTTLA 414

Query: 401 AFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           AF  G+DLY  T +R F+V   +     + R  GK+  LA GY G   A + M       
Sbjct: 415 AFREGKDLYCETASRMFDVPVEKHGINGELRQKGKIAVLACGYGGSVGALKAMG------ 468

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A          + +  AWRQ +  + 
Sbjct: 469 ----------------------------------AFTMGLAEHELKPIVDAWRQANPHIV 494

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
           +LW ++ QA    I + + I  R  R         +   L + LPSGR L Y    +G N
Sbjct: 495 QLWADVEQAAIAAISSRQPIRLRNLR------FSVESGILFIELPSGRRLAYVQPRLGEN 548

Query: 577 R-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R           TT R+  +  TYGGKL ENIVQA++RD+L  GM    KAG+ IV+ VH
Sbjct: 549 RWGGTSITYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVVGMHAVAKAGHRIVMHVH 608

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DEIV + P   +F  +    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 609 DEIVIDEPTNLDFAVADACKLMSTLPAWAEGLPLDADGYECNYYRK 654


>gi|76786923|ref|YP_329353.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
 gi|76561980|gb|ABA44564.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
          Length = 651

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 207/705 (29%), Positives = 315/705 (44%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   +DL K G+  YAED    ++L A   D+ PV ++D      +P  + 
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLT-KENLPDQIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           +AL N  +   A N+ FER  L        P          + W C++V +   GLP +L
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSMVWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  QK++EG ++I  FC   K         RN P+H  + W  F  Y K DV
Sbjct: 122 EGVGTVLKLKEQKLKEGGDVIRYFCLPCKPTKINGGRKRNFPHHAPDKWAAFINYNKRDV 181

Query: 166 TVTREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  +L   P+     E ++ DQ INDRG  +DV        I +  ++K+ +EL+
Sbjct: 182 EVELAIKNKLRNHPVPDFLWEEYHQDQNINDRGIGIDVDFVKAAITIDEESKSKIQEELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT   + +   + ++  WL    G+    L +   + +L      T    +V   R +A
Sbjct: 242 ELTG--LENPNSVLQMIGWLREH-GVTTNSLDKKAVKELLKVVDAKT---TKVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +V  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +  + +
Sbjct: 296 AKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLKEARDL 355

Query: 344 THLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   +D        +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+   
Sbjct: 356 FKTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSMV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +     D R  GK+ ELA GY G   A + M +      
Sbjct: 416 FEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMGAI----- 470

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                              +        + +  +WRQ +  +  
Sbjct: 471 -----------------------------------DMGLDEQELQPLVDSWRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV------ 573
            W ++ +A +  I+  K            +  K  K  L + LPSGR L Y         
Sbjct: 496 FWWDVDKAVKTAIKYQKQTETHG------IQFKVRKGMLFITLPSGRKLAYVKPKMGENQ 549

Query: 574 --GNNRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
             G + +Y  T T ++  R  +YG K  ENI+QA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQL--KDFRIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           EI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|315656936|ref|ZP_07909823.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
 gi|315492891|gb|EFU82495.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
          Length = 655

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 227/706 (32%), Positives = 319/706 (45%), Gaps = 83/706 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D ET SP+ L K G+  Y E  D  ++LF++  D  PVE+ D  +   MP  + 
Sbjct: 1   MRTLFCDIETFSPVQLAKAGVYPYCEHPDFDLLLFSYSVDGGPVEIVDLANGQSMPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD---------IPIHRWICTLVLARSNGLPSAL 109
            AL + DV   AHN+ FER  L A  +           +   +W CT+V +   GLP +L
Sbjct: 61  AALVDPDVVKWAHNAAFERVCLSAWLHRHHSELLGDGFLDPRQWRCTMVWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGE---THECLYDRNKP-NHREAWRLFGEYCKGDV 165
            A+   LKL  QK   G++LI +FC             RN P      W  F +Y + DV
Sbjct: 121 DAIAAVLKLDVQKDSAGRKLIKQFCTPATPSVLNGGKHRNPPSADPTGWAHFIDYNRRDV 180

Query: 166 TVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V + I  R    P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVEQAIHDRLACFPMPESEWDTYALDQRINDAGILLDHTLVDNAVAVDEHHRNASLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT   + +     +LK WL    G  LE L +     V S+    T    +V   R   
Sbjct: 241 KLTG--LDNPNSPIQLKQWLATR-GCELESLAK---AEVDSALDTATGAVKEVLELRGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     SDGR RG +QF GA RTGR++G +   QNLPR      +  + +
Sbjct: 295 AKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARTL 354

Query: 344 T---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
               +L             +S  +R+  I S G + +VAD + IEARV+AW+AGE   L+
Sbjct: 355 VRTGNLDALELLYESVPDTLSQLIRTAFIPSTGHRFIVADFSAIEARVIAWLAGETSTLE 414

Query: 401 AFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           AF  G+DLY  T +R F V   +     + R  GK+  LA GY G   A + M       
Sbjct: 415 AFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKIAVLACGYGGSVGALKAMG------ 468

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A+         + +  AWRQ +  + 
Sbjct: 469 ----------------------------------ALNMGLAEHELKPIVDAWRQANPHIV 494

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
            LW ++ +A    I + + I  R  R         +     + LPSGR L Y    +G N
Sbjct: 495 GLWADVEEAAIAAISSRQPIRLRNLR------FSVESGIFFIELPSGRRLAYVQPRLGEN 548

Query: 577 R-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R           TT R+  +  TYGGKL ENIVQA++RD+L  GM    KAG+ IV+ VH
Sbjct: 549 RWGGTSVTYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVTGMHAVAKAGHQIVMHVH 608

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DEIV + P+   F  +    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 609 DEIVIDEPENSGFTVTDACALMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|212712317|ref|ZP_03320445.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
 gi|212685063|gb|EEB44591.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
          Length = 685

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 262/693 (37%), Positives = 378/693 (54%), Gaps = 27/693 (3%)

Query: 1   MA-TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
           M  TL++D ET S   + K G   YAE V ++LFA+  +++ V++WD      +P  LK+
Sbjct: 1   MKNTLWLDLETFSEKPI-KYGTHSYAETVEIMLFAWALNNNLVQVWDVTDKSPIPTELKQ 59

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK-- 117
           AL + +  I AHNS+F+RT+L     + I + RW  T+V A ++GLP AL A+ E L   
Sbjct: 60  ALSDPNTIIYAHNSHFDRTML-NHSGIKIDVSRWRDTMVQALAHGLPGALGALCEVLGVP 118

Query: 118 LSSQKMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLE 176
           L   K +EGK LI  FCK         R     H E W+ F  Y   D+   RE+ KRL 
Sbjct: 119 LDKAKDKEGKALIQLFCKPRPKNSALRRATSKTHPEEWKRFVAYAGLDIEAMREVHKRLP 178

Query: 177 PLSSKE--QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             +  +   E W+ DQ INDRG  +D+ LA    + V++E+ +L +  + LT   V ++ 
Sbjct: 179 SWNYCDNELEHWHRDQRINDRGVYMDIQLATAAIEAVEIEQKRLAKLTQDLTDNEVQAAT 238

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
             + L   +    G+ L D+ ++T +R ++      P   ++   R+++S ++  K   L
Sbjct: 239 QRDALLQHISAAFGVDLPDMQKSTLERRINDPDIPLPL-RELLAIRLQSSTTSTSKYKAL 297

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS-- 352
           +  ++SDGRLRGTLQF GASRTGRW+G +F PQNLPRP+     +D+ I  L        
Sbjct: 298 MNGVSSDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPTLDQNTIDKGIEALKAGCADLI 357

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE-----D 407
             D +Q+ S  +R C++A EGKKLVV+DL+ IE R+LAW+AGE WK+ AF   +     D
Sbjct: 358 YDDIMQLTSSTLRGCIMAPEGKKLVVSDLSNIEGRMLAWLAGEAWKITAFSEFDKGIGAD 417

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           LY   YAR+FN++P  V K  R IGKVMEL LGY GG  AF   A T  L+L+  A    
Sbjct: 418 LYKLAYARAFNISPEDVDKHMRQIGKVMELGLGYGGGVAAFLTFALTYSLDLDELAEAAL 477

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
            N  P+   DA ++ +   E    + + +    T C+ +K+ WR  H      W EL   
Sbjct: 478 PNIPPKVKHDALSWYQKSVETKKTYGLSETVFIT-CDSLKRMWRNAHPETVSFWYELEDT 536

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS-----YLNT 582
               I +       ++     + +++DK  L ++LPSGR++ Y    N+        +N 
Sbjct: 537 VRHAISSPGITFPCRK-----LKVRRDKAWLRIVLPSGRAVCYPSPRNDNGQISYMGVNP 591

Query: 583 TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEF 642
            +R+  R  TYGGKL EN+ QA +RD+LA  M      GYDIVLTVHDE++ E PD   F
Sbjct: 592 YSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPTIEDHGYDIVLTVHDEVLTEAPDNPAF 651

Query: 643 NASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           N   L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 652 NHEHLSELLATNPEWALDLPLSAGGFEAYHYRK 684


>gi|297583086|ref|YP_003698866.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297141543|gb|ADH98300.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 644

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 209/697 (29%), Positives = 316/697 (45%), Gaps = 76/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID E+ S  DL K G+ +YAE  D  ++LFA+  D  PV + D      +P V++
Sbjct: 1   MKTLNIDIESYSRTDLAKSGVYRYAEAPDFDILLFAYSVDAGPVHVVDLAQGETIPDVVR 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL +  V   A N+ FERT L    N  I    W C++V +   GLP +L+        
Sbjct: 61  QALTDDGVIKWAFNAQFERTCLSRYLNTPIHPTSWRCSMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SSQKMEEGKELIARFCKGET---HECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             +K++EGK+LI  FCK           +RN P+H  E W  F  Y + DV   + I  +
Sbjct: 121 DKKKLQEGKDLIRYFCKPCKPTQVNGGRERNFPHHDPEKWVAFKRYNQRDVETEQAIQDK 180

Query: 175 --LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+  +E   + LDQ INDRG  +D              R  L   L +LT   + +
Sbjct: 181 ISRYPVPEQEWGHYVLDQIINDRGILLDPVFVEAAIACDTATREALMNRLRTLT--KLEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + ++K WL  + G+    L +     +L S +       +V   R + ++S+V K  
Sbjct: 239 PNSVMQMKDWLAEQ-GVETGALDKAAVHELLKSAQGD---VAEVLTIRQKLAKSSVKKYT 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLPTS 349
            + +    D R RG +QF GA+R+GR++G +   QNLP+      +  + +    +L   
Sbjct: 295 AMKQVAGKDDRARGLIQFYGANRSGRYAGRLIQVQNLPQNHVPDLKEARDLVRASNLEAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
               P    ++S+ +R+  I  E  + +VAD + IEARV+AW+AGE W+ + F T   +Y
Sbjct: 355 DMLYPSVPDLLSELIRTAFIPKEHHQFIVADFSAIEARVIAWLAGEAWRNEVFATHGKIY 414

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + ++ FNV   ++ K    R  GK+ ELALGY G   A + M                
Sbjct: 415 EASASQMFNVPLEEIDKGSPLRQKGKISELALGYGGSVGALRAMG--------------- 459

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A++        + + +AWRQ + ++ + W  + QA
Sbjct: 460 -------------------------ALDMGVEEEELKPLVQAWRQANPKIVQFWWAVDQA 494

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLN---- 581
            ++ ++               +        L++ LPSGR L Y    +  N         
Sbjct: 495 AQKAVKQRTTTSTHG------ISFTYQSGLLLVGLPSGRHLSYVKPTIVLNDFGREGLCF 548

Query: 582 ---TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
                T++  R  TYG KL ENIVQAVSRD+LA  M    + GY IV+ VHDE+V E   
Sbjct: 549 EGIGATKKWERIDTYGPKLVENIVQAVSRDLLAHAMQRIEQEGYAIVMHVHDEVVVEA-- 606

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 S +  LMT  P W+ GL LKAEGY    Y+K
Sbjct: 607 KQHVTVSDICALMTDQPDWSSGLNLKAEGYACMFYQK 643


>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039804|gb|ACT56600.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120698|gb|ADV02521.1| DNA polymerase A [Liberibacter phage SC1]
 gi|317120741|gb|ADV02563.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120802|gb|ADV02623.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120842|gb|ADV02663.1| DNA polymerase A [Liberibacter phage SC1]
          Length = 675

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 402/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|255957611|dbj|BAH96662.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957616|dbj|BAH96666.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957626|dbj|BAH96674.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957641|dbj|BAH96686.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957661|dbj|BAH96702.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957666|dbj|BAH96706.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957671|dbj|BAH96710.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957676|dbj|BAH96714.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957686|dbj|BAH96722.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 402/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|153581904|emb|CAM34262.1| phage polymerase [Streptococcus pyogenes]
 gi|262113717|emb|CAR95384.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 651

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 208/705 (29%), Positives = 326/705 (46%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D  +   +PQ + 
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYD-FNKEKLPQDIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           EAL +  V   A N+ FER  L        P          + W C+++ +   GLP +L
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  +KM EG +LI  FC   K         RN P+H  + W  F +Y + DV
Sbjct: 122 EGVGTVLKLKDKKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPDKWSAFIDYNRRDV 181

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I +RL+  P+     + ++ DQ INDRG  +DV       +I    + K+ +EL+
Sbjct: 182 EVELAIKERLKNFPVPDFVWDEYHQDQIINDRGLGIDVDFVKAAIKIDRESKAKIQEELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT   + +   + ++  WL    G+  + L +   + +L +  + T    QV   R +A
Sbjct: 242 ALTG--LENPNSVLQMIGWLREH-GVTTDSLDKKAVKGLLKTVDETT---AQVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      E  + +
Sbjct: 296 AKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLEEAREL 355

Query: 344 THLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   ++   D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K 
Sbjct: 356 FGTGDLEATELIYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +     + R  GK+ ELA GY G   A + M        
Sbjct: 416 FEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMG------- 468

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A++        + +  +WR  +  +  
Sbjct: 469 ---------------------------------ALDMGLTEEELQPLVNSWRLANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++  A +  ++               +  +  +  L + LPSGR L Y    +G+N+
Sbjct: 496 YWWDVDNAVKTAVKELIPTSTHG------IQFEVKRGILFITLPSGRKLAYIKPRIGDNQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQL--KNFKIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EVIIECPIEQ--KLDEVASLMGIAPDWLSDINLRADGYECFFYQK 650


>gi|260579057|ref|ZP_05846956.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
 gi|258602808|gb|EEW16086.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
          Length = 653

 Score =  505 bits (1300), Expect = e-140,   Method: Composition-based stats.
 Identities = 217/707 (30%), Positives = 310/707 (43%), Gaps = 87/707 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET SP++L   G+  YA+     ++LF +  D  PVE+ D  +   +P+ + 
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----------IPIHRWICTLVLARSNGLPSA 108
            AL +  V   A N+ FER  L +               +   +W CT+V +   GLP +
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGE---THECLYDRNKPN-HREAWRLFGEYCKGD 164
           L  V   L L  +K   GK+LI +FC             RN P    + W  F  Y + D
Sbjct: 121 LDQVATVLHLPVRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   PL + E + + LDQ +ND G  +D  L           R       
Sbjct: 181 VEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT   + +     +LK WL    G  L+ LT+     V ++    T Q  +V   R  
Sbjct: 241 QELTG--LENPNSPIQLKDWL-AAHGAPLQSLTKD---EVAAALDTATGQVREVLLLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
            ++S+V K   +      DGR RG LQF GA RTGR++G +   QNLPR         + 
Sbjct: 295 LAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLAEARS 354

Query: 343 IT---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           +                   +S  +R+  I ++G + VVAD + IEARV+AW+AGE   L
Sbjct: 355 LVRTGDFEAVELLYDSVPDTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAGETTTL 414

Query: 400 KAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           +AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M      
Sbjct: 415 EAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG----- 469

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                              A+      +  + +  AWR  +  V
Sbjct: 470 -----------------------------------ALRMGLAESELQPLVDAWRAANPSV 494

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGN 575
            +LW +++ A  +TI   +            +    +   + + LPSGR L Y    +G 
Sbjct: 495 VQLWADINAAAIETISTRQPTSVG------ALTFTVESGIMFIRLPSGRRLAYVKPKLGE 548

Query: 576 NRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
           NR    + T       R+  +  TYGGKLTENIVQAV+RD+L   M    +AG+ IV+ V
Sbjct: 549 NRFGGTSITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTYAMHQVAEAGHRIVMHV 608

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDEIV ET          +  LM++ P WA GLPL+A+GY    Y K
Sbjct: 609 HDEIVVET---ATATVDEICKLMSTAPDWAAGLPLEADGYACDFYMK 652


>gi|255957621|dbj|BAH96670.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  505 bits (1300), Expect = e-140,   Method: Composition-based stats.
 Identities = 401/677 (59%), Positives = 483/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL E +
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSETV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|300933386|ref|ZP_07148642.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  505 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 226/707 (31%), Positives = 314/707 (44%), Gaps = 87/707 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LF+D ET SP++LTK G+  YAE  D  V+LF +  D +PV++ D      +P  + 
Sbjct: 1   MHELFVDLETFSPVNLTKSGVYPYAEHPDFDVLLFGYSIDGNPVKVVDVASSEQLPAEVV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----------IPIHRWICTLVLARSNGLPSA 108
           EAL +  VT  A N+ FER  L A               +   +W CT+V +   GLP +
Sbjct: 61  EALVDPGVTKWAFNAAFERVCLSAWLARHHPDLIAGRNFLDPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPN-HREAWRLFGEYCKGD 164
           L+ V   L L  +K   GK+LI RFC   +         RN P    + W  F  Y + D
Sbjct: 121 LEQVATVLDLPVRKDSAGKKLITRFCTPARPSVLNQGEMRNLPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   P+   E   + LDQ IND G  +D  L     Q     R       
Sbjct: 181 VEVELAIHDRLAGFPMPEAEWATYALDQNINDTGIRLDRVLVDHAVQCDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT   + +     +LK WL    G  L+ LT+     V ++    T +  +V   R  
Sbjct: 241 QELTG--LENPNSPIQLKDWLTAH-GTPLQSLTKD---EVAAALDTATGEVREVLQLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
            ++S+V K  T+      DGR RG LQF GA RTGR++G +   QNLPR         + 
Sbjct: 295 LAKSSVKKYETMQHVAGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLCEARD 354

Query: 343 ITHL---PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           +                   +S  +R+  + ++G + VVAD + IEARV+AW+AGE   L
Sbjct: 355 LVRTGEFEAVELLYDSVPDTLSQLIRTAFVPADGHRFVVADFSAIEARVIAWLAGEATTL 414

Query: 400 KAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           +AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M      
Sbjct: 415 QAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG----- 469

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                              A+      +  + +  AWR  +  V
Sbjct: 470 -----------------------------------ALRMGLAESELQPLVDAWRAANPNV 494

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGN 575
            +LW +++ A  + I   +         V  +    +   + + LPSGR L Y    +G 
Sbjct: 495 VQLWADINAAAIEAISTRQPT------GVGALTFTVESGIMFVRLPSGRRLAYVKPKLGE 548

Query: 576 NRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
           NR      T       R+  +  TYGGKLTENIVQAV+RD+L  GM    +AGY IV+ V
Sbjct: 549 NRFGGTAITHEGIATGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGYRIVMHV 608

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDEIV ET          +  LM + P WA GLPL A+GY    Y K
Sbjct: 609 HDEIVVET---ATATVDEICELMATAPDWAAGLPLAADGYACDFYMK 652


>gi|319757792|gb|ADV69734.1| phage polymerase [Streptococcus suis JS14]
          Length = 651

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/705 (29%), Positives = 323/705 (45%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   IDL K G+ +YAED    ++LFA   ++ PV ++D      +PQ + 
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFEILLFAVSVNNGPVTVYDL-SKEKLPQDIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACF---------NLDIPIHRWICTLVLARSNGLPSAL 109
           EAL +  V   A N+ FER  L             +  +    W C+++ +   GLP +L
Sbjct: 62  EALVDDRVIKWAFNASFERVCLSNWLKKYHPDLLLDRFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  QKM EG +LI  FC   K         RN P+H  + W  F +Y + DV
Sbjct: 122 EGVGTVLKLKDQKMREGADLIRYFCVPCKPTKINGGRTRNLPHHAPDQWATFIDYNRRDV 181

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I +RL+  P+     + +  DQ INDRG  +DV       +I    + ++ +EL+
Sbjct: 182 EVELAIKERLKNFPVPDFVWDEYLQDQIINDRGIGIDVDFVKAAIKIDTESKAQIQEELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT   + +   + ++  WL    G+  + L +   + +L +    T    +V   R +A
Sbjct: 242 ALT--SLENPNSVLQMIGWLREH-GVTTDSLDKKAVKELLKTVDDKT---SKVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      E  + +
Sbjct: 296 AKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLEEARKL 355

Query: 344 THLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   ++   D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K 
Sbjct: 356 FKTGDLEATELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGEKWRSKV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +       R  GK+ ELA GY G   A + M        
Sbjct: 416 FELGKDIYCMSASQMFGVPVEKHGQNSKLRQKGKIAELACGYGGSVGALKAMG------- 468

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A++        + +  +WRQ +  +  
Sbjct: 469 ---------------------------------ALDMGLSEEELQPLVNSWRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
           LW ++  A +  ++               +  +     L + LPSGR L Y    +G N+
Sbjct: 496 LWWDVDNAVKTAVKEQIPTSTHG------IQFEVRSGILFITLPSGRKLAYIKPRIGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENIVQA+SRDILA  +       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAYSLKQL--KEFKIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P   E     +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EVIIECP--MEQKIDKIASLMGIAPDWMSDINLRADGYECLFYQK 650


>gi|255957561|dbj|BAH96622.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957566|dbj|BAH96626.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957571|dbj|BAH96630.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957576|dbj|BAH96634.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957581|dbj|BAH96638.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957586|dbj|BAH96642.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957591|dbj|BAH96646.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957601|dbj|BAH96654.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957631|dbj|BAH96678.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957636|dbj|BAH96682.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957646|dbj|BAH96690.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957651|dbj|BAH96694.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957656|dbj|BAH96698.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957681|dbj|BAH96718.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 401/677 (59%), Positives = 483/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|323159211|gb|EFZ45201.1| DNA-directed DNA polymerase [Escherichia coli E128010]
          Length = 687

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 260/692 (37%), Positives = 379/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
            + +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVHDE++ E PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 655 DKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|227497454|ref|ZP_03927686.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226833079|gb|EEH65462.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 649

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 213/704 (30%), Positives = 317/704 (45%), Gaps = 85/704 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L +D ET SP +L   G+ +YAED    ++LF +  D  P ++ D      +P  + 
Sbjct: 1   MRSLSLDLETFSPTNLATAGVYRYAEDEAFRILLFGYSIDGAPAKVIDLARGEPIPPGIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           +AL +  VT  A N+ FER  + A      P            W CT+V A S GLP +L
Sbjct: 61  QALTDPTVTKSAFNASFERVCMSAYLRRHHPDLLAEGFLGPRGWRCTMVWAASLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
               +AL+L  +K   G++LI RF               +    W+ +  Y + DV V  
Sbjct: 121 DGAAKALRLPIEKDPAGQKLIRRFSIPGKD--GIRVLPSDDPVGWQQYISYNRRDVDVEV 178

Query: 170 EIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           ++  R    P+   E E ++LDQ IND G  +D  LA    ++    R       + LT 
Sbjct: 179 QLASRLARNPMLEAEWETYWLDQRINDTGVRIDTQLAAHAVEVDSRHRDTCLARAQQLTG 238

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +LK WL    G  LE LT+T  +  L +   +T    +V   R   SRS+
Sbjct: 239 --LENPNSPIQLKDWL-AAHGCELESLTKTEVEAALET---VTGDVAEVLRLRQDLSRSS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---T 344
           V K   ++    SD R RG +Q++GA RTGR++G +   QNLPR         + +    
Sbjct: 293 VKKYQAMLTVAGSDDRARGLIQYMGAGRTGRFAGRLIQVQNLPRNHMPDLASARSLLNAG 352

Query: 345 HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
           +              +S  +R+  I S+  + +VAD + IEARVLAW+AGE+  L+AF  
Sbjct: 353 NSDALELLYSPLPDTLSQLIRTAFIPSKDHRFIVADFSAIEARVLAWLAGEEGTLQAFRE 412

Query: 405 GEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNT 461
           G+DLY  T +R F V   +     + R  GK+  LA GY G   A + M +   GL+ + 
Sbjct: 413 GKDLYCQTASRMFGVPVEKHGANSELRQKGKIAVLACGYGGSVGALKAMGALRMGLDESE 472

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
                                                     + +  AWR  +  V + W
Sbjct: 473 L-----------------------------------------KPLVDAWRDANPMVVQFW 491

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSY 579
           +++ QA   T+E        +      +++      L + LPS R L Y    +G NR  
Sbjct: 492 HDIEQAAITTVETRTPTQVGR------IHLSYRSGCLFIALPSRRELCYPRPRLGENRFG 545

Query: 580 LNT--------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
           + +        TTR+     TYGGKLTEN+VQA +RD+L   M +   AG+ IV+ +HDE
Sbjct: 546 MTSILFDGVDGTTRKWGPIETYGGKLTENLVQATARDLLTHAMHHVDAAGHRIVMHIHDE 605

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV + P     +   +  LMT  P+WA GLPL A+GYE   Y K
Sbjct: 606 IVVDEPTDGA-SVEDIVTLMTRLPTWADGLPLDADGYECGFYMK 648


>gi|255957596|dbj|BAH96650.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957606|dbj|BAH96658.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 400/677 (59%), Positives = 482/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPD   F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDIPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|332522757|ref|ZP_08399009.1| DNA-directed DNA polymerase [Streptococcus porcinus str. Jelinkova
           176]
 gi|332314021|gb|EGJ27006.1| DNA-directed DNA polymerase [Streptococcus porcinus str. Jelinkova
           176]
          Length = 653

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 204/706 (28%), Positives = 321/706 (45%), Gaps = 87/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCV-HDPVMPQVL 57
           +  L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D       +PQ +
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDESFELLLFAVSVDNGPVTVYDLDLTKEKLPQDI 62

Query: 58  KEALENTDVTIVAHNSYFERTVLKACF---------NLDIPIHRWICTLVLARSNGLPSA 108
            E L +  V   A N+ FER  L             +  +    W C+++ +   GLP +
Sbjct: 63  LETLVDNSVIKWAFNASFERICLSNWLKKYHPDLLLDGFLSPVSWRCSMIWSAYLGLPLS 122

Query: 109 LKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGD 164
           L+ VG  LKL  QKM EG +LI  FC   K         RN P+H    W  F +Y + D
Sbjct: 123 LEGVGTVLKLKDQKMREGADLIRYFCLPCKPTKVNGGRIRNFPHHASNKWSTFIDYNRRD 182

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I +R++  P+ S     ++ DQ IND G  +DV       +I    + K+  EL
Sbjct: 183 VEVELAIKERVKNFPVPSFVWNEYHQDQIINDHGIGIDVDFVKAALKIDGESKAKIQAEL 242

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           ++LT   + +   + ++ +WL    G+  + L +   + +L +  + T    QV   R +
Sbjct: 243 KALTG--LENPNSVLQMISWLREH-GVATDSLDKNAVKELLKTVDETT---AQVLKLRQQ 296

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
           A++S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +  + 
Sbjct: 297 AAKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLKEARD 356

Query: 343 ITHLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
           +       +++   D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K
Sbjct: 357 LFRTGDLESTELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSK 416

Query: 401 AFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            FE G+D+Y  + ++ F V   +     + R  GK+ ELA GY G   A + M       
Sbjct: 417 VFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMG------ 470

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A++        + +  +WR  +  + 
Sbjct: 471 ----------------------------------ALDMGLSKEELQPLVNSWRLANPNIV 496

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W ++  A +  ++               +  +     L + LPSGR L Y    +G+N
Sbjct: 497 LYWWDVDNAVKTAVKELIPTSTHG------IQFEVKSGILFITLPSGRKLAYIKPRIGDN 550

Query: 577 RSYLNT-------TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           +    +       T ++  R  +YG K  ENIVQA+SRDILA  M       + IV  VH
Sbjct: 551 QFGGESVTYEGSGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQL--KDFRIVGHVH 608

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DEI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 609 DEIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECFFYQK 652


>gi|255957556|dbj|BAH96618.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 400/677 (59%), Positives = 482/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KG PLKAEGYE+KRYRK
Sbjct: 659 KGFPLKAEGYEAKRYRK 675


>gi|291283829|ref|YP_003500647.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
 gi|290763702|gb|ADD57663.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
          Length = 687

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 259/692 (37%), Positives = 380/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
            + +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQ 121

Query: 121 QKME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKNKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PHLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT--SD 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCAGLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     ++     + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYNESVKHKSTFGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPIIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 655 DKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|315121967|ref|YP_004062456.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495369|gb|ADR51968.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 673

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 398/677 (58%), Positives = 487/677 (71%), Gaps = 6/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M  LFID ETRSP  L K G+  YAE+  + L A+  +D  ++LWDC  +PVMP  L + 
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L++  V  VAHNS FER + K   N+ IP  RWICT  LAR NGLP++LK    ALK   
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG   E  YD  + NH +AW+LFGEYCK DV  TRE++KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E+ LW LDQ INDRGY +D+ L   L +++  ER KLD+EL++LT+G++ SSR  + 
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFEREKLDEELKTLTFGVIGSSRKTDL 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L  +LFL  GL L D+ E+T    LS    +T +A  + NNR+ +S+SA+LKLNTL  A+
Sbjct: 241 LNKYLFLYMGLDLPDMAESTIATALSQ-PNITQRAKDILNNRLSSSQSAILKLNTLSGAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           + D RLRGTLQF GASRTGRWSGCVF PQNLPRP+ SHE +++ I           DPL+
Sbjct: 300 SPDLRLRGTLQFYGASRTGRWSGCVFQPQNLPRPNTSHETIEEAIESSNFPS---DDPLR 356

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
             SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGEQWKL AF  GED+Y T Y+++FN
Sbjct: 357 FASDCVRSCIIASTGKKLVVADLAGIEARVLAWIAGEQWKLNAFANGEDIYKTAYSKAFN 416

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
           +  + VTKDQRAIGKVMELALGYQGGA+ FQ MAS  GL+L  F+  +K  +  ++WE A
Sbjct: 417 IPLSNVTKDQRAIGKVMELALGYQGGARVFQTMASNLGLDLKQFSKSIKQTATGDDWEQA 476

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           +  C WMQE +PE A+ D FIGTACE VK AWR KH  V +LW +  +AF+  I++G++I
Sbjct: 477 QRRCLWMQETYPEFAVHDPFIGTACELVKTAWRAKHKGVVQLWKDCEEAFDCVIKDGRSI 536

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+   VP + MKK   N+ + LPS R LVYRDV ++RSYLNT T Q+ RE TYGGKLT
Sbjct: 537 SARRVAGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLT 596

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDILA GM+NAT+AGYDIVLTVHDEIVCETPDT EF++  L  LMT NP WA
Sbjct: 597 ENIVQAISRDILACGMINATRAGYDIVLTVHDEIVCETPDTPEFSSDELCFLMTQNPKWA 656

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+ RYRK
Sbjct: 657 KGLPLKAEGYEALRYRK 673


>gi|50914501|ref|YP_060473.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|40218547|gb|AAR83201.1| phage polymerase [Streptococcus pyogenes]
 gi|50261592|gb|AAT72360.1| DNA polymerase [Streptococcus pyogenes]
 gi|50903575|gb|AAT87290.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 651

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 208/705 (29%), Positives = 322/705 (45%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   IDL K G+ +YAED    ++L A   D+ PV ++D  +   +PQ + 
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLIAVSVDNGPVTVYD-FNKEKLPQDIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           EAL    V   A N+ FER  L        P            W C+++ +   GLP +L
Sbjct: 62  EALVEDRVIKWAFNASFERICLSNWLKKHHPEFLSDGFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  QKM EG +LI  FC   K         RN P+H    W  F +Y + DV
Sbjct: 122 EGVGTVLKLKDQKMREGADLIRYFCLPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRRDV 181

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I +R++  P+ S     ++ DQ INDRG  +DV       +I    + K+  EL+
Sbjct: 182 EVELAIKERVKNFPVPSFVWNEYHQDQIINDRGIGIDVDFVKAALKIDGESKAKIQAELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT   +     + ++ +WL    G+  + L +   + +L +  + T    QV   R +A
Sbjct: 242 TLTG--LEKPNSVLQMISWLREH-GVATDSLDKKAVKELLKTVDETT---AQVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +  + +
Sbjct: 296 AKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLKEAREL 355

Query: 344 THLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                  +++   D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K 
Sbjct: 356 FRTGDLESTELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +     + R  GK+ ELA GY G   A + M        
Sbjct: 416 FEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMG------- 468

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A++        + +  +WRQ +  +  
Sbjct: 469 ---------------------------------ALDMGLSEEELQPLVNSWRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++  A +  ++       +       +  +     L + LPSGR L Y    +G N+
Sbjct: 496 YWWDVDNAVKTAVKELLPTSTQ------NIQFEVKSGILFITLPSGRKLAYIKPRIGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQLND--FKIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EVIIECPIEQ--KLDEVASLMGIAPYWLSDINLRADGYECFFYQK 650


>gi|218555134|ref|YP_002388047.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361902|emb|CAQ99502.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 687

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 260/692 (37%), Positives = 379/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGVGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
            + +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVHDE++ E PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 655 DKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|260161774|emb|CAZ39318.1| phage polymerase [Streptococcus suis]
 gi|313575356|emb|CBR26885.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 651

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 209/705 (29%), Positives = 330/705 (46%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D  +   +PQ + 
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYD-FNKEKLPQDIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           EAL +  V   A N+ FER  L        P          + W C+++ +   GLP +L
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  +KM EG +LI  FC   K         RN P+H    W  F +Y + DV
Sbjct: 122 EGVGTVLKLKDKKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRRDV 181

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I +RL+  P+     + ++ DQ INDRG  +D+       +I    + K+ +EL+
Sbjct: 182 EVELAIKERLKNFPVPDFVWDEYHQDQIINDRGIGIDIDFVKAAIKIDSESKAKIQEELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT   + +   + ++  WL    G+  + L +   + +L +  + T    QV   R +A
Sbjct: 242 ALT--RLENPNSVLQMIGWLREH-GVTTDSLDKKVVKELLKTADETT---AQVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      E  + +
Sbjct: 296 AKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLEEAREL 355

Query: 344 THLPTSITSDP--DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   ++   D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K 
Sbjct: 356 FGTGDLEATEFLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +     + R  GK+ ELA GY G   A + M        
Sbjct: 416 FEQGKDIYCISASQMFGVPVEKYGQNSELRQKGKIAELACGYGGSVGALKAMG------- 468

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A++          +  +WRQ +  +  
Sbjct: 469 ---------------------------------ALDMGLKDKELRPLVDSWRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++ +A +  I+               +  + +K  L + LPSGR L Y    +G N+
Sbjct: 496 FWWDVDRAVKTAIKQHIQTETHG------IQFEVNKGMLSITLPSGRKLAYVKPKIGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M    +  ++IV  VHD
Sbjct: 550 FGGESITYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFAMKQLQE--FNIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E     + +   + +LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EVIIEC--GIDQSLDEIAYLMGIAPEWMTDIKLRADGYECSFYQK 650


>gi|258646421|ref|ZP_05733890.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
 gi|260403824|gb|EEW97371.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
          Length = 656

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 199/701 (28%), Positives = 299/701 (42%), Gaps = 72/701 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +D+ K G+ KY E     ++LFA+ +D   V + D      +P  + 
Sbjct: 1   MKHLSIDIETFSDVDIKKSGLFKYCESPVFELLLFAYAYDFGDVHVVDLAQGEKIPDSVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L N +V   A+N+ FE T L           +W CT++     G P+ L  +G AL +
Sbjct: 61  SDLNNPEVIKHAYNASFEITGLNRY-GYATSPEQWRCTMLHGLYLGYPAGLAFLGAALGI 119

Query: 119 SSQK--MEEGKELIARFC---KGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIF 172
              K  +  GK LI  FC   K         RN P H    W LF EY   DV    E +
Sbjct: 120 PEDKRKLSTGKALIRYFCVPCKPTKRNGGRTRNLPKHDIDKWHLFKEYNAQDVVTEMEDY 179

Query: 173 KR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +R    P+    Q+ W +D  +N RG  +D+ L      I D  +T+L ++   +T    
Sbjct: 180 RRLSAYPVPGWVQDDWVIDYELNRRGIQLDMDLVRGALAIDDQHKTELVEKAIQITGLT- 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L TW+   + L LE LT+ T    L   +       +V + R   ++S++ K
Sbjct: 239 -NPNSRNQLLTWINDNSDLKLEKLTKETVAESLQIAEDQ---VAEVLHIRRALAKSSISK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
             ++  A+ +DGR+RG LQF GA+RTGRW+G +   QNLP       +    +     + 
Sbjct: 295 YESMKNAVCADGRIRGVLQFYGANRTGRWAGRLVQVQNLPHDVPVAMDTAIRLVKNGNAR 354

Query: 351 ---TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +S  +R+  +A EG  L V+D + IEARVL+W+A E+W+   F  G D
Sbjct: 355 GVKLMYGHISTSLSHLIRAAFVAPEGSLLCVSDFSAIEARVLSWLADEKWRQDVFAKGGD 414

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + +  F V   +       R  GKV ELALGYQGG  A   M +            
Sbjct: 415 IYCASASSMFGVPVEKHGINGHLRQKGKVAELALGYQGGPPALITMGALKQ--------- 465

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                                   +   WR  + R+   W ++ 
Sbjct: 466 -------------------------------GLTEDELPDIVHRWRGANPRICGFWYDVD 494

Query: 526 QAFEQTIENGKAIIARKRRDV-PLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRS---- 578
            A    + + + +       +     +    + L + LPSGR L Y    +  N+     
Sbjct: 495 GAALSVMSDARPVGLPHGILISRECNLLYGYDYLTIRLPSGRKLYYPQPYINENQFGKPA 554

Query: 579 --YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
             Y      + +   TYGGKL ENI QA++RD LA  +    KAGY  ++ +HDE+V E 
Sbjct: 555 LHYRVQAGIKWSHTSTYGGKLVENITQAIARDCLALAINRLVKAGYKPLMHIHDEVVLEV 614

Query: 637 PDT--DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P     E     +  +M +   WA GL L A+G+ S  Y K
Sbjct: 615 PKDKIHEDEIDRINQIMCAPIPWAPGLLLNADGFISPYYTK 655


>gi|300933484|ref|ZP_07148740.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 218/707 (30%), Positives = 307/707 (43%), Gaps = 87/707 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET SP++L   G+  YA+     ++LF +  D  PVE+ D  +   +P+ + 
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----------IPIHRWICTLVLARSNGLPSA 108
            AL +  V   A N+ FER  L +               +   +W CT+V +   GLP +
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGE---THECLYDRNKPN-HREAWRLFGEYCKGD 164
           L  V   L L  +K   GK+LI +FC             RN P    + W  F  Y + D
Sbjct: 121 LDQVATVLHLPVRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   PL + E + + LDQ +ND G  +D  L           R       
Sbjct: 181 VEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT   + +     +LK WL    G  L+ LT+     V ++    T Q  +V   R  
Sbjct: 241 QELTG--LENPNSPIQLKDWL-AAHGAPLQSLTKD---EVAAALDTATGQVREVLLLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
            ++S+V K   +      DGR RG LQF GA RTGR++G +   QNLPR         + 
Sbjct: 295 LAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLAEARS 354

Query: 343 IT---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           +    +              +S  +R+  I ++G + VVAD + IEARV+AW+AGE   L
Sbjct: 355 LVRTGNYDAVELLYDSVPDTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAGEATTL 414

Query: 400 KAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           +AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M      
Sbjct: 415 EAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG----- 469

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                              A+      +  + +  AWR  +  V
Sbjct: 470 -----------------------------------ALRMGLAESELQPLVDAWRAANPNV 494

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGN 575
            +LW +++ A  + I                +    +   + + LPSGR L Y    +G 
Sbjct: 495 VQLWADINAAAIEAISTRLPTSVG------ALTFTVESGIMFIRLPSGRRLAYVKPKLGE 548

Query: 576 NRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
           NR           TT R+  +  TYGGKLTENIVQAV+RD+L  GM    +AG+ IV+ V
Sbjct: 549 NRFGGTAITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGHRIVMHV 608

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDEIV ET          +  LM   P WA GLPL A+GY    Y K
Sbjct: 609 HDEIVVET---ATATVDEICKLMAITPDWAAGLPLAADGYACDFYMK 652


>gi|77412069|ref|ZP_00788395.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
 gi|77161874|gb|EAO72859.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
          Length = 651

 Score =  500 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 206/705 (29%), Positives = 314/705 (44%), Gaps = 87/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET   +DL K G+  YAED    ++L A   D+ PV ++D      +P  + 
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLT-KENLPDQIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           +AL N  +   A N+ FER  L        P          + W C++V +   GLP +L
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSIVWSAYLGLPLSL 121

Query: 110 KAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           + VG  LKL  QK++EG ++I  FC   K         RN P+H  + W  F  Y K DV
Sbjct: 122 EGVGTVLKLKEQKLKEGGDVIRYFCLPYKPTKINGGRKRNFPHHAPDKWAAFINYNKRDV 181

Query: 166 TVTREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  +L   P+     E ++ DQ IND G  +DV        I +  ++K+ +EL+
Sbjct: 182 EVELAIKNKLRNHPVPDFLWEEYHQDQNINDSGIGIDVDFVKAAITIDEESKSKIQEELK 241

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT   + +   + ++  WL    G+    L +   + +L      T    +V   R +A
Sbjct: 242 ELTG--LENPNSVLQMIGWLREH-GVTTNSLDKKAVKELLKVVDAKT---TKVLKLRQQA 295

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +V  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +  + +
Sbjct: 296 AKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLKEARDL 355

Query: 344 THLPTSITSD--PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   +D        +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+   
Sbjct: 356 FKTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSMV 415

Query: 402 FETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           FE G+D+Y  + ++ F V   +     D R  GK+ ELA GY G   A + M +      
Sbjct: 416 FEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMGAI----- 470

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                              +        + +  +WRQ +  +  
Sbjct: 471 -----------------------------------DMGLDEQELQPLVDSWRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV------ 573
            W ++ +A +  I+  K            +  K  K  L + LPSGR L Y         
Sbjct: 496 FWWDVDKAVKTAIKYQKQTETHG------IQFKVRKGMLFITLPSGRKLAYVKPKMGENQ 549

Query: 574 --GNNRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
             G + +Y  T T ++  R  +YG K  ENI+QA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQL--KDFRIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           EI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|191173996|ref|ZP_03035513.1| DNA polymerase [Escherichia coli F11]
 gi|190905687|gb|EDV65309.1| DNA polymerase [Escherichia coli F11]
 gi|324014350|gb|EGB83569.1| hypothetical protein HMPREF9533_01582 [Escherichia coli MS 60-1]
          Length = 687

 Score =  500 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 259/692 (37%), Positives = 378/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDEPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
              +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +      + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYNESVKRKSTFGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 655 DKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|257088833|ref|ZP_05583194.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|256997645|gb|EEU84165.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|315160597|gb|EFU04614.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0645]
 gi|315579443|gb|EFU91634.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0630]
          Length = 653

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 229/703 (32%), Positives = 324/703 (46%), Gaps = 79/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D      +P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISE-IPDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL + +V  +A N+ FER  L     +   +   +W CT+V A   GLP++L    + L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   I 
Sbjct: 120 NIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMAIA 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L   P+   E +L+ LDQ INDRG  +D  LA     I+         E++ LT   +
Sbjct: 180 NKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKELTG--L 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+  K
Sbjct: 238 ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALA-LGNLPENVAEVLKLRLSLSNSSTKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  +  + +       
Sbjct: 296 YLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDVE 355

Query: 351 TS---DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  D    +   +R+ ++A EG + +V+D + IEARV+AW A + W L+ F T   
Sbjct: 356 GIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHGK 415

Query: 408 LYVTTYARSFNV-------APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
           +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M         
Sbjct: 416 IYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG-------- 467

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E+       + +   WR  + R+   
Sbjct: 468 --------------------------------ALENGIEEHELQDIVDRWRTANKRIKNF 495

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR--- 577
           W+E  +A    ++NG       ++    +   K    L + LPSGR L Y      +   
Sbjct: 496 WHETQKAVIDCLQNG-----GIKKGPRGLKFYKKAGFLFIQLPSGRKLAYAKAHLEQGDY 550

Query: 578 ----SYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                Y     +   T + TYGGKL ENIVQA +RD+LAE M+   KAGY IV  VHDE 
Sbjct: 551 GPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPIVFHVHDEA 610

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +  +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 611 VAEVPEGE-KSIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|320530602|ref|ZP_08031654.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
 gi|320137129|gb|EFW29059.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
          Length = 653

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 215/701 (30%), Positives = 330/701 (47%), Gaps = 78/701 (11%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L ID ET S +D+   G  +YAE+  ++LFA+ +DD PV++ D   +  +P  +  AL 
Sbjct: 2   ILSIDLETYSALDIKTVGGYRYAENAEILLFAYAWDDTPVQIVDLTAEETIPADVLSALT 61

Query: 63  NTDVTIVAHNSYFERTVLKACFNLD------IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + D+   A N+ FERTVL    + +      +    W CT+V A + GLP +L  V + L
Sbjct: 62  DNDIMKCAFNAQFERTVLSHYLHKEGEPFAFLDPAGWSCTMVHALTLGLPGSLAEVSKTL 121

Query: 117 KLSS--QKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTRE 170
           KL    +KM  G +LI  F   CK         RN P +  E W  F  YC  DV   RE
Sbjct: 122 KLGEEKEKMSVGTQLITYFCKPCKPTKSNGGRTRNLPNDAPEKWATFKAYCVRDVEAERE 181

Query: 171 IFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           + +RL   P+   E+ LW LDQ INDRG  +D  LA          R ++  E  +L+  
Sbjct: 182 VRRRLSGYPVPETERALWALDQRINDRGVRIDEILAQNAIAFDSAFRAEVTAEASALSG- 240

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +    E+LK W++ + G     LT+ T   ++ + K  T     +   +M  S+++V
Sbjct: 241 -LENPNSGEQLKHWIYEQEGARPLSLTKETIPELIETAKSET--VKTMLQLKMLLSKTSV 297

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---TH 345
            K   +V+A  SDGR  G LQF GA+RTGRW+G +   QNLPR + +  +  + +     
Sbjct: 298 KKYEAMVQAQCSDGRAHGLLQFYGANRTGRWAGRLVQVQNLPRNTMAELDDARALLRCGD 357

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
                    +P  ++S  +R+  I + G +  VAD + IEARV+AW+AGE+W++  F  G
Sbjct: 358 TDALEMLFDNPPDVLSQLIRTAFIPAVGMRFTVADFSAIEARVIAWLAGEKWRMDVFADG 417

Query: 406 EDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ F+V   +       R  GKV ELALGY GG  A ++M +          
Sbjct: 418 GDIYCASASKMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVSALKRMGADK-------- 469

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                                   E +K++WR+   R+  LW++
Sbjct: 470 --------------------------------LGLTDAELEEIKQSWRKASPRIVRLWSD 497

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN------- 576
              A  + +     +  +       + ++     L + LPSGRSL Y             
Sbjct: 498 FESAALEAVRERSTVSLQ-----HGIKLECRSGILFIRLPSGRSLAYVKPRIEYEESFDR 552

Query: 577 --RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              +Y         ++ TYGG+L EN +QA++RD LA  M     AGY IV+ +HDE+V 
Sbjct: 553 EGLTYYGRDVGGWGKQRTYGGRLVENAIQAIARDCLAVAMTRLEAAGYPIVMHIHDEVVV 612

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ETP +     + +  +M+    WA GL L A+GY +  Y+K
Sbjct: 613 ETPRS-VDCLADVCEIMSKPVDWAPGLVLTADGYTTNYYKK 652


>gi|331648300|ref|ZP_08349389.1| putative DNA polymerase (P45) [Escherichia coli M605]
 gi|331042849|gb|EGI14990.1| putative DNA polymerase (P45) [Escherichia coli M605]
          Length = 687

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 258/692 (37%), Positives = 380/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCDIPINN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
            + +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE+ KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVCKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKK+VV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKMVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYGESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 655 DKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|293400006|ref|ZP_06644152.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306406|gb|EFE47649.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 651

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 213/697 (30%), Positives = 325/697 (46%), Gaps = 78/697 (11%)

Query: 9   ETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALENTDV 66
           ET S +DL  CG+ KY  +ED  ++LFA+  DD PV++ D      +P  + + ++   +
Sbjct: 2   ETYSSVDLISCGVYKYVESEDFEILLFAYAVDDEPVKVVDLACGEKIPSEVLDLIDEPAI 61

Query: 67  TIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL--SSQKME 124
              AHN+ FER  L       +   +W C+++ A   GLP++LK VG  L L    QKM 
Sbjct: 62  IKYAHNAVFERLCLSRYLGTQLDTDQWHCSMIHAMMLGLPASLKDVGAVLGLSEDKQKMR 121

Query: 125 EGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLE--PL 178
            GK LI+ F   CK         RN P +  E W+LF +YC  DV   REI  +L+  P+
Sbjct: 122 IGKTLISYFCKPCKPTRVNGQRSRNTPADAPEKWQLFKDYCHRDVETEREISNKLDKFPI 181

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
            + E ELW  DQ +ND G  +D+ + HT+         +L  E E +T G     + + +
Sbjct: 182 PASEHELWCWDQKMNDHGARIDMEMVHTVLVFGHRYDEELINECERITNG--IGPKKIAQ 239

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           LK W+  +    +E L +     +L     ++P+  +V   R  + ++++ K   +  ++
Sbjct: 240 LKEWICRKEDRSIESLDKDAVIELLKD-SSISPETRRVLQIRQESGKTSITKYAAIQRSV 298

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD---PD 355
            +D RL G LQF GA+RTGRW+G +F PQNLPR + +  EL + +       + D     
Sbjct: 299 CNDQRLHGFLQFYGANRTGRWAGRIFQPQNLPRNAFNDIELARKLVKEKDFESLDMLYGS 358

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYAR 415
             Q+ S  +R+ VI   G    +AD + IEAR+ AW   E+W+ + F T   +Y  + A+
Sbjct: 359 YNQVFSTLIRTAVIPPNGHMFAIADYSAIEARLTAWFCNEEWRQEVFATTGKIYEASAAQ 418

Query: 416 SFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
            F+V    VTK  D R  GKV ELALGY GG  A ++M                      
Sbjct: 419 MFHVPIESVTKGSDLRKKGKVAELALGYGGGVSALERMG--------------------- 457

Query: 474 EWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIE 533
                                +        + +   WR     + ++W  +  A    + 
Sbjct: 458 -------------------GADMGLSEDEMQDIVNKWRLASPNIKKMWYRVQDAAYTAVR 498

Query: 534 NGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV-------GNNRSYLNTT--- 583
             K     +   V  V        L   LPSGR L Y          G+  +Y       
Sbjct: 499 ERK-----RVSVVHGVRYFYSSGILFAELPSGRRLAYVRPKLKKGRYGDELTYEGYGSDQ 553

Query: 584 ----TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP-D 638
               T++  R+ T+GGKL EN++QA++RD LA+ M+     GY I++ +HDE+V E P +
Sbjct: 554 DGKQTKKWCRQKTWGGKLFENLIQAIARDCLAKAMLKLDDVGYKIIMHIHDEVVVEVPSE 613

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           T E     +  +M     WA GL L A+G+ S+ YRK
Sbjct: 614 TAESCLIDIERIMGEPIPWAPGLILTADGFISEYYRK 650


>gi|194429286|ref|ZP_03061813.1| DNA polymerase [Escherichia coli B171]
 gi|194412694|gb|EDX28989.1| DNA polymerase [Escherichia coli B171]
          Length = 687

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 259/692 (37%), Positives = 379/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
            + +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL +  
Sbjct: 481 NIPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVH+E++ E PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHNEVITEAPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 655 DKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|331654014|ref|ZP_08355015.1| putative DNA polymerase (P45) [Escherichia coli M718]
 gi|331048863|gb|EGI20939.1| putative DNA polymerase (P45) [Escherichia coli M718]
          Length = 687

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 260/692 (37%), Positives = 378/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
              +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP +L  + E L +  
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL    
Sbjct: 481 NIPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELECTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 655 DKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|325690425|gb|EGD32428.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK115]
          Length = 645

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 217/698 (31%), Positives = 326/698 (46%), Gaps = 77/698 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y +     ++LFA+  D+   ++ D      +P+ + 
Sbjct: 1   MRTLSIDIETYSDVDLTKCGVYRYVDSPQFEILLFAYKIDEENTQIVDLAQGEELPKGIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FER  L       +    W CT V A S GLP +L+ VG  L +
Sbjct: 61  SALRDDAVVKTAFNANFERVCLSKYLKQKLSARSWSCTAVQAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG+ LI  F   C+      + +RN P+H  E W LF  YCK DV V + I KR
Sbjct: 121 EEQKMKEGQRLIRYFCLPCRPTIANGMRERNWPHHALEDWELFKRYCKRDVEVEQAIRKR 180

Query: 175 L--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   PL   EQ L+ LDQ INDRG  VD  L           + ++ Q    L+   + +
Sbjct: 181 LSNYPLLESEQLLYQLDQAINDRGIAVDQELVSQAILGDLSYKEQVTQRAYELSG--LDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL    G+ ++ L +   + V    K++  + +++   R+  S+++V K  
Sbjct: 239 PNSVSQLKGWL-ENQGVFMDSLGK---KDVAKQLKEVDGEILEMLKLRLLMSKTSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LPTS 349
            +   + SD R+ G LQF GA+RTGRW+G +   QNLP+      +L + +     L   
Sbjct: 295 AMERCVCSDDRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLDLARTLVKDGQLKAL 354

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
                +   ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G D+Y
Sbjct: 355 DLLYDNVPNVLSELIRTAFVPKSGHQFIVADFAAIEARVLAWLSGETWRLEVFEQGGDIY 414

Query: 410 VTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLV 466
             + A  F V   +       R  GK+ ELALGY G   A + M +   GL+        
Sbjct: 415 CASAASMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGALDMGLDEE------ 468

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                + +   WR  +  +   W  + +
Sbjct: 469 -----------------------------------ELQPLVNQWRMANPHIVAFWWVIDK 493

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTT-- 584
           A ++  E  +         V  + +        + LPSGR L Y       +        
Sbjct: 494 ASKEVYETREPQ------KVGNLLLYYQAGMFFIALPSGRKLAYVKPRMELNAFGKPGLT 547

Query: 585 -------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
                  ++ +R  TYG KL ENIVQ ++RD+LA GMM   K   DIVL VHDE V E  
Sbjct: 548 YEGIGENKKWSRIDTYGPKLVENIVQGIARDLLAHGMMQLQKQELDIVLHVHDEAVVEVK 607

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + +  +   +  L  + P WA+GLPL+A+GY  + Y+K
Sbjct: 608 EGEA-SVEEVCQLFATLPDWAEGLPLRADGYACQFYQK 644


>gi|227520155|ref|ZP_03950204.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
 gi|227072400|gb|EEI10363.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
          Length = 653

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/703 (32%), Positives = 323/703 (45%), Gaps = 79/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D      +P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISE-IPDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL + +V  +A N+ FER  L     +   +   +W CT+V A   GLP++L    + L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKHLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   I 
Sbjct: 120 NIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMAIA 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L   P+   E +L+ LDQ INDRG  +D  LA     I+         E+++LT   +
Sbjct: 180 NKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKALTG--L 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+  K
Sbjct: 238 ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALA-LGNLPENVAEVLKLRLSLSNSSTKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  +  + +       
Sbjct: 296 YLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDVE 355

Query: 351 TS---DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +    +   +R+ ++A EG + +V+D + IEARV+AW A + W L  F T   
Sbjct: 356 GIELMYENVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLDVFRTHGK 415

Query: 408 LYVTTYARSFNV-------APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
           +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M         
Sbjct: 416 IYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG-------- 467

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E+       + +   WR  + R+   
Sbjct: 468 --------------------------------ALENGIEEHELQDIVDRWRTANKRIKNF 495

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN---- 576
           W+E  +A    ++NG       ++    +   K    L + LPSGR L Y          
Sbjct: 496 WHETQKAVIDCLQNG-----GIKKGPRGLKFYKKAGFLFIQLPSGRKLAYAKAHLKEGDY 550

Query: 577 ---RSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                Y     +   T + TYGGKL ENIVQA +RD+LAE M+   KAGY IV  VHDE 
Sbjct: 551 GPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPIVFHVHDEA 610

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +  +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 611 VAEVPEGE-KSIEEMNKIMSIVPDWAEGLPLNAEGFETKYYMK 652


>gi|307569599|emb|CAR82778.1| phage-related DNA polymerase family protein [Listeria monocytogenes
           L99]
          Length = 644

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 217/692 (31%), Positives = 323/692 (46%), Gaps = 70/692 (10%)

Query: 2   ATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
             L ID ET S  D+  CG   Y  +ED  ++LFA+ +DD PV++ D   D  +P  + E
Sbjct: 4   KVLRIDIETYSGRDIKNCGAYAYTESEDFEILLFAYAYDDEPVKVIDLTIDE-IPDTVLE 62

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
            L N  V   AHN+ FERT L   +N  +P  +W CT+V     GLP++L  + +AL+L+
Sbjct: 63  DLNNRRVLKTAHNANFERTCLAKYYNRKMPPEQWQCTMVHGTLLGLPASLDMMSKALRLA 122

Query: 120 SQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRL 175
            +K  EGK LI  F   CK         RN P H  E W  F EYC+ DV V R I K++
Sbjct: 123 QEKDNEGKALIRYFCMPCKPTKANGGRTRNYPEHASEKWAKFIEYCRQDVVVERSIAKKI 182

Query: 176 E--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
              P    EQ  W LDQ I D+G  +DV L        +  +  L ++ + LT   + + 
Sbjct: 183 AKFPFPEDEQRNWELDQRIADKGVRIDVDLVKHAIACQERYQASLSKKAKGLTG--LENP 240

Query: 234 RCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT 293
             +++LK WL  + G  +  L + +   +L+  + L     ++   R   S++++ K   
Sbjct: 241 NSVQQLKDWL-ADMGYPVSSLNKDSVSELLAD-EDLDEDVREMLLLRQEMSKTSIKKYEK 298

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL---DQIITHLPTSI 350
           +  A   DGR+RG LQF GA+RTGRW+G +   QNLPR           D          
Sbjct: 299 MQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIKDIAEVRKDLKAGDYEAFE 358

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
               +   ++S  +R+  IA +G    + D + IEARV+AW+AGEQW+L  F +   +Y 
Sbjct: 359 MMYSNVPDVLSQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDVFNSHGKIYE 418

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
            + ++ F++   +V K+ R  GKV ELALGY GG  A   M                   
Sbjct: 419 ASASQMFHIPIEEVDKNLRQKGKVSELALGYNGGVNALIAMG------------------ 460

Query: 471 APEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQ 530
                                 A+E        + +  AWR+    ++ LW  + +  + 
Sbjct: 461 ----------------------ALEMGLKENELQGIVDAWRKASPAITSLWRGVEKHAKL 498

Query: 531 TIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYLNTT 583
            I   K+           +    +   L + LPSGR+L Y          G    Y   T
Sbjct: 499 AISTRKSQ------KYKGLTFYYEAGILFIKLPSGRNLAYFRAKLVPGKYGPQICYEGVT 552

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
            +   ++YTYGGKL ENIVQA++RD LA  +      G D V+ VHDE + E  +++  +
Sbjct: 553 DKGWRKQYTYGGKLVENIVQAIARDCLAISLRRIEDTGIDTVMHVHDEAITEVQESE-SS 611

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  ++    SWA GLPL+ +G+ S  Y K
Sbjct: 612 VDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 643


>gi|260845239|ref|YP_003223017.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
 gi|257760386|dbj|BAI31883.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
          Length = 687

 Score =  495 bits (1274), Expect = e-137,   Method: Composition-based stats.
 Identities = 261/692 (37%), Positives = 378/692 (54%), Gaps = 26/692 (3%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
              +  +  HNS+F+RTVL+     L  P+ RW  T+V A ++GLP AL  + E L +  
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGALGELCEVLGVPQ 121

Query: 121 QK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
            K   +EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            + +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++  
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+  +T +R ++    L     ++   R++AS ++  K   L+
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIAD-PDLPSAVKELLAIRLQASTTSTSKYKALM 300

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
           + ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L         
Sbjct: 301 KGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLF 360

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----EDL 408
            + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF         DL
Sbjct: 361 DNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDL 420

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    
Sbjct: 421 YKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALP 480

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
           N   +   +A+++     +    + + +     AC+ +K+ WR+ H    + W EL    
Sbjct: 481 NIPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELECTV 539

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTT 583
              I   +  +         + +++D   L + LPSGR++ Y        N +Y+  N+ 
Sbjct: 540 RTAIATPQKTL-----YCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSY 594

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT++FN
Sbjct: 595 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFN 654

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 655 DKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|281416455|ref|YP_003347375.1| DNA polymerase [Enterococcus phage phiFL4A]
 gi|270209631|gb|ACZ64170.1| DNA polymerase [Enterococcus phage phiFL4A]
          Length = 653

 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 227/703 (32%), Positives = 321/703 (45%), Gaps = 79/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D      +P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISE-IPDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL + +V  +A N+ FER  L     +   +   +W CT+V A   GLP++L    + L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   I 
Sbjct: 120 NIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMAIA 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L   P+   E +L+ LDQ INDRG  +D  LA     I+         E++ LT   +
Sbjct: 180 NKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKELTG--L 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+  K
Sbjct: 238 ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALA-LGNLPENVAEVLKLRLSLSNSSTKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  +  + +       
Sbjct: 296 YLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDVE 355

Query: 351 TS---DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  D    +   +R+ ++A EG + +V+D + IEARV+AW A + W L+ F T   
Sbjct: 356 GIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHGK 415

Query: 408 LYVTTYARSFNV-------APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
           +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M         
Sbjct: 416 IYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG-------- 467

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E+       + +   WR  + R+   
Sbjct: 468 --------------------------------ALENGIEEHELQDIVDRWRTANKRIKNF 495

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN---- 576
           W+E  +A    ++NG       ++    +   K    L + LPSGR L Y          
Sbjct: 496 WHETQKAVIDCLQNG-----GIKKGPRGLKFYKKAGFLFIQLPSGRKLAYAKAHLKEGDY 550

Query: 577 ---RSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                Y     +   T + TYGGKL ENIVQA +RD+LAE M    + GY IV  VHDE 
Sbjct: 551 GPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPIVFHVHDEA 610

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +  +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 611 VAEVPEGE-KSIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|253581725|ref|ZP_04858949.1| DNA polymerase [Fusobacterium varium ATCC 27725]
 gi|251836074|gb|EES64611.1| DNA polymerase [Fusobacterium varium ATCC 27725]
          Length = 657

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 219/703 (31%), Positives = 323/703 (45%), Gaps = 75/703 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +D+ K G+ KYA  +D  ++LFA+  D   V++ D     ++P+V+ 
Sbjct: 1   MKHLSIDIETYSSVDIKKAGMYKYALSDDFQILLFAYSIDFGEVKIIDLAKGEILPEVII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL + ++   A+N+ FE   L         I +W  T+      G  + L A G A+ L
Sbjct: 61  EALNDKNIIKHAYNAPFEWWCL-NQAGYKTSIEQWRDTMFHGLYCGYTAGLGATGAAIGL 119

Query: 119 --SSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
               +K   GK LI  FC   K         RN P+H  E W LF  YC  DV    EI+
Sbjct: 120 PQDKKKDTTGKALIKLFCVPCKPTKKNGGRLRNLPHHEPEKWELFKNYCIQDVVTETEIY 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           KRL   P+  +EQELW LDQ IN  G  +D  L      I D+   +L +E   +T   +
Sbjct: 180 KRLSNFPVPQEEQELWVLDQKINAYGVKIDTELVKGALSINDIVTAELTEEAIQVTG--L 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL  +TG  +E+L + T   ++ S +    +A++V   R   +++++ K
Sbjct: 238 DNPNSAAQLGKWLKEKTGQDIENLQKGTVSELIGSLEDK--EAVRVLEIRQELAKTSIKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              + EA+  DGR+RG LQF GA+RTGRW+G +   QNLPR      +  + I     + 
Sbjct: 296 YVAMEEAICPDGRIRGLLQFYGANRTGRWAGRLVQVQNLPRNYLETLDYAREIVKSQDAD 355

Query: 351 ---TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +    +S  +R+  + SEG K VVAD + IEARV+AW+AGEQW+ + F T   
Sbjct: 356 FLKLVYGNVSDTLSQLIRTAFVPSEGHKFVVADFSAIEARVIAWLAGEQWRQEVFATHGK 415

Query: 408 LYVTTYARSFNVAPA-----QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           +Y  + ++ F V              R  GKV ELALGY G + A   M           
Sbjct: 416 IYEASASQMFGVPIELIKKGNPEYALRQKGKVAELALGYGGSSGALIAMG---------- 465

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                         A++          V + WR  + R+++LW 
Sbjct: 466 ------------------------------ALDMGLEEKELPDVVRRWRNANKRITDLWY 495

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR----- 577
            +  A  + +E G+    +       + +  D++ L + LPSGR L Y            
Sbjct: 496 GIENAVIKLMETGETQGLKGIIFSREIDLIYDQDFLTIKLPSGRKLYYPKPHLKENRFGS 555

Query: 578 -----SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                  +N TT++   + TYGGKL ENIVQA+SRD LA  +      G   V+ +HDE 
Sbjct: 556 NALHYFGVNQTTKKWEVQETYGGKLVENIVQAISRDCLAVTLKRLETEGLQTVMHIHDEA 615

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V +     +   + +  LM     WA GL LKA G+ES  Y K
Sbjct: 616 VIDADPNVD--LNKVCELMGQPIEWAPGLLLKAAGFESGYYMK 656


>gi|29374964|ref|NP_814117.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|29342422|gb|AAO80188.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|315574067|gb|EFU86258.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309B]
 gi|315582012|gb|EFU94203.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309A]
          Length = 653

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 227/703 (32%), Positives = 322/703 (45%), Gaps = 79/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D      +P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISE-IPDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL + +V  +A N+ FER  L     +   +   +W CT+V A   GLP++L    + L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGIPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   I 
Sbjct: 120 NIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMAIA 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
            +L   P+   E +L+ LDQ INDRG  +D  LA     I+         E+++LT   +
Sbjct: 180 NKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKALTG--L 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+  K
Sbjct: 238 ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALA-LGNLPENVAEVLKLRLSLSNSSTKK 295

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  +  + +       
Sbjct: 296 YLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDVE 355

Query: 351 TS---DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  D    +   +R+ ++A EG + +V+D + IEARV+AW A + W L+ F T   
Sbjct: 356 GIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHGK 415

Query: 408 LYVTTYARSFNV-------APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
           +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M         
Sbjct: 416 IYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG-------- 467

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E+       + +   WR  + R+   
Sbjct: 468 --------------------------------ALENGIEEHELQDIVDRWRTANKRIKNF 495

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN---- 576
           W+E  +A    ++NG       ++    +   K    L + LPSGR L Y          
Sbjct: 496 WHETQKAVIDCLQNG-----GIKKGPRGLKFYKKAGFLFIQLPSGRKLAYAKAHLKEGDY 550

Query: 577 ---RSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                Y     +   T + TYGGKL ENIVQA +RD+LAE M    + GY IV  VHDE 
Sbjct: 551 GPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPIVFHVHDEA 610

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +  +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 611 VAEVPEGE-KSIEEMNKIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|227875067|ref|ZP_03993212.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304390310|ref|ZP_07372263.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|306817354|ref|ZP_07451099.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
 gi|227844345|gb|EEJ54509.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304326066|gb|EFL93311.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304649795|gb|EFM47075.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
          Length = 655

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 224/706 (31%), Positives = 318/706 (45%), Gaps = 83/706 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D E+ S   L K G+  YAE  D  ++LF +  D  P+E+ D  +   +P  + 
Sbjct: 1   MRTLFCDIESFSLAQLAKTGVYPYAEHPDFELLLFGYSIDGGPIEVVDLANGQSIPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
            AL +  V   AHN+ FER  L A      P           +W CT++ +   GLP +L
Sbjct: 61  AALVDPSVVKWAHNAAFERVCLSAWLRTHHPELLADGFLGPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGE---THECLYDRNKP-NHREAWRLFGEYCKGDV 165
            AV   LKL  QK   GK+LI +FC             RN P      W  F +Y + DV
Sbjct: 121 DAVATVLKLDVQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRRDV 180

Query: 166 TVTREIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  R    P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVELAIHDRLACFPMPESEWDTYTLDQRINDAGILLDHTLVDNAVGVDEHHRNATLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT   + +     +LK WL    G  L+ L +     V ++    T    +V   R   
Sbjct: 241 TLTG--LENPNSPIQLKQWLASR-GCVLDSLAK---AEVDAALDTATGTVKEVLGLRGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     SDGR RG +QF GA RTGR++G +   QNLPR      +  + +
Sbjct: 295 AKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARTL 354

Query: 344 T---HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
               +L             +S  +R+  I S G + +VAD + IEARV+AW+AGE   L+
Sbjct: 355 VRTGNLEALELLHESVPDTLSQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGETTTLQ 414

Query: 401 AFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           AF  G+DLY  T +R F V   +     + R  GK+  LA G+ G   A ++M       
Sbjct: 415 AFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKLAVLACGFGGSTGALERMG------ 468

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A+         + +  AWR  +  + 
Sbjct: 469 ----------------------------------ALTMGLAEHELKPIVDAWRAANPHIV 494

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
            LW  + +A    I + ++I  R  R         +   L + LPSGR L Y    +G N
Sbjct: 495 ALWAGVEEAAIAAIASRQSIRLRNLR------FSVEAGILFIELPSGRRLAYVKPRLGEN 548

Query: 577 R-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R           TT R+  +  TYGGKLTENIVQA++RD+L  GM    KAG+ IV+ VH
Sbjct: 549 RWGGTSITYTGTTTARRWGQLETYGGKLTENIVQAIARDLLVTGMHAVAKAGHQIVMHVH 608

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DEIV + P+   F A+    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 609 DEIVIDEPENSGFTATGACELMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|298346386|ref|YP_003719073.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
 gi|298236447|gb|ADI67579.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
          Length = 658

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 207/692 (29%), Positives = 311/692 (44%), Gaps = 72/692 (10%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
            +L +D ET S ++L++CG+ +Y +D    ++L ++  DD  V   D      +P  +  
Sbjct: 20  KSLALDLETFSAVNLSQCGVYRYCDDPSFRILLCSYSVDDSDVVTVDLASGEQLPPEVVA 79

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
           AL++  V   A+N+ FERT L A     +    W CT+V A + GLP +LK VG  L L+
Sbjct: 80  ALDDPSVIKWAYNAAFERTCLSAHLGHRLDPTGWRCTMVWAATLGLPLSLKDVGTVLGLA 139

Query: 120 SQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR--LEP 177
            QK+ EGK+LI  F               +   AW LF +Y   DV V   I ++    P
Sbjct: 140 HQKLAEGKDLIKYFSLPTKT--GIRHQPSDDSAAWALFKQYNARDVEVETTIRRKLSHHP 197

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
           +  +    + +DQ INDRG  +D  LA          R +     + LT   + +     
Sbjct: 198 VPDEVWGQYEVDQRINDRGIHIDTRLATNAMACDKKYRKRTLARAQELTG--LDNPASPL 255

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
           +L++WL  + G  +  + +   + V S+    T    +    R   S+S+V K   + +A
Sbjct: 256 QLQSWLAEQ-GCKISSMAK---EDVDSALDTATGSVREALELRQDLSKSSVAKYRKMADA 311

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT---SITSDP 354
             +DGR  G LQF GASRTGRW+G +   QNLPR         + + H           P
Sbjct: 312 TCADGRAHGLLQFYGASRTGRWAGRLVQVQNLPRNYLPDLAQARSLVHYGDFDVLEMLYP 371

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYA 414
                +S  +R+  I SE  + +VAD + IEARVLAW+AGE+  L AF  GEDLY  T +
Sbjct: 372 SVPDTLSQLIRTAFIPSENHRFIVADYSAIEARVLAWLAGEETTLAAFTNGEDLYCATAS 431

Query: 415 RSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAP 472
             F V   +     + R  GK+  LA GY G   A + M                     
Sbjct: 432 AMFGVPVEKHGANAELRQKGKIAVLACGYNGSVGALKAMG-------------------- 471

Query: 473 EEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTI 532
                               A++     +  + +  AWR  +  +  +W+++ Q   Q I
Sbjct: 472 --------------------ALKMGLTASELQPIVDAWRAANPNIVAMWHDVDQTAIQAI 511

Query: 533 ENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT------ 584
                +          +     K  L + LPSGR L Y    +G NR    + T      
Sbjct: 512 TTRSTVTLG------NLSFTGTKGMLFITLPSGRRLAYVKPGLGVNRFGGTSITYWGQGI 565

Query: 585 -RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
            R+  +  TYGGKL ENIVQA +RD+LAE +     AG+++V+ +HDE+V +        
Sbjct: 566 NRKWQQLETYGGKLVENIVQATARDLLAEAITRIENAGHEVVMHIHDEVVVDESKDSGTT 625

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + +  LM   P+WA GLP+ A GY+   Y K
Sbjct: 626 VADICTLMNQLPTWALGLPIDAAGYKCDFYMK 657


>gi|304406771|ref|ZP_07388426.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
 gi|304344304|gb|EFM10143.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
          Length = 653

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 227/700 (32%), Positives = 331/700 (47%), Gaps = 73/700 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ID+ K G  KYA+  D  +++FA+ +D  PV++ D      +PQ + 
Sbjct: 1   MRTLNIDIETYSSIDIKKAGAYKYAQSPDFQILMFAYSWDGGPVQIVDLAQGEYLPQEIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A+N+ FE   L   F   I   +W CT V     G  + L AVGEAL +
Sbjct: 61  EALADPAVVKHAYNAAFEWYCLNRFFYSPIE--QWRCTQVHGLYCGYTAGLGAVGEALGI 118

Query: 119 SSQ--KMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
                K+  G  LI  F   CK      +  R  P+H  E W+LF EYC GDV    EI 
Sbjct: 119 PQDKRKLGTGGSLIRTFCIPCKPTRTNGMRTRTLPHHEPEKWKLFKEYCVGDVVAEMEIQ 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+  +E +LW+LDQ IN RG   D+ +      + +   ++L  E  SLT   +
Sbjct: 179 RRLSAFPVPDQEWQLWHLDQRINARGLFCDLQMVEGALAVDEQVTSELRAEAISLTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            + + +++L  WL  ETG  +E+L + T  +++    +   +A +V   R   S+++  K
Sbjct: 237 DNPKSVQQLSKWLAEETGEEVENLQKGTVSKLIDKLDE--GKARRVLEIRQELSKTSTKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLP 347
              +  A  SD R+RG LQF GA+RTGRW+G +   QNLPR   S  E  + +     + 
Sbjct: 295 YAAMQTAAGSDQRVRGLLQFYGANRTGRWAGRLVQIQNLPRNYLSTLEYARQLVVERKVE 354

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +    +S  +R+  +   GK+L VAD + IEARV+AW+AGEQW+L  F T   
Sbjct: 355 MLKFVYGNVPDTLSQLIRTAFVVPAGKQLGVADFSAIEARVIAWLAGEQWRLDVFATHGK 414

Query: 408 LYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + ++ F V   Q+ K  D R  GKV ELALGYQGG  A   M              
Sbjct: 415 IYEASASQMFGVPIEQIGKGSDLRQKGKVAELALGYQGGKGALIAMG------------- 461

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A++          +   WR  + R+ +LW  + 
Sbjct: 462 ---------------------------ALDQGLTEAELPEIVTRWRNANRRIVDLWYSME 494

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRS----- 578
            A  + +E G+ +  R        +    ++   + LPSGR L Y    +  N       
Sbjct: 495 AAAIEVMETGQPVGVRGLIFARESHHATKQDFFTITLPSGRKLFYAKPFLRENDFGKPAL 554

Query: 579 ---YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
               ++ T+++ T   TYGGKL EN VQA++RD LA  +M     GY IVL VHDE+  E
Sbjct: 555 HYWGMDQTSKKWTVLNTYGGKLVENCVQAIARDCLAVTLMRLDHVGYPIVLHVHDEVGAE 614

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              +       +  +M     WA GLPLK +G+ +  Y K
Sbjct: 615 L--SSADELDRMLEIMAQPIQWAPGLPLKGDGFVTNFYMK 652


>gi|255525749|ref|ZP_05392680.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296188034|ref|ZP_06856426.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|255510572|gb|EET86881.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296047160|gb|EFG86602.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
          Length = 646

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 216/696 (31%), Positives = 329/696 (47%), Gaps = 76/696 (10%)

Query: 4   LFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET S +D+TK G+  Y  AED  ++LFA+ ++D  + + D      +PQ + E L
Sbjct: 2   LSIDIETYSSVDITKSGVYAYTEAEDFEILLFAYAYEDKEINIIDLAFGEKLPQGIIEDL 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ 121
            N  +   A N+ FERT L    N  +P  +W C+ V A + G   +L+   ++L L  Q
Sbjct: 62  TNPKLIKTAFNANFERTCLAKYLNKPMPPEQWRCSAVHALALGFGGSLEGAAKSLNLQQQ 121

Query: 122 KMEEGKELIARFCKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRLEPLS- 179
           KM+EGK LI  F           RN P H  E W++F  YCK DV V R + K+LE    
Sbjct: 122 KMKEGKALIRYFSMPCKR-GERSRNLPQHNIEKWKVFKTYCKQDVEVERAVRKKLEKYPV 180

Query: 180 -SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
             KE ELW LDQ IND G  +D  L H+  +     ++K  +E  +LT   + +     +
Sbjct: 181 TKKEWELWALDQKINDSGVKIDKVLVHSAIECDKTCQSKKTEEAAALTG--LENPNSQVQ 238

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           LK WL  + G+  E L++   + +L   +    +  +V   R   S+++V K   +  A+
Sbjct: 239 LKGWLETK-GVKAESLSKEKVRELLKEVEDE--KVKRVLKLRQELSKTSVKKYEAIKRAV 295

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTSITSDPD 355
             D R+RG L+F GA+RTGRWSG +   QNLPR +  + E  +++    +          
Sbjct: 296 CKDERVRGLLKFYGANRTGRWSGKLVQTQNLPRNTMDNLEAARMLLKSGNYEMLEVLFYS 355

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYAR 415
             +++S  +R+  I +   + +V+D + IEARV+AW+AGE+W +  F+    +Y    +R
Sbjct: 356 VPEVLSQLIRTAFIPAFNSRFIVSDFSAIEARVIAWLAGEKWVIDTFKGSGKVYEMAASR 415

Query: 416 SFNVAPAQVTKD-----QRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
            F V   ++ K       R  GKV  LA GYQG   A   M +                 
Sbjct: 416 MFGVPIEKIVKGNMEYSLRQKGKVATLACGYQGSTGALIAMGAVK--------------- 460

Query: 471 APEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQ 530
                                              +  AWR+ +S + +LW ++  A  +
Sbjct: 461 -------------------------MGLKEEELSGIVAAWRKSNSNIVKLWRKIEDAAIK 495

Query: 531 TIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS-----------Y 579
            +   K +  +       +     +  L + LPSGRSL Y      +             
Sbjct: 496 AVREKKVVKMQYG-----LEFFGSEEFLFIKLPSGRSLSYVRPRIEKDFRFNKLKLTYEG 550

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
           +   T+   R  TYGGKLTENIVQA++RD LA  M+   +AGY IV  VHDE++ + P+ 
Sbjct: 551 IEQGTKAWGRLNTYGGKLTENIVQAIARDCLAYAMLRLDRAGYKIVFHVHDEVILDVPNG 610

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              +   +  +M     WAKGLPLKA+G+E+  Y+K
Sbjct: 611 F-GSLKEVNEIMGKPIEWAKGLPLKADGFETDYYKK 645


>gi|322382461|ref|ZP_08056356.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153574|gb|EFX45963.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 662

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 215/703 (30%), Positives = 315/703 (44%), Gaps = 78/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL  CG+ +Y E  D  V+LFA+ +DD PV++ D      +P  + 
Sbjct: 9   MKILQIDLETYSSVDLKDCGVYRYVESPDFEVLLFAYAYDDDPVQVIDLTAFEDLPDQVV 68

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L + +V   A N+ FERT +K  F +     +W CT V A + GLP  L+ V E LKL
Sbjct: 69  HDLTDPNVLKTAFNAAFERTCIKKHFGIKCNPSQWRCTAVWALALGLPGYLEGVAEVLKL 128

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH--REAWRLFGEYCKGDVTVTREIFK 173
            +QK   GK LI  F   CK         RN P H   E W  +  Y   DV V RE+ +
Sbjct: 129 EAQKDTRGKNLIKYFSVPCKPTKANGGRTRNHPPHHDMEKWEQYKAYNIQDVVVEREVRR 188

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +LE  P+   E +LW LDQ INDRG  +D  L +      D  +T L QE + +T   + 
Sbjct: 189 KLERFPVPQHEWDLWALDQRINDRGIQLDPTLFNQAIDCADQYKTGLLQEAKDIT--QLE 246

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
           +   L KLK WL  +     + L +     +L           +V   R    +++V K 
Sbjct: 247 NPNSLTKLKEWLAEQGLETPDGLGKEHMPTLLVQAPDEDT--RRVLQIRQELGKTSVDKY 304

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT--- 348
           N +  ++ +DGR RG LQF GA+RTGRW+G +   QNLP+   +   + + +        
Sbjct: 305 NAMARSICADGRARGILQFCGANRTGRWAGRIIQVQNLPQNKLNALWMAREVLKSGDFDL 364

Query: 349 SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL 408
                     ++S  +R+  I S G + +V+D + IEAR++AW+A E W L  F+    +
Sbjct: 365 LEMLYGALPSVLSQLIRTVFIPSPGCRFIVSDFSAIEARIIAWLADEHWVLNVFQDHGKI 424

Query: 409 YVTTYARSFNVAPA-----QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           Y    ++ F V            + RA GKV  LA GYQGG  A  KM            
Sbjct: 425 YEAAASQMFKVPMETIVKGHPNYELRAKGKVATLACGYQGGPPALIKMG----------- 473

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A++          + K WR+ + R+ +LW  
Sbjct: 474 -----------------------------ALKSGIPEEELPGIVKRWRKANPRIVKLWYA 504

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR------ 577
             +A    +   + +          V  +     L   LPSGRSL Y +           
Sbjct: 505 AEEAALTAVREKRTVPLA-----HGVKYRYKSGTLFADLPSGRSLAYVNPRIKPDPNFGK 559

Query: 578 -----SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                  ++   ++     TYGG+L EN+VQA++RD LAE +M    A Y  V+ VHDE+
Sbjct: 560 DGLVFDGMDQIKKKWMSHRTYGGRLVENLVQAIARDCLAESLMRLDAAEYRTVMHVHDEV 619

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V + P     +   +  +M+    WA GLPL A G+E + Y+K
Sbjct: 620 VLDVPIGT-GSVDHVTGIMSQPIDWAPGLPLSAAGFECEFYQK 661


>gi|160937655|ref|ZP_02085015.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439300|gb|EDP17052.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
          Length = 661

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 219/707 (30%), Positives = 321/707 (45%), Gaps = 82/707 (11%)

Query: 3   TLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQ----V 56
           T+ +D ET S ID+ + G+  YA   D  ++L  + +D   V++ D       P+     
Sbjct: 2   TMNVDIETYSSIDIREAGVYAYASAPDFEILLIGYRYDGQDVKVIDLTDPLADPERDFPD 61

Query: 57  LKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEAL 116
             E L + DV   A+N+ FERT L +     +P  +W CT V A + GLP  L  VGEAL
Sbjct: 62  FWEGLYSPDVIKTAYNANFERTCLASWLGRPMPPEQWRCTAVHAATLGLPGTLGGVGEAL 121

Query: 117 KL--SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDV--TVT 168
            L    QK + GK LI  F   CK      +  RN P H  + W+LF EY + DV    T
Sbjct: 122 GLPEDKQKDKIGKSLIQYFCKPCKPTKTNGMRSRNLPEHAPDKWQLFIEYNRQDVVAEAT 181

Query: 169 REIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
                ++ P++ +EQELW LDQ IND G  +D+ LA  + Q   + + +L QE   LT  
Sbjct: 182 IREKLQIYPVARQEQELWNLDQHINDHGVRLDMDLADKIIQYDGIYQERLKQEARKLTG- 240

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETT---CQRVLSSNKKLTPQAI--QVFNNRMRA 283
            +++   L +LK W F+  GL +  +T+ +    +  L   K         ++   R   
Sbjct: 241 -LNNPNSLPQLKMWFFMTYGLDVPSITKDSIPVIEAQLKELKTTHDVLPGLRMLQIRKEL 299

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
            +++V K   +  A+  DG LRG LQF GA+RTGRW+G +    NLP+      +L + +
Sbjct: 300 GKTSVKKYQAMRHAVCPDGYLRGILQFYGANRTGRWAGRIVQVHNLPQNKIPDLDLARDL 359

Query: 344 THLPT---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
                             + S  +R+  I SEG + VV+D + IEARV+AW+A E+W+L 
Sbjct: 360 VKQEDFDTLELLFEGIPFVFSQLIRTAFIPSEGYRFVVSDFSAIEARVIAWLADEKWRLN 419

Query: 401 AFETGEDLYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            F T   +Y  + A+ F+V     +     R  GKV ELALGY GG  A + M       
Sbjct: 420 VFRTHGKIYEASAAQMFHVPIENIKKGSRLRQQGKVAELALGYGGGFGAMKAMDKAG--- 476

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                                          +   WR+    + 
Sbjct: 477 --------------------------------------TIPDDEIPMIIANWRKASPNIC 498

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR- 577
           +LW     A    IE  + I  +       +        L + LPSGR L Y D      
Sbjct: 499 KLWRNAEAAARAAIEERRTIKLK-----HGLSFSYINRILFIGLPSGRKLAYYDTRIEDD 553

Query: 578 ---------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
                    + ++  T++  R  T+GGKL ENIVQA +RD LA  M   + AGY IV+ V
Sbjct: 554 EKGKSVITYAGVDQETKKWGRLKTWGGKLVENIVQATARDCLAVTMERVSGAGYQIVMHV 613

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDEI+ + P+TD      +  +M     WA+ LPL+ +GYE+  Y+K
Sbjct: 614 HDEIIVDVPETDIDALEKITAIMAQPVPWAQELPLRGDGYETPFYKK 660


>gi|168179450|ref|ZP_02614114.1| DNA polymerase [Clostridium botulinum NCTC 2916]
 gi|182669649|gb|EDT81625.1| DNA polymerase [Clostridium botulinum NCTC 2916]
          Length = 653

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 208/701 (29%), Positives = 315/701 (44%), Gaps = 75/701 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVL- 57
           M TL ID ET   +D+   G  KY E     ++L A+ +DD PV++ D ++   +P+VL 
Sbjct: 1   MRTLAIDVETYCELDIKSVGAYKYCEHPSFEIMLLAYAYDDEPVKIIDIMNGEKIPEVLE 60

Query: 58  KEALEN-TDVTIVAHNSYFERTVLKACF-NLDIPIHRWICTLVLARSNGLPSALKAVGEA 115
            +  E+ + V   A N+ FER  +KA F  L      W CT+V A + GLPS+L  VG+A
Sbjct: 61  FDIYEHYSKVLKTAFNANFERNAIKAHFKGLKCHPGDWECTMVKALTLGLPSSLDMVGKA 120

Query: 116 LKL--SSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           LK     QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V R
Sbjct: 121 LKFEEDKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVER 180

Query: 170 EIFKR--LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           EI         + KE+ELW LDQ INDRG  VD+ L     +  +  + +L +E  +LT 
Sbjct: 181 EIRNLLNRYKTTIKEKELWQLDQHINDRGVRVDLVLVENAIKCDESYQERLKEEAINLTG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             +++     +LK W+    G  +  LT+ +   ++  +K       ++   R   ++++
Sbjct: 241 --LNNPNSPTQLKKWISERVGHEVTSLTKDSIPILIEESKDKN--VKKILELRQLMAKTS 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---T 344
           + K  T++ A   D R+RG LQF GA+RTGRW+G +   QNLP+      E  + +    
Sbjct: 297 IKKYQTMLNARCDDERVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLEEARNLLRNG 356

Query: 345 HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
              T           +S  +R+  I ++G + +VAD + IEARV+A++A EQW+L  F+ 
Sbjct: 357 DFETIEFLFDSIPDTLSQLIRTAFIPTDGNRFIVADFSAIEARVIAYLANEQWRLDVFKE 416

Query: 405 GEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
           G D+Y  + ++ F V   +   +     K                               
Sbjct: 417 GGDIYCASASKMFKVPVEKHGINGHLRAKG------------------------------ 446

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                    +  +                           ++   WR+    +++ W  +
Sbjct: 447 ---------KIAELALGYGGAGGAIRAFDKTGSIPDEDLPKLVSDWRKASPHITQFWWNV 497

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS------ 578
            +A ++ I     +          +    D   L + LPSGR L Y              
Sbjct: 498 DKAAKKAITEKTTVALH-----HGIKFIYDPGVLFIQLPSGRKLSYLRPKIEEGKFGSDV 552

Query: 579 ----YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
                +  T++Q  R  TYG KL ENIVQA +RD LAE M    K G+ +V+ VHDE+V 
Sbjct: 553 ITYEGMEQTSKQWKRIETYGPKLVENIVQAFARDCLAETMARVEKKGFKVVMHVHDELVL 612

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +    +  +   +  +   +  WA GLPLKA+GYE   Y K
Sbjct: 613 DVSK-EIGSVEEICSIFAESIEWAPGLPLKADGYECNYYMK 652


>gi|157311150|ref|YP_001469195.1| polymerase [Streptococcus phage P9]
 gi|119104299|gb|ABL61044.1| polymerase [Streptococcus phage P9]
          Length = 640

 Score =  482 bits (1240), Expect = e-133,   Method: Composition-based stats.
 Identities = 224/696 (32%), Positives = 324/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL+++T    
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAITGLA- 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G     LT+     V    K    +  +V   +++ + S++ K
Sbjct: 238 -NPNSRAQLLPWLKEH-GYSANGLTK---ADVEQELKTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + +   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   I   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + E    
Sbjct: 547 GQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|21910979|ref|NP_665247.1| DNA polymerase A domain-containing protein [Streptococcus pyogenes
           MGAS315]
 gi|28876473|ref|NP_795675.1| putative DNA polymerase A domain [Streptococcus pyogenes phage
           315.6]
 gi|28895334|ref|NP_801684.1| DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50913380|ref|YP_059352.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|21905187|gb|AAM80050.1| putative DNA polymerase A domain - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810580|dbj|BAC63517.1| putative DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50902454|gb|AAT86169.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 640

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 222/696 (31%), Positives = 324/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT   +
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G     LT+     V    K    +  +V   +++ + S++ K
Sbjct: 237 DNPNSRTQLLPWLKEH-GYSASGLTK---ADVEKELKTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  A  SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERARCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + +   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   +   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPVRLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               +   T + TYGGKL ENIVQA +RDILAE ++    AG+ +V  VHDE + E    
Sbjct: 547 GQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLTIEEVNDLMAQAPEWAEGLPLNSEGYITKYYMK 639


>gi|139473888|ref|YP_001128604.1| phage DNA polymerase [Streptococcus pyogenes str. Manfredo]
 gi|209559298|ref|YP_002285770.1| DNA polymerase [Streptococcus phage NZ131.2]
 gi|134272135|emb|CAM30380.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209540499|gb|ACI61075.1| DNA polymerase [Streptococcus phage NZ131.2]
          Length = 640

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 224/696 (32%), Positives = 325/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT   +
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G  +  LT+     V    K    +  +V   +++ + S++ K
Sbjct: 237 DNPNSRAQLLPWLKEH-GYSVNGLTK---ADVEQELKTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +     V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + +   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   I   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + E    
Sbjct: 547 GQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|225871341|ref|YP_002747288.1| phage DNA polymerase [Streptococcus equi subsp. equi 4047]
 gi|225700745|emb|CAW95387.1| putative phage DNA polymerase [Streptococcus equi subsp. equi 4047]
          Length = 640

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 224/696 (32%), Positives = 324/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
           KL  +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLVQEKDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT   +
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G  +  LT+     V    K    +  +V   +++ + S++ K
Sbjct: 237 DNPNSRAQLLPWLKEH-GYSVNGLTK---ADVEQELKTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +     V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + +   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   I   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + E    
Sbjct: 547 GQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|283469578|emb|CAQ48789.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
 gi|283470753|emb|CAQ49964.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
          Length = 653

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 225/705 (31%), Positives = 324/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KESTGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|94989082|ref|YP_597183.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
 gi|94542590|gb|ABF32639.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
          Length = 640

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 227/696 (32%), Positives = 326/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLP++L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHRE-AWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H    W++F  YC  DV V   I 
Sbjct: 119 KLAQEKDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT   +
Sbjct: 179 EKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G     LT+     V    KK   +  +V   +++ + S++ K
Sbjct: 237 DNPNSRAQLLPWLKEH-GYSANGLTK---ADVEQELKKAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + V   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGVVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   I   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPIKLGKIR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               R   T + TYGGKL ENIVQA +RDILAE ++    AGYD+V  VHDE + E    
Sbjct: 547 GQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM+  P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLIIEEVNDLMSQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|268610653|ref|ZP_06144380.1| hypothetical protein RflaF_14297 [Ruminococcus flavefaciens FD-1]
          Length = 658

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 204/713 (28%), Positives = 302/713 (42%), Gaps = 94/713 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ETRS  D+TKCG+  YA+     + L +   DD  V+L+D  +   +P+ + 
Sbjct: 1   MKTIEIDLETRSDRDITKCGVYAYADSPYFAITLMSVSIDDGAVQLYDLANGDRVPEDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP------------------IHRWICTLVLA 100
            AL +  V   A N  FER  L      + P                     W CT++  
Sbjct: 61  TALVDESVVKRAFNVNFERVCLSRYLREEYPQIFRSYSIDADTVGDYLSPVGWQCTMIHC 120

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDR--NKPNHREAWRLFG 158
           R+ GL S L + G ALKL  QKM EGK LI  FC          +  +  +  E W  F 
Sbjct: 121 RTLGLSSTLASAGAALKLEQQKMPEGKALIKYFCVPYDTVDGIPQFHSPADAPEKWETFK 180

Query: 159 EYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT 216
            Y K DV     I +RL   P+     E +YLDQ INDRG  VD+ L      +    + 
Sbjct: 181 AYNKQDVEAELAIDRRLSRFPVPDFIWEQFYLDQEINDRGIRVDMELVEAALTLDAQAKA 240

Query: 217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQV 276
            L  E+  LT   + +   + +L  WL  + G   + L +   + +L + K        V
Sbjct: 241 TLSSEMRRLTG--IENPNSVYQLLEWLGEQ-GYKSDCLDKAAVKELLKTVKDP---VKSV 294

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R+  S+S+V K   +  A  SD R RG   F GASRTGRW+G +   QNLP+     
Sbjct: 295 LELRLMLSKSSVKKYQAMQTAACSDSRARGMFSFYGASRTGRWAGRIIQLQNLPQNHIPD 354

Query: 337 EELDQI---ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
               +      +         D    +S  +R+  +   G K ++AD + IEARV+AW+A
Sbjct: 355 LTEARNTVKYGYYDEVEMFYGDVPDTLSQLIRTAFVPRPGYKFIIADFSAIEARVIAWLA 414

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKM 451
           GE+W++ AF  G D+Y  + ++ F V   +     + R  GKV ELA GY G   A + M
Sbjct: 415 GEKWRMDAFANGADIYCASASKMFGVPVVKHGVNGELRQKGKVAELACGYGGSVGAMKAM 474

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                                                            +  +++   WR
Sbjct: 475 G----------------------------------------GDALNLSDSELKQIVTDWR 494

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY- 570
                + + W  +  A ++ I+               +        L + LPSGR L Y 
Sbjct: 495 DASPNIVKFWWTVDDAVKKAIKQKITTETHG------LQFSYQSKMLFITLPSGRKLCYA 548

Query: 571 -RDVGNNR------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G N+      +Y+    +++  R  +YG K  ENIVQAV+RD+L   M        
Sbjct: 549 HPQIGENQFGGESVTYMGVGASKKWERIESYGPKFVENIVQAVARDLLMFSMQTM--RCC 606

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV  +HDE++ E       +   +   M   P+WA+GL L+A+GYE + YRK
Sbjct: 607 FIVGHIHDEMIIEA--DRRMSLDEVCRQMERTPAWAEGLLLRADGYECEFYRK 657


>gi|258455585|ref|ZP_05703542.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
 gi|257862273|gb|EEV85044.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
          Length = 653

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 225/705 (31%), Positives = 325/705 (46%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|71911263|ref|YP_282813.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94992973|ref|YP_601072.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
 gi|71854045|gb|AAZ52068.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94546481|gb|ABF36528.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
          Length = 640

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 226/696 (32%), Positives = 325/696 (46%), Gaps = 78/696 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLP++L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHRE-AWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H    W++F  YC  DV V   I 
Sbjct: 119 KLAQEKDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT   +
Sbjct: 179 EKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G     LT+     V    KK   +  +V   +++ + S++ K
Sbjct: 237 DNPNSRAQLLPWLKEH-GYSANGLTK---ADVEQELKKAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +       + 
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDID 352

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +   VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F T   
Sbjct: 353 AVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M                
Sbjct: 413 IYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG--------------- 457

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                    A+         + +   WR+ + ++ + W ++ +A
Sbjct: 458 -------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRA 492

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNNRSYL 580
             + I++   I   K R       +  K  L + LPSGR+L Y        D G+   Y 
Sbjct: 493 AIKAIKSRAPIKLGKIR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIYE 546

Query: 581 NTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
               R   T + TYGGKL ENIVQA +RDILAE ++    AGYD+V  VHDE + E    
Sbjct: 547 GQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAIIE---G 603

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 604 SGLIIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|288799805|ref|ZP_06405264.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
 gi|288333053|gb|EFC71532.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
          Length = 726

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 212/697 (30%), Positives = 330/697 (47%), Gaps = 73/697 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET S  ++   G+  Y +  +  ++LFA+  D   V+L D      +P  + 
Sbjct: 80  IKILSIDIETYSDNEI-TNGVHNYVDTPNFEILLFAYSCDGGSVQLVDLAQGEEIPAKIL 138

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL ++++   A N+ FER  +     L +   +W CT + A   GLP++L++ GE LKL
Sbjct: 139 DALTDSNIIKTAFNASFERVCIGKHLGLTLDPSQWHCTQIRALMLGLPASLQSCGEVLKL 198

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             +K+ EG ELI  F   CK         RN P H  + W  F  YC  DV V + I ++
Sbjct: 199 KHKKLREGAELIKYFSIPCKPTKSNGGRTRNLPEHAPDKWAQFKRYCIRDVEVEKAIQRK 258

Query: 175 L-----EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
           +      P++  E+ L+  DQT+ND+G C+D  LA+   ++ D  + +L  E++ +T   
Sbjct: 259 VCNNTLNPVTPFERALYIFDQTMNDKGVCIDSELANNAIRMNDEAQDELFAEMQEITN-- 316

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           + +     +LK WL  + G  ++ L +   + + +   +      +V   R  +S+++V 
Sbjct: 317 LENPNSPVQLKQWLSSKLGRPIQSLAKEDAKELATGASED---VKRVLYLRSMSSKTSVK 373

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---L 346
           K   +  A  SD +L   LQF GA +TGRW+G +    NLPR S     L + +      
Sbjct: 374 KYEAMTLAKCSDNKLHDLLQFYGA-KTGRWAGRIVQVHNLPRNSSKDLALARELVKKNDF 432

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                +  +   I+S  +R+  IA E   L V D + IEARV+AW+AGE+W+LK F    
Sbjct: 433 ELLELTFGNVCDILSQLIRTAFIAKENYTLCVCDFSAIEARVIAWLAGEEWRLKVFRGSG 492

Query: 407 DLYVTTYARSFNVAPAQVTKD--QRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + AR F V    +T D   R  GK+ ELALGY+GGA A + M +           
Sbjct: 493 RIYEASAARMFGVDEKTITHDSPLRQKGKIAELALGYEGGANALKIMGADK--------- 543

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                                   ++   WR     + +LW ++
Sbjct: 544 -------------------------------MGLSDPEIAQIVSGWRNSSPNIVKLWRDV 572

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG---NNRSYL- 580
            +A ++ I + + I  ++   +     +K  N L + LPSGR L Y       N   Y+ 
Sbjct: 573 ERAAKEAILSDRIIKLKQGGLI----FRKTSNILQIKLPSGRLLSYPLAKIVDNKICYMS 628

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP-D 638
            N TTRQ     TYGGKL ENIVQA++RD L E ++   K GY+I   VHDEI+ E P D
Sbjct: 629 QNQTTRQWVDTETYGGKLVENIVQAIARDCLGETILRVDKKGYNICFHVHDEIIAEVPTD 688

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                   + ++  +  ++A  LPLK EGY +  Y K
Sbjct: 689 ESAKALQDIKNIFATPITFAPDLPLKGEGYITPYYLK 725


>gi|66395454|ref|YP_239831.1| ORF004 [Staphylococcus phage 2638A]
 gi|62635881|gb|AAX90992.1| ORF004 [Staphylococcus phage 2638A]
          Length = 653

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D  PV   D       P    
Sbjct: 1   MKYMNIDIETYSSNDISKCGAYKYVEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL + +V   A N+ FER  L   FN ++P   W CT+V     GLP++L  VG
Sbjct: 61  YETFKIALFDPEVRKYAFNANFERVCLAQHFNKEMPPEEWTCTMVNVTRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTR 169
           E L L +QK + GK LI  F   CK         RN P H  + W+ F +YC  DV V  
Sbjct: 121 EVLNLQNQKDKAGKNLIRYFSVPCKPTKVNGGRTRNLPQHDPKKWQQFIDYCVRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++      +EQ+ W LDQ INDRG  +  +L    N++  + + +L ++   +T 
Sbjct: 181 SIATKIKDFPVTKEEQKYWSLDQHINDRGIKLSKSLMLGANELDKISKAELLKQATKITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L      T +A Q+   R++ S+++
Sbjct: 241 --LENPNSPSQLLKWLNEEQGLDIPNLQKKTVQEYLKY---ATGKAKQMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M  D R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCGDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELNIARDFIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG  L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLDIHPQDLLSQLVRTTFTAEEGYALAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPA--QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + A+ F V     +     R  GKV ELALGYQGG  A + M        
Sbjct: 415 FNTHGKIYEASAAQMFGVPVDSIKKGDPLRQKGKVSELALGYQGGPGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A++     +  + +  +WR+ +  +  
Sbjct: 468 ---------------------------------ALDMGIDESELQGLVDSWRKANPNIVA 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
            W     A  +T+   +  +    R          K  L++ LPSGRSL Y       + 
Sbjct: 495 FWKGCQDAAIETVRTRQTHLTHGLR------FYMKKGFLMIELPSGRSLAYPKARVGENS 548

Query: 580 LNTT---------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
             +           R+ T+  TYGGKL ENIVQA +RD+LA  M     AG+ IV  VHD
Sbjct: 549 WGSPVVEFMGLDLNRKWTKLKTYGGKLVENIVQATARDLLAISMYRIEHAGFSIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E PD        + ++M+    WA+GL L ++G+ S  Y K
Sbjct: 609 EVIVEIPDGS-GGLKAIENIMSKPVKWAEGLKLNSDGFTSPFYMK 652


>gi|282919245|ref|ZP_06326980.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317055|gb|EFB47429.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
          Length = 653

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 225/705 (31%), Positives = 325/705 (46%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|262049890|ref|ZP_06022752.1| putative DNA polymerase [Staphylococcus aureus D30]
 gi|259162039|gb|EEW46619.1| putative DNA polymerase [Staphylococcus aureus D30]
          Length = 653

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 225/705 (31%), Positives = 325/705 (46%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKADNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVIEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|170023450|ref|YP_001719955.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
 gi|169749984|gb|ACA67502.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
          Length = 693

 Score =  477 bits (1228), Expect = e-132,   Method: Composition-based stats.
 Identities = 249/697 (35%), Positives = 373/697 (53%), Gaps = 32/697 (4%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L++D ET S   +   G   YA +  ++L A+  DD PV + +      +P  L  AL 
Sbjct: 4   ILWLDLETYSETPIRN-GTHAYAANAEIMLIAWAIDDGPVSVHEFTEPKNLPVPLCTALR 62

Query: 63  NTDVTIVAHNSYFERTVLKACFN-LDIP------IHRWICTLVLARSNGLPSALKAVGEA 115
           + +  + AHNS F+RTVL+        P      + RW  T+V A ++GLP +L  + + 
Sbjct: 63  DGETLVYAHNSQFDRTVLRTHLKSYKWPNVAARDVTRWRDTMVKALAHGLPGSLSDLCDI 122

Query: 116 LKL--SSQKMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIF 172
           L +     K + GK LI  FCK         R  K  H E W+ F +Y   D+   REI 
Sbjct: 123 LGVAQDKAKDKAGKALIQLFCKPRAKNSAIRRATKQTHPEEWKRFIDYAGLDIEAMREID 182

Query: 173 KRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           K+L   + +  EL  W+ DQ INDRG  +D  LA      V++E+ +L    + LT   V
Sbjct: 183 KKLPVWNYQSNELALWHFDQRINDRGVQMDTVLAEAAVSAVEIEQKRLAVRTQDLTDNEV 242

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            ++   + L   +    G+ L D+  +T QR +S    L  +  ++   R++AS ++  K
Sbjct: 243 QAATQRDVLLKHIVEAFGVTLPDMQASTIQRRVSD-PDLPIELRELLAIRLQASTTSTSK 301

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
             TL++ ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRP    E +D  I  L    
Sbjct: 302 YKTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLGQETIDTGIEALKAGC 361

Query: 351 TS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG--- 405
                 + +++IS  +R C++A EGKKLVV+DL+ IE R L W++GE+WKL+AF      
Sbjct: 362 ADLLFDNVMELISSALRGCIVAPEGKKLVVSDLSNIEGRALVWLSGEEWKLQAFRDYDAG 421

Query: 406 --EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
              DLY+  YAR+FN++P  V K QR IGKVMEL LG+ GG  AF   A   GL+L+  A
Sbjct: 422 TGHDLYMLAYARAFNISPDNVDKIQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDGLA 481

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                N       +A+++ +   +    + + +     AC+ +K+ WR  H +    W E
Sbjct: 482 KAALPNVPASIQREAQSWYKASVKQKRTYGLSEQVFI-ACDSLKRMWRNAHPKTVSFWYE 540

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG---NNRSYL 580
           +     + I   +     ++  +     ++D + L + LPSGR++ Y  +       SY+
Sbjct: 541 IEDTVRRAIAAPRQTFTCRKLKI-----RRDGSWLRIQLPSGRAVCYPGIRIDEGKISYM 595

Query: 581 --NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
             N+ +R+  R  TYGGKLTEN+ QA +RD++A  M     +GY+I LTVHDE++ E PD
Sbjct: 596 GINSYSRKWQRLKTYGGKLTENVTQAAARDVMANNMPLIETSGYEITLTVHDEVLTEAPD 655

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           T++F +  L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 656 TEQFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 692


>gi|66395659|ref|YP_240050.1| ORF003 [Staphylococcus phage 47]
 gi|282911107|ref|ZP_06318909.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|297207805|ref|ZP_06924239.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|62636083|gb|AAX91194.1| ORF003 [Staphylococcus phage 47]
 gi|282324802|gb|EFB55112.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|296887521|gb|EFH26420.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|312438063|gb|ADQ77134.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|329724432|gb|EGG60942.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 653

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 224/705 (31%), Positives = 322/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|266623807|ref|ZP_06116742.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
 gi|288864379|gb|EFC96677.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
          Length = 656

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 213/703 (30%), Positives = 309/703 (43%), Gaps = 76/703 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ETRS ID+ K G  KYA+  D  ++LFA+ +++ PV++ D  +   +P  L 
Sbjct: 1   MHHLSIDIETRSSIDIGKAGAYKYAQSPDFEILLFAYQWNNDPVKVIDLKNGEELPCWLM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL + +V   A+N+ FE   L  C   + PI +W CT+      G  + L A G+A+ L
Sbjct: 61  QALADPNVIKHAYNAAFEWYCL-NCAGYETPIEQWRCTMAHGLYCGYTAGLDATGKAIGL 119

Query: 119 --SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               QK+  GK LI  FC   K          N+P H  + W LF EYC  DV   REI 
Sbjct: 120 PQDKQKLTTGKALIRYFCVPCKPTKTNGSRTWNQPWHDTDKWELFKEYCLQDVVTEREIL 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           KRL+  P+  +E+ LW +D  +N  G  VD  L      I  +   +L  E  SLT    
Sbjct: 180 KRLDLFPMPEEEEHLWQMDVLMNAYGVRVDTDLIEGALYIDQISTQRLTDEAISLTGLQ- 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL    G   ++L + T   +L        +  ++   R +  ++++ K
Sbjct: 239 -NPNSAAQLLQWLRD-NGTEADNLQKATVAELLGGI--NPNKVRRMLEIRQQLGKTSIKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A     R+RG  Q+ GA+RTGRW+G +   QNLPR      +  + +       
Sbjct: 295 YVAMDTARGEGDRVRGLTQYYGANRTGRWAGRLVQMQNLPRNYLKTLDYARNLVKAKNYD 354

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +    +S  +R+  I S G K VVAD + IEARV+AW+AGEQW  + F T   
Sbjct: 355 GVRILYGNVPDTLSQLIRTAFIPSAGHKFVVADFSAIEARVIAWLAGEQWVNEVFATHGK 414

Query: 408 LYVTTYARSFNVAPAQVTKD-----QRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           +Y  T ++ F V   ++ K       R  GKV  LALGYQGG  A   M           
Sbjct: 415 IYEATASQMFGVPVERIAKGNPEYSLRQKGKVATLALGYQGGTSALIAMG---------- 464

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                         A++          + + WRQ + R+  LW 
Sbjct: 465 ------------------------------ALQMGLTEEELPDIVQRWRQANPRIKGLWY 494

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRSY- 579
            +  A    +E  +              +   ++ L + LPSGR L Y    +  NR   
Sbjct: 495 AIENAALAVMETAQPQGINGLIFALEGDIIYGQSFLTVRLPSGRKLFYPKPFLKENRFEK 554

Query: 580 -------LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                  +   TR+     TYGGK+ ENIVQA++RD LA  +      G  +V  VHDE+
Sbjct: 555 MAVHYYTVGQQTRKWEVTSTYGGKMVENIVQAIARDCLAVTLERIASKGLQVVFHVHDEV 614

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + + P   E     +  LM     WA GL LK  G+ES  Y K
Sbjct: 615 IIDAP--METTVEEICDLMAEPIPWAPGLVLKGAGFESSYYMK 655


>gi|330862112|emb|CBX72276.1| putative DNA polymerase [Yersinia enterocolitica W22703]
          Length = 699

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 256/704 (36%), Positives = 373/704 (52%), Gaps = 38/704 (5%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
             L+ D ET     + K G   YAE V V++  +  +D PV  WD      MP+ LK  L
Sbjct: 3   KKLWFDSETFCETPI-KNGTHAYAEHVEVMIITYALNDDPVSEWDITSGAKMPEDLKAYL 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEALKL- 118
           ++  + I A NS+F+RT+++      I     RW  T+V A ++GLP  L  + E L + 
Sbjct: 62  QDPSIEIYAQNSHFDRTMMRHDMPSVIAGGIERWRDTMVKALAHGLPGGLGVLCEILGIT 121

Query: 119 -SSQKMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLE 176
               K +EGK LI  FCK         R     H E W+ F +Y   D+   R I K+L 
Sbjct: 122 QDKAKDKEGKALIQLFCKPRAKNSTIHRATSKTHPEEWKRFLKYAGNDIEAMRAIDKKLP 181

Query: 177 PLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             + + +EL  W+ DQ INDRG  +D  LA      V  E+  L +  ++LT   V ++ 
Sbjct: 182 VWNYQGKELALWHFDQLINDRGVQMDTVLAEAAVTAVVDEQKLLAKRTQNLTDNEVQAAT 241

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
             + L   +    G+ L D+ ++T +R ++   +L     ++   R++AS ++  K  TL
Sbjct: 242 QRDALLRHIVESFGVDLPDMQKSTLERRIAD-PELPSVLRELLAIRLQASTTSTSKYKTL 300

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS-- 352
           ++ ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRP    E +D  I  L        
Sbjct: 301 LKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLDQETIDTGIEALKAGCADLL 360

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG------- 405
             + +++IS  +R C++A +GKKLVV+DL+ IE RVLAW+AGE+WKL+AF          
Sbjct: 361 FDNVMELISSALRGCIVAPKGKKLVVSDLSNIEGRVLAWLAGEEWKLEAFRDYDTIIGYD 420

Query: 406 ---------EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
                     DLY   YAR+FN++P  VTK QR IGKVMEL LG+ GG  AF   A   G
Sbjct: 421 EGGEALREGPDLYKLAYARAFNISPDDVTKLQRQIGKVMELGLGFGGGVAAFLTFALVYG 480

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           L+L+  A+    N       +A+++ +   +      + +     AC+ +K+ WR  H  
Sbjct: 481 LDLDELANAALPNVPTSIQREAQSWYQASVKQKRTFGLSEQVFI-ACDSLKRMWRNAHPE 539

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--- 573
               W+E+     + I N K     ++  +     ++D + L + LPSGRS+ Y  +   
Sbjct: 540 TVSFWSEIENTVRRAIINPKQTFVCRKLKI-----RRDGSWLRIQLPSGRSVCYPGIRIE 594

Query: 574 GNNRSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
           G+  SY+  NT +R+  R  TYGGKL EN  QA +RD++A  M      GY+I LTVHDE
Sbjct: 595 GDKISYMGVNTYSRKWQRLKTYGGKLAENATQAAARDVMANNMPLIEARGYEITLTVHDE 654

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++ E PDTD F +  L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 655 VLTEAPDTDAFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 698


>gi|282926447|ref|ZP_06334079.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
 gi|282591776|gb|EFB96847.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
          Length = 653

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 222/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WA+GL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVEWAEGLNLNSDGFTSPFYMK 652


>gi|329730633|gb|EGG67018.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 653

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 224/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|148267473|ref|YP_001246416.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393526|ref|YP_001316201.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|147740542|gb|ABQ48840.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945978|gb|ABR51914.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
          Length = 653

 Score =  475 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|258448861|ref|ZP_05696971.1| DNA polymerase [Staphylococcus aureus A6224]
 gi|257857898|gb|EEV80789.1| DNA polymerase [Staphylococcus aureus A6224]
          Length = 653

 Score =  475 bits (1223), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT++ +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMINSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|21283154|ref|NP_646242.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300911890|ref|ZP_07129333.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|21204594|dbj|BAB95290.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300886136|gb|EFK81338.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|315197712|gb|EFU28046.1| DNA polymerase [Staphylococcus aureus subsp. aureus CGS01]
          Length = 653

 Score =  475 bits (1222), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGVR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257428253|ref|ZP_05604651.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|258419942|ref|ZP_05682901.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282905878|ref|ZP_06313733.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282928293|ref|ZP_06335897.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
 gi|257275094|gb|EEV06581.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257844067|gb|EEV68457.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282331170|gb|EFB60684.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591964|gb|EFB96997.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
          Length = 653

 Score =  475 bits (1222), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|262053228|ref|ZP_06025380.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
 gi|259158878|gb|EEW43970.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
          Length = 653

 Score =  474 bits (1221), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYIKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|49485814|ref|YP_043035.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244257|emb|CAG42684.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 653

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L      T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKAEQGLDIPNLQKKTVQDYLKR---ATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M +D R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCNDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPKDS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257432437|ref|ZP_05608800.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
 gi|257283316|gb|EEV13448.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
          Length = 653

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 324/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKNDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|297590990|ref|ZP_06949628.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|297575876|gb|EFH94592.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
          Length = 653

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AE+  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLNNDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|284024530|ref|ZP_06378928.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           132]
          Length = 653

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 224/705 (31%), Positives = 324/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDTEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKYFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|237738628|ref|ZP_04569109.1| DNA polymerase [Fusobacterium sp. 2_1_31]
 gi|229424111|gb|EEO39158.1| DNA polymerase [Fusobacterium sp. 2_1_31]
          Length = 656

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 216/703 (30%), Positives = 321/703 (45%), Gaps = 76/703 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G  KYA  +D  ++LFA+  D   V++ D      +P  + 
Sbjct: 1   MRTLNIDIETFSSVDIGKSGAYKYAMSDDFQILLFAYSVDGQDVKIIDLAQGEAIPGEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           + L++      A+N+ FE   L     ++ P+ +W CT+V     G  + L A+G A+ L
Sbjct: 61  DLLKDETCIKYAYNAVFEWWCL-NMAGIETPLEQWHCTMVHGLYCGYTAGLAAIGNAMGL 119

Query: 119 --SSQKMEEGKELIARFCKG---ETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
               +K+  G  LI  FC             RN P+H  E W LF EYC  DV    EI 
Sbjct: 120 PQDKKKLTTGSALIRYFCIPCNPTKSNGNRTRNLPHHAPEKWELFKEYCIQDVVTEMEIG 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+  +E +LW LD  +N  G  VD  L +    I  + R  L +E   +T   +
Sbjct: 180 RRLSAFPVPEREWKLWVLDTFMNAYGVRVDSELVNGALYIDALSRANLLEEARDIT--KL 237

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +     +L  WL  E G  +E+L + T  +++ +      +A +V   R   S+++V K
Sbjct: 238 DNPNSTSQLLNWL-EEAGEEVENLQKATVGKMIDTLDD--GKAKRVLEIRQELSKTSVKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              + EAM  D R+RG LQF GA+RTGR++G +   QNLPR      ++ + +       
Sbjct: 295 YKAMDEAMCKDERVRGLLQFYGANRTGRYAGRLVQVQNLPRNYIETLDVARDVIKKGDGE 354

Query: 351 T---SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  +    +S  +R+  I SEG   VV+D + IEARV+AW+AGE+W+++ F+T   
Sbjct: 355 LLEMLYGNIPDTLSQLIRTAFIPSEGNHFVVSDFSAIEARVIAWLAGEEWRMEVFKTHGK 414

Query: 408 LYVTTYARSFNVAPA-----QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           +Y  + ++ F V        +     RA GKV ELALGYQG   A   M +         
Sbjct: 415 IYEASASQMFGVPINTIAKGEENYHLRAKGKVAELALGYQGSVGALTAMGAA-------- 466

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                           +        + +   WR+   R+ ELW 
Sbjct: 467 --------------------------------DMGLTDEEMKDIVDRWRKSSKRIVELWY 494

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR----- 577
            L  A  + +E G+  I +  +          ++   + LPSGR L Y            
Sbjct: 495 ALENAAVEVLETGEPQIVKCVKLAKEYDFIYGQDFFTIELPSGRKLFYPKPFLKENQFGQ 554

Query: 578 -----SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
                  +N TT++     TYGGKLTENIVQA++RD LAE ++     G+ IV  VHDEI
Sbjct: 555 MQMHYMGINQTTKKWEVIPTYGGKLTENIVQAIARDCLAETLLRVKAKGWPIVFHVHDEI 614

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + + P + E     +   MT   SWAKGL L A G+    Y K
Sbjct: 615 ILDVPKSVE--LEEVIKTMTEEISWAKGLILNAAGFTGSYYMK 655


>gi|156603970|ref|YP_001429916.1| hypothetical protein SPTP3102_gp21 [Staphylococcus phage tp310-2]
 gi|154818056|gb|ABS87483.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 650

 Score =  473 bits (1218), Expect = e-131,   Method: Composition-based stats.
 Identities = 224/700 (32%), Positives = 320/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIANK 182

Query: 175 LEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q      K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y   +    S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +      GY IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGYKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVEWAKGLNLNSDGFTSPFYMK 649


>gi|315128370|gb|EFT84381.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           CGS03]
          Length = 653

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 325/705 (46%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDDEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   + EG +L V+D + IEARV+AW A E+W+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKERWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|66395591|ref|YP_239981.1| ORF003 [Staphylococcus phage 3A]
 gi|62635937|gb|AAX91048.1| ORF003 [Staphylococcus phage 3A]
          Length = 650

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 224/700 (32%), Positives = 322/700 (46%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y   +    S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|49483719|ref|YP_040943.1| DNA polymerase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49241848|emb|CAG40540.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 653

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/705 (31%), Positives = 323/705 (45%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AE+  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKNDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|29028629|ref|NP_803318.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|88195276|ref|YP_500079.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|258428683|ref|ZP_05688217.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
 gi|18920553|gb|AAL82293.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|87202834|gb|ABD30644.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|257849738|gb|EEV73702.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
          Length = 650

 Score =  472 bits (1214), Expect = e-131,   Method: Composition-based stats.
 Identities = 223/700 (31%), Positives = 320/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIANK 182

Query: 175 LEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q      K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y   +    S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|238018841|ref|ZP_04599267.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
 gi|237864607|gb|EEP65897.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
          Length = 644

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 217/695 (31%), Positives = 311/695 (44%), Gaps = 75/695 (10%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
            L ID ET S   + K G  +Y +D    ++LFA+ FDD PVE+ D      +P+ + +A
Sbjct: 2   ELSIDVETYSDCPI-KYGAQRYVDDTTFEILLFAYSFDDEPVEVIDMT-KDPLPERVVDA 59

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L N ++T  A N+ FE   LK  F  D     W CT VLA    LP++L  V +AL+L  
Sbjct: 60  LYNKEITKTAFNAAFEMLCLKKYFP-DADYTNWECTSVLALYCSLPASLDNVSKALRLGE 118

Query: 121 QKMEEGKELIARFC---KGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR--L 175
            K   GK LI  F    K             +  E W  + EY + DV V R I KR   
Sbjct: 119 AKDARGKRLIQFFSVPRKPTKTNPKTRNMPEDAPEKWAEYIEYNRQDVVVERAIRKRLLS 178

Query: 176 EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
               + E E W LDQ IN RG  VD+ L        D    +  +  + LT   + +   
Sbjct: 179 LKPPAIEHEYWLLDQDINWRGVKVDMELVDAALACNDEIVEEATESSKILTG--LENPNS 236

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
             +LK WL    G  LE + +     +L+    +     +V  NR     S++ K   + 
Sbjct: 237 TMQLKEWLTARLGYDLETMRKDDVSNLLAQ--DIPSDVRKVLQNRQVLGNSSIKKYLAMK 294

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII---THLPTSITS 352
            A+ SDGR+ G LQF GA R+GRW+G V   QNLPR      +  + +     +      
Sbjct: 295 NAVCSDGRIHGMLQFYGAMRSGRWAGRVVQLQNLPRNYLEDLDTARDVLKSRDVEMLDLL 354

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTT 412
             +P  +I   +R+ ++A +G + +VAD + IEARV+AW+A E+W+   F  G D+Y  +
Sbjct: 355 YGNPGDVIKQLIRTALVAEDGHRFIVADFSAIEARVIAWLAHEKWRQDVFAQGGDIYCAS 414

Query: 413 YARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
            +  F+V   +       R  GKV ELALGY GG  A + M S   +             
Sbjct: 415 ASSMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVGAMKAMDSKGEIPE----------- 463

Query: 471 APEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQ 530
                                              + +AWRQ   R+++ W +   A +Q
Sbjct: 464 ------------------------------KELPGIIEAWRQASPRITKFWKDADSAAKQ 493

Query: 531 TIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRS--------YL 580
            +  G+ +    R     +   K K  L + LPSGR L Y    +G N+          +
Sbjct: 494 VVRTGEPV----RIIQGNIKFFKSKGFLFIELPSGRRLAYARPRLGLNQFGSESIEYDGM 549

Query: 581 NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
           +       R  TYGGKL ENIVQAV+RD LA  M+  +KAGY IV  +HDE+V E P   
Sbjct: 550 DQVKNTWGRVETYGGKLVENIVQAVARDCLAASMLRLSKAGYKIVAHIHDEVVIEAPIG- 608

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +   +  +M     W +GL L A G+E+  Y K
Sbjct: 609 VGSLEEVIDIMCEPEPWNEGLILNAAGFENPYYMK 643


>gi|258445211|ref|ZP_05693406.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
 gi|257855972|gb|EEV78892.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
          Length = 653

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 325/705 (46%), Gaps = 83/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++     + EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   + EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y        S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +R++LA  +     +G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARELLAISIARLEASGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|87161801|ref|YP_494120.1| phage related DNA polymerase family A [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509702|ref|YP_001575361.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294848501|ref|ZP_06789247.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|87127775|gb|ABD22289.1| phage related DNA polymerase, family A [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|160368511|gb|ABX29482.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294824527|gb|EFG40950.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|302333141|gb|ADL23334.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|320140648|gb|EFW32502.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142780|gb|EFW34583.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 650

 Score =  471 bits (1212), Expect = e-130,   Method: Composition-based stats.
 Identities = 222/700 (31%), Positives = 321/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T   + +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y        S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGVR------FYMKKGFLMIELPSGRALAYPKASVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|295407651|ref|ZP_06817440.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297246752|ref|ZP_06930567.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
 gi|294967465|gb|EFG43505.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297176378|gb|EFH35651.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
          Length = 650

 Score =  471 bits (1212), Expect = e-130,   Method: Composition-based stats.
 Identities = 222/700 (31%), Positives = 321/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T   + +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y        S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|215401125|ref|YP_002332380.1| putative DNA polymerase [Staphylococcus phage phiSauS-IPLA35]
 gi|215260476|gb|ACJ64606.1| gp17 [Staphylococcus phage phiSauS-IPLA35]
          Length = 650

 Score =  470 bits (1210), Expect = e-130,   Method: Composition-based stats.
 Identities = 226/700 (32%), Positives = 325/700 (46%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSNNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + DV   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPDVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++     + EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKDQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDSLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y        S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPKDS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|209363571|ref|YP_002267989.1| DNA polymerase [Staphylococcus phage phi2958PVL]
 gi|208973072|dbj|BAG74388.1| DNA polymerase [Staphylococcus phage phi2958PVL]
          Length = 650

 Score =  469 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 222/700 (31%), Positives = 321/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++     + EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T   + +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q      K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y        S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPADWAKGLNLNSDGFTSPFYMK 649


>gi|323440323|gb|EGA98037.1| phage related DNA polymerase family A [Staphylococcus aureus O11]
          Length = 650

 Score =  468 bits (1205), Expect = e-129,   Method: Composition-based stats.
 Identities = 224/700 (32%), Positives = 321/700 (45%), Gaps = 83/700 (11%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPVHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++       EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTEIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M             
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------------ 464

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                       A+E        + +  +WR  +  +   W   
Sbjct: 465 ----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKAC 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG-NNRSYLNTT 583
            +A   T+++ K       R          K  L++ LPSGR+L Y        S+ +  
Sbjct: 497 QEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKASVGENSWGSQV 550

Query: 584 --------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                    R+ ++  TYGGKL ENIVQA +RD+LA  +     + + IV  VHDE++ E
Sbjct: 551 VEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASVFKIVGHVHDEVIVE 610

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 611 IPRGS-NGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|225405823|ref|ZP_03761012.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
 gi|225042637|gb|EEG52883.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
          Length = 668

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 212/708 (29%), Positives = 305/708 (43%), Gaps = 80/708 (11%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKE- 59
            L ID ETRS +D++K G  +YA+  D  ++LFA+ +DD PVE+ D   D   P  + E 
Sbjct: 5   HLSIDIETRSSVDISKAGAYRYAQSPDFEILLFAYQWDDGPVEVIDLTADESFPPEIWEE 64

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL- 118
           AL + DV   A+N+ FE   L        P+ +W CT+      G  + L A G+A+ L 
Sbjct: 65  ALRDPDVIKHAYNAAFEWYCLNRA-GYATPLDQWRCTMAHGLYCGYTAGLDATGKAIGLP 123

Query: 119 -SSQKMEEGKELIARFC---KGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFK 173
              QK+  GK LI  FC   K          N+P +  + W LF EYC+ DV    EI +
Sbjct: 124 QDKQKLAVGKALIRYFCVPCKPTKSNGGRTWNQPRHDPDKWTLFKEYCRQDVVTEHEILR 183

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           RL   P+   E+ LW LD  +N  G  VD  L      + +V   KL  E   LT   + 
Sbjct: 184 RLNFFPMPEDEERLWQLDVAMNAYGVRVDTKLIAGALYVDEVSTEKLTAEAVELTG--LD 241

Query: 232 SSRCLEKLKTWLFLETGLHLED------LTETTCQRVLSSNKKLTPQAIQVFNNRMRASR 285
           +     +L  W+      H +D      L + T +  L     L     ++   R +  +
Sbjct: 242 NPNSGAQLVPWINAHNKEHPDDPDLLADLRKETVEEALKDRDNLPEDVARMLEIRQQLGK 301

Query: 286 SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           ++V K   +  A     R+RG  Q+ GA+RTGRW+G +   QNLPR      +  + +  
Sbjct: 302 TSVKKYVAMDVARGEGDRVRGLTQYYGANRTGRWAGRLVQLQNLPRNYLKTLDYARELVK 361

Query: 346 LPT---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
                       +    +S  +R+  I SEG K VVAD + IEAR +AW+AGEQW  + F
Sbjct: 362 AKNYDGLRILYGNVPDTLSQLIRTAFIPSEGHKFVVADFSAIEARAIAWLAGEQWVNEVF 421

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKD-----QRAIGKVMELALGYQGGAKAFQKMASTTGL 457
            T   +Y  T A+ F V   ++TK       R  GKV  LALGYQG   A   M      
Sbjct: 422 ATHGKIYEATAAQMFGVPVERITKGNPEYSLRQKGKVATLALGYQGSTAALIAMG----- 476

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                              A++          +   WR  + R+
Sbjct: 477 -----------------------------------ALKMGLTEDELPDIVTRWRNANKRI 501

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGN 575
             LW  +     + ++  +              +   ++ L + LPSGR L Y    +  
Sbjct: 502 CGLWYAVENTALRVMQTAQPQGLNGLIFALEGDLIYGQSFLTVRLPSGRKLYYPKPFLQE 561

Query: 576 NRS--------YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLT 627
           NR          +   TR+   + TYGGK+TENIVQA++RD LA  +    + G   V  
Sbjct: 562 NRFGKQAIHYYAVGQQTRKWEIDSTYGGKMTENIVQAIARDCLAVTLRRIAQKGLQTVFH 621

Query: 628 VHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           VHDE++ + P   E     +  LM     WA GL LK  G+ES  Y K
Sbjct: 622 VHDEVIIDAP--METTVDEICDLMAEPIPWAPGLILKGAGFESSYYMK 667


>gi|41179402|ref|NP_958711.1| Bbp42 [Bordetella phage BPP-1]
 gi|45569535|ref|NP_996604.1| DNA polymerase [Bordetella phage BMP-1]
 gi|45580786|ref|NP_996652.1| DNA polymerase [Bordetella phage BIP-1]
 gi|40950141|gb|AAR97707.1| Bbp42 [Bordetella phage BPP-1]
          Length = 688

 Score =  461 bits (1186), Expect = e-127,   Method: Composition-based stats.
 Identities = 270/694 (38%), Positives = 380/694 (54%), Gaps = 26/694 (3%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+TLF+D ET   + +   G   YAE   V+LFA+  D+ PV +WD      MP  L+ A
Sbjct: 1   MSTLFLDLETYCEVPIQN-GTHAYAEKAEVLLFAYALDNGPVYVWDAASGEKMPDDLRWA 59

Query: 61  LENTDVTIVAHNSYFERTVLKACF-NLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
           L + +V + AHNS+F+RTVL+    +  + + RW  T+V A ++ LP AL  + + LK+ 
Sbjct: 60  LIDENVALCAHNSHFDRTVLRHAMPDYPLALPRWRDTMVKALAHSLPGALGDLCDILKVP 119

Query: 120 SQK--MEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLE 176
           + K   + GK+LI  FCK         R  +  H   W  F EY   D+   R I ++L 
Sbjct: 120 TDKAKDKAGKQLIMLFCKPRPATSKLRRATRETHPAEWAKFVEYAGLDIEAMRVIDQKLP 179

Query: 177 PLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             + +  EL  W+LDQTINDRG  VD  LAH   + V+  +  L      +T G V ++ 
Sbjct: 180 AWNYQGTELALWHLDQTINDRGVMVDTDLAHAAIRAVERTQKVLAARTSDITLGAVQAAT 239

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
             + +   +    GL L D+ ++T +R ++    L  +  ++   R++AS ++  K  TL
Sbjct: 240 QRDAMLRHVLAAYGLDLPDMQQSTLERRIAD-PDLPAELRELLGIRLQASTTSTSKYKTL 298

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS-- 352
            + ++SDGRLRGTLQF GASRTGRW+G +F PQNLPRP    + +++ I  L        
Sbjct: 299 AKGVSSDGRLRGTLQFNGASRTGRWAGRLFQPQNLPRPVLKQDAIERGIAALKADCADLL 358

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG-----ED 407
             + +++ S  +R C++A EGKKLVVADL+ IE R++AW+AGE WKL AF         D
Sbjct: 359 FANVMELTSSAIRGCIVAPEGKKLVVADLSNIEGRMIAWLAGEDWKLAAFREFDDGAGPD 418

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           LY   YA++F V+P  V KDQR IGKVMEL LGY+GG  AF   A+T G++L+  A    
Sbjct: 419 LYKLAYAKAFAVSPDSVDKDQRQIGKVMELMLGYEGGVGAFLTGAATYGIDLDAMADAAW 478

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
            +   +   +AE F  W  E               C+ +K+ WR+ H  VS  W EL +A
Sbjct: 479 PSIPADIIAEAEQFLAWRTEQRLGDFGLKPKTFVVCDALKRLWRRAHPAVSSFWKELEEA 538

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYL--N 581
               +            D   +  ++D   L + LPSGR L Y     D     SY+  N
Sbjct: 539 ARLAVLRPGTT-----YDCRTLKARRDGAWLRIRLPSGRFLCYPSPQLDDAGKLSYMGVN 593

Query: 582 TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDE 641
             +R+ +R  TYGGKL EN+ QA SRD+LA  M     AGY IVL+VHDE + E  D DE
Sbjct: 594 QYSRKWSRLKTYGGKLAENVTQAASRDVLAANMPAIEAAGYQIVLSVHDENITEADDRDE 653

Query: 642 FNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           F+A+ L  LM +NP WA GLPL A G+E+ RYRK
Sbjct: 654 FSAAHLAGLMATNPPWAAGLPLAAAGFEAYRYRK 687


>gi|268610175|ref|ZP_06143902.1| family A DNA-dependent DNA polymerase [Ruminococcus flavefaciens
           FD-1]
          Length = 654

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 198/709 (27%), Positives = 309/709 (43%), Gaps = 90/709 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+++CG+ +YAE     ++L ++  D  PV   D      +P  + 
Sbjct: 1   MKQLTIDIETASDEDISECGVYRYAESEYFDLLLVSYSIDGGPVATVDIDSGDTLPDEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF--------------NLDIPIHRWICTLVLARSNG 104
            AL +  V   A N  FER  L                     I    W C ++ +R  G
Sbjct: 61  SALTDKSVIKKAFNVNFERVCLSVYLRRNYPEIAGFEDAVGNYIAPESWHCDMIHSRYLG 120

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDR--NKPNHREAWRLFGEYCK 162
           + S+L  +G+ L+L  +K++EGK+LI  FC     +       +K +  + W+ F EY +
Sbjct: 121 MMSSLDDMGKLLRLKEKKLDEGKDLIKYFCTLHQDKQGNLLFYDKSDAPKKWKEFIEYNR 180

Query: 163 GDVTVTREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            DV V  +I + L   P+     E +Y+DQ INDRG  VD   A    ++    + +L  
Sbjct: 181 RDVEVELKIQRLLSEMPVPDFIWEEFYIDQRINDRGILVDTKFAEKAVELDSNVKKELFP 240

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNR 280
           +L+ LT   + +     ++K WL +  G+  + L + +   +L           +V    
Sbjct: 241 KLKELT--RLDNPNSPAQMKDWL-MRQGIEADSLDKKSMPLLL---ASAPDDVKEVLMLY 294

Query: 281 MRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD 340
            + S+S+V K +T++ A   DGR RG   F GA+RTGR++G +   QNLP+    +    
Sbjct: 295 QQLSKSSVSKYHTMLGASCKDGRARGMFNFYGANRTGRFAGRIIQLQNLPQNHLDNLAET 354

Query: 341 QIITH---LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
           + +     L        D   ++S  +R+  I  EGKK VVAD + IEARV++W+AGE W
Sbjct: 355 KWLIKSGDLDAVKERFEDIPDVLSQLIRTAFIPPEGKKFVVADFSAIEARVISWLAGETW 414

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +++AF  GED+Y    A+ F V   +       R  GK+ ELA GY G   A + M    
Sbjct: 415 RMEAFANGEDIYCACAAKMFGVPVEKNGVNGHLRQKGKIAELACGYGGSIGAIKAMG--- 471

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
                                                  E          + + WR+   
Sbjct: 472 -------------------------------------GTELNLTDDELYSLVEDWRKTSP 494

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            + +LW+++     + I +  ++   +      +    +   L + LPSGR L Y     
Sbjct: 495 NIVKLWSDVQSVAVKVITDQSSMTFGR------LKFSYEIGILFIELPSGRRLAYVRPKV 548

Query: 576 N--------RSYLNTTT-RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
                     +Y      ++  R  TYG KL ENI Q ++RD+L   M        DIV 
Sbjct: 549 EKDDNGKTIITYEGVGDNKKWLRLETYGAKLVENITQGIARDLLLHSMAAM--KDMDIVG 606

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDE++ E           + HLM   P WA+GL L+A+GYE + Y K
Sbjct: 607 HVHDEVIVECDPD--TTVVQVCHLMEQTPDWAEGLLLRADGYECEFYMK 653


>gi|227872576|ref|ZP_03990912.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
 gi|227841577|gb|EEJ51871.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
          Length = 643

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 202/699 (28%), Positives = 299/699 (42%), Gaps = 81/699 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S ID+ K G  +YA  E   ++LFA+ FD   V++ D  +   +P  + 
Sbjct: 1   MRHLSIDIETFSDIDIQKAGAYRYAQSEQFRIMLFAYSFDGEEVQVVDLENGEEIPHFIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL++ +V   A+N+ FE   L  C  +  P+ +W CT+V A    LP+ L   GEAL +
Sbjct: 61  TALQDMEVIKHAYNAAFEWYCL-NCAGIKTPLDQWQCTMVHAMYLSLPAGLANTGEALGI 119

Query: 119 SSQKMEE--GKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLE 176
           +  K +   GK+LI  FC          +        W+ F EY + DV    EI  RL 
Sbjct: 120 AEDKKKSAVGKQLIRYFCV---------KPYKPDAVKWKAFKEYNRQDVVSEMEIENRLS 170

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P+   E E W  D  +N  G  VD  L +   +I +    +L  E   LT   + +  
Sbjct: 171 GFPVPELEWERWRQDIAMNAYGVKVDTELVNGAIKIQEQCEEELLNEAVRLT--QLENPN 228

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
              +L  W+  + G  LE+  + T +  L     L  +  +V   R +  +++V K   +
Sbjct: 229 SPTQLLNWVNAQ-GYPLENTQKATIESALKE--DLPLKVRRVLEIRQQLGKTSVKKYEAM 285

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI---ITHLPTSIT 351
              +    R+RG  QF GAS+TGR+SG +   QNLPR         +         T   
Sbjct: 286 TNTIGEGDRVRGISQFYGASKTGRFSGRLVQMQNLPRNYLEPLAETRECVKRQDYETLKL 345

Query: 352 SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
                   +S  +R+  I S G + VVAD + IEARV+AW+A E W  + F T   +Y  
Sbjct: 346 LFDSIPDTLSQLIRTAFIPSTGNQFVVADFSAIEARVIAWLAKETWVQEVFATHGKIYEA 405

Query: 412 TYARSFNVAPAQVTKDQRAIG-----KVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
           T ++ F+V   ++ K           KV  LALGYQGG  A   M               
Sbjct: 406 TASQMFHVPIEKIAKGNPEYALRQKGKVATLALGYQGGTNALISMG-------------- 451

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                     A++          +   WR  + R+  LW+ +  
Sbjct: 452 --------------------------ALKMGLSEEELPEIVTRWRAANQRIVALWSAVGS 485

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSY----- 579
              +T+ +G+A             +K     L + LPS R L Y    +G N+       
Sbjct: 486 YALRTVRDGRARQVNGLIFRMEQDLKHGLRFLTIELPSKRKLFYCKPYIGLNQFGGESLY 545

Query: 580 ---LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
               N TT++     T+GGKL ENIVQ ++RD L E +   T  GY IV  VHDE++ + 
Sbjct: 546 FYTQNQTTKKWEESSTFGGKLVENIVQGIARDCLCETLDRITSKGYRIVFHVHDEVIVDA 605

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               +     L  +M     WAKGL LK  G+  + Y+K
Sbjct: 606 --GMDLTVEELCGIMAEPIPWAKGLILKGAGFSGQFYQK 642


>gi|312897720|ref|ZP_07757136.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
 gi|310621104|gb|EFQ04648.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
          Length = 654

 Score =  454 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 202/700 (28%), Positives = 302/700 (43%), Gaps = 72/700 (10%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET SP D++  G+ KY+E  +  ++LF++ +    V + D      +P  + 
Sbjct: 1   MRHLNIDIETYSPNDIS-FGVYKYSESEEFEILLFSYAYAFGEVHVVDLASGETIPDDVV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L+  +V   A+N+ FE T L         + +W CT++     G P  L  +G+AL L
Sbjct: 60  LDLKRDEVIKHAYNAQFEITCLNRA-GYQTFVEQWRCTMIHGAYLGYPMGLAKLGKALGL 118

Query: 119 SSQKMEE--GKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
           +  KM++  G  LI  F   CK         RN P H  + W  +  Y K DV    E +
Sbjct: 119 TQDKMKDKAGAALIRYFSVPCKPTKKNGGRTRNLPKHDPDKWAAYIAYNKQDVVTEMECY 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+  + ++ W +D  +N  G  +D  L      I +  +  L +E   LT   +
Sbjct: 179 RRLSAFPVPEEVEKQWQVDIRMNATGVGIDRQLVDGALTIDEENKKALLEEAYELTG--L 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           S+     +L  WL   T L LE LT+ +     ++       A +V   R + ++S+V K
Sbjct: 237 SNPNSRNQLLDWLNSNTNLELEKLTKDSVA---AAMTDADDLAKKVLTIRKKLAKSSVSK 293

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A   DGRLRGTLQF GA+RTGRW+G +   QNLPR   ++ +  + +       
Sbjct: 294 YEMMASATGQDGRLRGTLQFYGANRTGRWAGRLLQVQNLPRNYITNLDTARSLVKASNRV 353

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  D    +S  +R+ +IA EG  L VAD + IEARV+AW++GE W+ K F  G D
Sbjct: 354 GLGLLFGDVSDTLSQLIRTAIIAKEGYTLCVADFSAIEARVIAWLSGETWRQKVFAEGGD 413

Query: 408 LYVTTYARSFNVAPAQV--TKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           +Y  + +  F V   +       R  GKV ELALGYQGG  A + M              
Sbjct: 414 IYCASASSMFGVPVVKHGVNGHLRQKGKVAELALGYQGGVNALKAMG------------- 460

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                                      A++          +   WRQ    + + W  + 
Sbjct: 461 ---------------------------ALDMGLTEEELPNIVGLWRQASPNIVKFWYTVE 493

Query: 526 QAFEQTIENGKAIIA-RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS------ 578
           +A   T+  G  +           V        + + LPSGR L Y D     +      
Sbjct: 494 KAAVYTVTTGNPMTLDHGITFRLEVDPFYGYRYMTIELPSGRKLFYPDPHIKLNNFDKEA 553

Query: 579 --YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
             +          E TYGGKL ENI QAV+RD LA  +M  +  G   ++ +HDE V E 
Sbjct: 554 VHFKTQLNNAWVTESTYGGKLVENITQAVARDCLALTLMRLSGNGLPAIMHIHDEAVIEV 613

Query: 637 PDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P  +      ++         WA+GL L A G+ +  Y K
Sbjct: 614 PKDEADEYLDIVEKTFALPIPWAEGLALTAAGFTNDYYMK 653


>gi|282533171|gb|ADA82280.1| putative DNA polymerase [Escherichia phage K1G]
          Length = 726

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 249/730 (34%), Positives = 344/730 (47%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDV--CVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD PV++WDC +   MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN   F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L     S  E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+          + +  ++T   +  ++  L   A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRELAPAH---RIHNAQKSTLNDL-LADDDLPDDARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL- 346
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPA---QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           D+Y  T  + F + P    +  KD R IGK  EL LGY GG  AF + A   GL+L   A
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMA 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENH------------PEHAIEDLFIGTACERVKKAWR 511
             +        W        W +                   I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDYIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYM--------KKDKNNLILMLP 563
           + H      W ++  A    I N         R V             K     L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYR------------------DVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y                   +V       N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|282534222|gb|ADA82330.1| putative DNA polymerase [Escherichia phage K1H]
          Length = 726

 Score =  452 bits (1162), Expect = e-124,   Method: Composition-based stats.
 Identities = 248/730 (33%), Positives = 343/730 (46%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDV--CVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD PV++WDC +   MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN   F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L     S  E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+          + +  ++T   +  ++  L   A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRELAPAH---RIHNAQKSTLNDL-LADDDLPDDARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL- 346
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPA---QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           D+Y  T  + F + P    +  KD R IGK  EL LGY GG  AF + A   GL+L    
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMT 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENH------------PEHAIEDLFIGTACERVKKAWR 511
             +        W        W +                   I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYM--------KKDKNNLILMLP 563
           + H      W ++  A    I N         R V             K     L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYR------------------DVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y                   +V       N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|15837285|ref|NP_297973.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9105565|gb|AAF83493.1|AE003912_5 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 270/726 (37%), Positives = 366/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     +P  L  AL 
Sbjct: 10  ILWGDLETYSPVPMAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           +  V +  HNS+F+RTVL     +DIP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  DPAVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEH 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL   +
Sbjct: 128 AKDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHN 187

Query: 180 S--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               E  LW+LDQTINDRG  +D  L     + V+  +  L Q  E+LT G V ++   +
Sbjct: 188 YAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L    G+ L D+ + T  R +  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLQHLNTAHGVALPDMQQHTVARCV-DDPALPETVRELLSIRRQASSTSTAKYQALLHC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +          D
Sbjct: 307 TSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKAGCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA + KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPKNKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGTW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  V+K+QR IGKV 
Sbjct: 427 HTGAAITHGALRGAPIALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   + A     W + NH      
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMAAQAAL--PPLLLQQATELLEWTKANHRPTFDL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + ++  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETA-----HTCCGITVQYRR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG++
Sbjct: 660 LAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGFD 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 TYRYRK 725


>gi|15839115|ref|NP_299803.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9107731|gb|AAF85323.1|AE004059_13 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 270/726 (37%), Positives = 366/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     +P  L  AL 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           +  V +  HNS+F+RTVL     +DIP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  DPGVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEH 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL   +
Sbjct: 128 AKDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHN 187

Query: 180 S--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               E  LW+LDQTINDRG  +D  L     + V+  +  L Q  E+LT G V ++   +
Sbjct: 188 YAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L    G+ L D+ + T  R +  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLQHLNTAHGVALPDMQQHTVARCV-DDPALPETVRELLSIRRQASSTSTAKYQALLHC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +          D
Sbjct: 307 TSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKADCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGCW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  V+K+QR IGKV 
Sbjct: 427 HTGAAITHGALRAAPLALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   ++A     W + NH      
Sbjct: 487 ELALGYGGGVGAFAAFAALYHIDLEAMAAQ--AVFPPLLLQEATELLEWTKANHRPTFDL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + ++  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETT-----HTCCGITVQYRR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG++
Sbjct: 660 LAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGFD 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 TYRYRK 725


>gi|83648986|ref|YP_437421.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
 gi|83637029|gb|ABC32996.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
          Length = 911

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 109/705 (15%), Positives = 203/705 (28%), Gaps = 162/705 (22%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
            T   D ET S           Y E   ++  +F  +          HD           
Sbjct: 332 KTFSFDTETTSLN---------YME-AEIVGVSFAVEPGKAAYVPVAHDYMGAPEQLERD 381

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKA 111
            +   LK  LE+     +  N  ++  VL     + +       T++ +      +    
Sbjct: 382 KVLAALKPLLEDPAYRKIGQNLKYDAHVLANH-GVQLNGIA-EDTMLESYVLNSTAN--- 436

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
                +     +   K L       E       +    ++ +    G Y   D  +T ++
Sbjct: 437 -----RHDMDTLAS-KHLGRETIHFEDIAGKGAKQLTFNQISLEQAGPYAAEDADITLQL 490

Query: 172 FKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
              L P               E  L  +   +  RG  VD     T +Q +     +L++
Sbjct: 491 HHALNPKLKKEGRLEQVYRDIELPLVPVLMRMEHRGALVDSQRLRTHSQELAERMLELEE 550

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETG----LHLEDLTETTCQRVLSSNKKLTPQAIQV 276
           E          +    ++L+   + + G            +T + VL    +       +
Sbjct: 551 EAYEKAGQK-FNLGSPKQLQEIFYEKLGFDIIKKTPKGQPSTAEPVLQELAEKYELPRVL 609

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   S+      + L E +N       T      + TGR S      QN+P  +   
Sbjct: 610 LEYR-GLSKLKSTYTDKLPEMINPRTGRVHTSYQQAVAATGRLSSSDPNLQNIPVRNEQG 668

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA +G KL+ AD + IE R++A ++G++
Sbjct: 669 RR-------------------------IRQAFIAPKGCKLISADYSQIELRIMAHLSGDE 703

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             LKAF  G D++  T A  FNVA  +V+ +QR   K +                    G
Sbjct: 704 GLLKAFSEGLDVHQATAAEVFNVAFDEVSSEQRRKAKAIN--------------FGLIYG 749

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++    A  +                                  +  +     + +++  
Sbjct: 750 MSAFGLARQIHVE------------------------------RSEAQSYIDKYFERYPG 779

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V    N +    + T                            +    GR L   D+ ++
Sbjct: 780 VLNYMNRIRAEAQDT--------------------------GYVETLFGRRLYLPDIRSS 813

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA-------GYDIVLTVH 629
                   +   R            +Q  + DI+   M+               +++ VH
Sbjct: 814 N---RNLQQAAERTAINAP------MQGTAADIIKRAMLAVDAWLEGDSAPPAKMIMQVH 864

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE++ E  ++        L  +M+S       +PL  E      +
Sbjct: 865 DELILEVEESAVEAVKEKLTQIMSSAAD--LNVPLLVEAGVGNNW 907


>gi|282535272|gb|ADA82478.1| putative DNA polymerase [Escherichia phage K1ind3]
 gi|282547373|gb|ADA82429.1| putative DNA polymerase [Escherichia phage K1ind2]
          Length = 726

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 248/730 (33%), Positives = 344/730 (47%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDV--CVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD  V++WDC     MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEHVQVWDCTDGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN   F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L     S  E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+          + +  ++T   +  ++  L   A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRELAPAH---RIHNAQKSTLNDL-LADDDLPDDARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL- 346
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPA---QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           D+Y  T  + F + P    +  KD R IGK  EL LGY GG  AF + A   GL+L   A
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMA 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQ------------ENHPEHAIEDLFIGTACERVKKAWR 511
             +        W        W +            ++     I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGEKDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYM--------KKDKNNLILMLP 563
           + H      W ++  A    I N         R V             K     L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYR------------------DVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y                   +V       N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|90019722|ref|YP_525549.1| DNA polymerase I [Saccharophagus degradans 2-40]
 gi|89949322|gb|ABD79337.1| DNA polymerase I [Saccharophagus degradans 2-40]
          Length = 926

 Score =  448 bits (1153), Expect = e-123,   Method: Composition-based stats.
 Identities = 106/705 (15%), Positives = 207/705 (29%), Gaps = 169/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S           Y E   V+  +F             HD            + 
Sbjct: 351 AFDTETTSLN---------YME-AKVVGVSFAVAPGEAAYVPFGHDYLGAPEQLSEEQVL 400

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA---LKA 111
             LK  LE+ +V  V  N  ++ +VL     + +       T++ +      +    +  
Sbjct: 401 GKLKPLLEDENVKKVGQNLKYDASVLANH-GIALQGIA-FDTMLESYVVNSTANRHDMDT 458

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +  A          G   I+     E       +    ++        Y   D  +T  +
Sbjct: 459 LALAH--------LGHTNISF----EEIAGKGAKQLTFNQIQLDQAAPYAAEDADITLRL 506

Query: 172 FKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               E  L  +   +   G  +D  +    +  +  +  ++ +
Sbjct: 507 HQALWPQVEAVEGIKSLFENVELPLVPVLSKVERTGALIDATILGQQSAELAADLERIQR 566

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           E   L      +    ++L   LF + G+ +   T+    +T + VL       P    +
Sbjct: 567 EAWELAG-EEFNLASPKQLGVILFEKLGIPVIKKTKTGAPSTAEEVLQELALDYPLPALL 625

Query: 277 FNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
              R   ++      + L   +N   GR+  +      + TGR S      QN+P  + +
Sbjct: 626 LEQR-GLAKLKSTYTDKLPTMINPHTGRVHTSYNQAV-TATGRLSSTDPNLQNIPIKTEA 683

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       VR   IA EG ++V AD + IE R++A ++G+
Sbjct: 684 GRR-------------------------VRKAFIAPEGYRIVAADYSQIELRIMAHLSGD 718

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +    AF  G D++  T A  F  +   VT +QR   K +                    
Sbjct: 719 EGLTNAFNQGLDVHSATAAEVFGTSVESVTPEQRRSAKAINF--------------GLIY 764

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        +R    +  ++ 
Sbjct: 765 GMS------------------------------AFGLARQLHIGRNDAQRYIDTYFDRYP 794

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V+    ++    ++                          +  +    GR L   ++  
Sbjct: 795 GVARYMEDIRVFAKE--------------------------HGYVETLMGRRLYLPEINA 828

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVH 629
           +            R            +Q  + DI+ + M++        K    +++ VH
Sbjct: 829 SNGMRRQA---AERTAINAP------MQGSAADIIKKAMIDVDKWLSTLKVDAKMIMQVH 879

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +       + L  +M++       +PL  E      +
Sbjct: 880 DELVLEVAEDQIEPVTATLCDIMSAALK--LDVPLLVEAGVGMNW 922


>gi|332160957|ref|YP_004297534.1| putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665187|gb|ADZ41831.1| Putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 669

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 245/673 (36%), Positives = 358/673 (53%), Gaps = 37/673 (5%)

Query: 33  FAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIH- 91
             +  +D PV  WD      MP+ LK  L++  + I A NS+F+RT+++      I    
Sbjct: 3   ITYALNDDPVSEWDITSGAKMPEDLKAYLQDPSIEIYAQNSHFDRTMMRHDMPSVIAGGI 62

Query: 92  -RWICTLVLARSNGLPSALKAVGEALKL--SSQKMEEGKELIARFCKGETHECLYDR-NK 147
            RW  T+V A ++GLP  L  + E L +     K +EGK LI  FCK         R   
Sbjct: 63  ERWRDTMVKALAHGLPGGLGVLCEILGITQDKAKDKEGKALIQLFCKPRAKNSTIHRATS 122

Query: 148 PNHREAWRLFGEYCKGDVTVTREIFKRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAH 205
             H E W+ F +Y   D+   R I K+L   + + +EL  W+ DQ INDRG  +D  LA 
Sbjct: 123 KTHPEEWKRFLKYAGNDIEAMRAIDKKLPVWNYQGKELALWHFDQLINDRGVQMDTVLAE 182

Query: 206 TLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSS 265
                V  E+  L +  ++LT   V ++   + L   +    G+ L D+ ++T +R ++ 
Sbjct: 183 AAVTAVVDEQKLLAKRTQNLTDNEVQAATQRDALLRHIVESFGVDLPDMQKSTLERRIAD 242

Query: 266 NKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFP 325
             +L     ++   R++AS ++  K  TL++ ++ DGRLRGTLQF GASRTGRW+G +F 
Sbjct: 243 -PELPSVLRELLAIRLQASTTSTSKYKTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQ 301

Query: 326 PQNLPRPSRSHEELDQIITHLPTSITS--DPDPLQIISDCVRSCVIASEGKKLVVADLAG 383
           PQNLPRP    E +D  I  L          + +++IS  +R C++A +GKKLVV+DL+ 
Sbjct: 302 PQNLPRPVLDQETIDTGIEALKAGCADLLFDNVMELISSALRGCIVAPKGKKLVVSDLSN 361

Query: 384 IEARVLAWMAGEQWKLKAFETG----------------EDLYVTTYARSFNVAPAQVTKD 427
           IE RVLAW+AGE+WKL+AF                    DLY   YAR+FN++P  VTK 
Sbjct: 362 IEGRVLAWLAGEEWKLEAFRDYDTIIGYDEGGEALREGPDLYKLAYARAFNISPDDVTKL 421

Query: 428 QRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQE 487
           QR IGKVMEL LG+ GG  AF   A   GL+L+  A+    N       +A+++ +   +
Sbjct: 422 QRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNVPTSIQREAQSWYQASVK 481

Query: 488 NHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVP 547
                 + +     AC+ +K+ WR  H      W+E+     + I N K     ++  + 
Sbjct: 482 QKRTFGLSEQVFI-ACDSLKRMWRNAHPETVSFWSEIENTVRRAIINPKQTFVCRKLKI- 539

Query: 548 LVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTTTRQLTREYTYGGKLTENIV 602
               ++D + L + LPSGRS+ Y  +   G+  SY+  NT +R+  R  TYGGKL EN  
Sbjct: 540 ----RRDGSWLRIQLPSGRSVCYPGIRIEGDKISYMGVNTYSRKWQRLKTYGGKLAENAT 595

Query: 603 QAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLP 662
           QA +RD++A  M      GY+I LTVHDE++ E PDTD F +  L  L+ +NP WA  LP
Sbjct: 596 QAAARDVMANNMPLIEARGYEITLTVHDEVLTEAPDTDAFTSDKLSELLATNPEWALDLP 655

Query: 663 LKAEGYESKRYRK 675
           L A G+E+  YRK
Sbjct: 656 LSAGGFEAYHYRK 668


>gi|255994008|ref|ZP_05427143.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
 gi|255993676|gb|EEU03765.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
          Length = 666

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 223/705 (31%), Positives = 311/705 (44%), Gaps = 76/705 (10%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQV---- 56
            L+ID ET S +D+   G+ KYAE  D  V+L A+  DD  VEL D      + Q     
Sbjct: 5   KLYIDIETFSSVDIRTAGLYKYAESGDFEVLLLAYAIDDGDVELIDLTDGGEITQQKLVG 64

Query: 57  LKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEAL 116
           ++  LE+ +    AHN++FE   LK   ++ I   RW CT+V     G P++L+ +GEAL
Sbjct: 65  VRRLLESQNYIKCAHNAHFEMECLKRALHIIIRPSRWECTMVKGMYRGYPASLEKMGEAL 124

Query: 117 KLSSQ--KMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            +     K+  GK LI  F   CK         RN P H  E W LF EYCK DV V RE
Sbjct: 125 DMPEDKAKLRTGKALINYFCKPCKPTKTNGGRTRNLPKHASEKWELFREYCKRDVEVARE 184

Query: 171 IFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           I K L  +       W  D  +N RG  VD AL      I    ++     ++ +T   V
Sbjct: 185 IDKMLPDVPQGVHTEWMRDYLVNWRGIAVDEALVEAAIAIDGEVKSAHLDTIKRITG--V 242

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            + R   ++  WL       +  L   + + +L     LT  A  V        +++  K
Sbjct: 243 DNPRSRAQVLDWLNDTLDEEITSLNAASVKALLE--SDLTDDARAVLTAWQGLGKTSTKK 300

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---LP 347
             TL  A   D R+RG LQF GASRTGRW+G +  P NLPR    +      +       
Sbjct: 301 YETLRAAAQKDNRVRGLLQFYGASRTGRWAGRLVQPHNLPRGDVYNLNQAGELVKAGHKK 360

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                       +S  +R+C +  EG K V+ D + IEARVLAW+AGE W L+ F+    
Sbjct: 361 DIELLHGSVPNTLSGLIRTCFVPREGCKFVICDYSAIEARVLAWLAGEHWVLEEFKGDGK 420

Query: 408 LYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           +Y  T AR +N+  + + K       R  GK+  LALGYQG   A ++M ++        
Sbjct: 421 IYEATAARMYNIDKSTIIKGHSNYAYRQKGKIATLALGYQGAVGALRQMGAS-------- 472

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                           ED F       + +AWR  +  ++ELW 
Sbjct: 473 --------------------------------EDEFTDDELRGLVRAWRVANPCIAELWR 500

Query: 523 ELHQAFEQTIEN--GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNR 577
                 + T+ +                     +  NL + LPSGR L Y +        
Sbjct: 501 YTEMMAKSTVSDEFYSGTNPMIPISFKSTLNAVNGINLAIGLPSGRELYYHNPVIVDGAI 560

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDE 631
            Y + T    T+E TYGGKL ENIVQA++RD+LA+ +   TK          IVL VHDE
Sbjct: 561 YYTDYTHAGKTKEQTYGGKLVENIVQAIARDVLADAINRITKTLVVGGINAHIVLHVHDE 620

Query: 632 IVCETPDTDEFNASMLYH-LMTSNPSWAKGLPLKAEGYESKRYRK 675
           +V E           L   + ++ PSWA+GLPLK E + S  Y+K
Sbjct: 621 VVVEAEAGCAEKVQELLEGVFSTPPSWAEGLPLKGESFISDYYKK 665


>gi|296277208|ref|ZP_06859715.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           MR1]
          Length = 631

 Score =  445 bits (1144), Expect = e-122,   Method: Composition-based stats.
 Identities = 214/684 (31%), Positives = 309/684 (45%), Gaps = 83/684 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++       E   W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E GL + +L + T Q      K+ T +A ++   R++ S+++
Sbjct: 241 --LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQ---EYLKEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQR--AIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F T   +Y  + ++ FNV    +TK       GKV ELALGYQGGA A + M        
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------- 467

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A+E        + +  +WR  +  +  
Sbjct: 468 ---------------------------------ALEMGIEENELQGLVDSWRNANPNIVN 494

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-VGNNRS 578
            W    +A   T+++ K       R          K  L++ LPSGR+L Y   +    S
Sbjct: 495 FWKACQEAAINTVKSRKTHHTHGLR------FYMKKGFLMIELPSGRALAYPKALVGENS 548

Query: 579 YLNTT--------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           + +           R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHD
Sbjct: 549 WGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHD 608

Query: 631 EIVCETPDTDEFNASMLYHLMTSN 654
           E++ E P         +  +M   
Sbjct: 609 EVIVEIPRGS-NGLKEIETIMNKP 631


>gi|95931003|ref|ZP_01313731.1| DNA polymerase I [Desulfuromonas acetoxidans DSM 684]
 gi|95132899|gb|EAT14570.1| DNA polymerase I [Desulfuromonas acetoxidans DSM 684]
          Length = 891

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 106/705 (15%), Positives = 202/705 (28%), Gaps = 166/705 (23%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPV 52
            + +D ET S   L             V+ F F  +          H             
Sbjct: 317 VISVDTETTSLNPLL----------AEVVGFCFAVEPGHGWYVPVGHCGGGAEEQLPRDE 366

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSAL 109
           +   ++  LE+  +  V  N  ++  VL+    + +       T++ +           L
Sbjct: 367 VVAQVQPLLEDATLAKVGQNLKYDALVLRRA-GIALR-GVVADTMLQSYLLYPAARSHGL 424

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            A+             G ++I+             +       A  +   Y   D  +T 
Sbjct: 425 DALAA--------DHLGYKMISY----SEVAGTGKKQIGFDEVALDVATRYAAEDADITL 472

Query: 170 EIFKRLEPLSS---------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
           ++++R +              E  L  +   +   G  VD      L+        +L+Q
Sbjct: 473 QLYQRFDAELDGTLRELFETVEMPLLQVLIDMEWWGVRVDRERLDALSAGFSTSIKQLEQ 532

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE---TTCQRVLSSNKKLTPQAIQVF 277
           ++  L      +    ++L   LF +  L     T+   +T   VL +          + 
Sbjct: 533 QIYELAG-EEFNINSPKQLGVILFEKLDLPHGKKTKTGWSTAVDVLKNLADKHDVVALIL 591

Query: 278 NNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             R   ++      + L   ++ D GR+  +      + TGR S      QN+P  S   
Sbjct: 592 QYR-SLAKLKGTYTDALPLLIHPDSGRIHTSFNQAV-TATGRLSSSDPNLQNIPIRSEEG 649

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   +   G+ L+ AD + IE RV+A MA E 
Sbjct: 650 RA-------------------------IREAFVPDAGQVLLAADYSQIELRVMAHMADEP 684

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
              ++F  GED++  T +  F+V P  V  + R   K +                    G
Sbjct: 685 ILQESFRQGEDIHQRTASEIFSVFPDMVDSEMRRRAKTIN--------------FGVLYG 730

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           +                                   A +        ++    + +++  
Sbjct: 731 MG------------------------------AFSLAKDLGISNKEAKQYIDHYFERYPA 760

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E   +  Q   +                          +L +    GR     D+ + 
Sbjct: 761 VLEFIEQQKQFGRE--------------------------HLYVETLLGRRCAVSDINSK 794

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                       R            VQ  + DI+   M+   +          +VL VHD
Sbjct: 795 N---GQVRSYAERNA------VNYPVQGSAADIIKVAMVRIHQRLQDLQLKTRMVLQVHD 845

Query: 631 EIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRYR 674
           E+V + P  +  +  +++   M         +PL+        +R
Sbjct: 846 ELVFDVPKDEVDDVVALVVQEMEQAVE--LRVPLEVSLGRGANWR 888


>gi|146280510|ref|YP_001170663.1| DNA polymerase I [Pseudomonas stutzeri A1501]
 gi|145568715|gb|ABP77821.1| DNA polymerase I [Pseudomonas stutzeri A1501]
          Length = 931

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 103/701 (14%), Positives = 195/701 (27%), Gaps = 160/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S            A+   ++  +F  +          H             + 
Sbjct: 355 AFDTETTSLD----------AQRAELVGVSFAVEPGQAAYVPLRHSYMGVPQQLELDAVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+   T +  +  ++  VL   + +++       T++ +              
Sbjct: 405 SALKPLLEDPAKTKICQHGKYDMNVLM-HYGIEMRGMA-FDTMLESYVLD--------AT 454

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
           A +     +   K L     + E       +     + A    G Y   D  VT  + + 
Sbjct: 455 ATRHDMDSLAL-KYLGRGTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLRLHQT 513

Query: 175 LEPLSSK-----------EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L     +           E  L  +   I   G  VD  L    +  +  +  +L++E  
Sbjct: 514 LLGKLEQTPSLLKVLTEIEMPLVPVLARIERNGALVDAQLLGQQSVELGDKLVQLEREAF 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L   L+ + G  +   T     +T + VL+   +      +V   
Sbjct: 574 DIAG-EEFNLGSPKQLCAILYDKLGCPVISKTAGGQPSTAESVLAELAEQDYPLPKVIMQ 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
               S+      + L + +N       T      + TGR S      QN+P  +      
Sbjct: 633 HRSLSKLKGTYTDKLPQQINPRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRTAEGRR- 691

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   +A+ G KL+ AD + IE R++A +A +   L
Sbjct: 692 ------------------------IRQAFVAAPGYKLLAADYSQIELRIMAHLAQDAGLL 727

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF+   D++  T A  F V   QV+ DQR   K +                    G++ 
Sbjct: 728 HAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINFG--------------LIYGMSA 773

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              A  +                                     +     +  ++  V  
Sbjct: 774 FGLAKQID------------------------------VGRKEAQEYIDRYFARYPGVLA 803

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                     +                             +    GR L   ++ +    
Sbjct: 804 YMERTRTQAAE--------------------------QGYVETLFGRRLYLPEINSKNGA 837

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEIV 633
           +    +   R            +Q  + DI+   M+              ++L VHDE+V
Sbjct: 838 MR---KGAERTAINAP------MQGTAADIIKRAMIAVDGWLQDSGLDARVILQVHDELV 888

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +         +  LM+        +PL  E      +
Sbjct: 889 LEVREDLVEQVREAICPLMSGAAQ--LDVPLLVEAGVGNNW 927


>gi|114322007|ref|YP_743690.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228401|gb|ABI58200.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
          Length = 912

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 107/703 (15%), Positives = 201/703 (28%), Gaps = 164/703 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   +          D  ++  A              H+            + 
Sbjct: 336 AFDLETSSLNYM----------DAEIVGVALAVGAGEAAYVPLAHEGPDTPTQLDRDRVL 385

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRW-ICTLVLARSNGLPSALKAVG 113
             LK  LE+ D   V  N  ++ +VL      DI +      T++ +      ++     
Sbjct: 386 AALKPLLEDPDRAKVGQNLKYDMSVLARY---DIHLEGVAYDTMLESYVLDSTAS----- 437

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
              +     +   K L     K E       +  P  + A      Y   D  +T  + +
Sbjct: 438 ---RHDMDSLAL-KYLGRATVKYEDVCGKGAKQIPFAQVAVETATRYAGEDADITLRLHQ 493

Query: 174 RLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
            L P               E  L  +   +   G  VD AL    +  +      L+Q  
Sbjct: 494 TLYPRLEAEGRLVQVFHAIEMPLLPVLSRMERHGVKVDRALLEQQSTELAEGMAALEQRA 553

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQVFN 278
                G   +    ++++  LF   GL           +T + VL        +  ++  
Sbjct: 554 HEEAEGP-FNLSSPKQIQEILFERMGLPVLQKTPKGAPSTAESVLEELAARGYELPRLIL 612

Query: 279 NRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE 337
                ++      + L   ++   GR+  +     A+ TGR S      QN+P  +    
Sbjct: 613 AYRSLAKLKTTYTDKLPRLIHPKTGRVHTSYHQAVAA-TGRLSSSDPNLQNIPVRTAEGR 671

Query: 338 ELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
                                     +R   +A  G KL+ AD + +E R++A ++G++ 
Sbjct: 672 R-------------------------IRKAFVAEPGCKLLAADYSQVELRIMAHLSGDEG 706

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
             +AF  G D++  T A  F +AP +V  +QR   K +                    G+
Sbjct: 707 LRQAFAEGADIHSATAAEVFGLAPERVGGEQRRAAKAINF--------------GLIYGM 752

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
           +                                  A +        +     + +++  V
Sbjct: 753 S------------------------------AYGLARQLGIERGEAQAYVDRYFERYPGV 782

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR 577
            E  +       +                             +    GR L   ++    
Sbjct: 783 KEYMDRTRAEARE--------------------------RGYVETLFGRRLYLPEINARN 816

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDE 631
                      R            +Q  + D++   M+          +   +V+ VHDE
Sbjct: 817 ---RQRREYAERTAINAP------MQGTAADLIKRAMVAVDAWLTEAHSKARMVMQVHDE 867

Query: 632 IVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           +V E P  D    +  L   M +    A  +PL+ +   +  +
Sbjct: 868 LVLEVPAADVPAVAEGLRERMQAAGELA--VPLEVDVGVADDW 908


>gi|188532189|ref|YP_001905986.1| DNA polymerase I [Erwinia tasmaniensis Et1/99]
 gi|188027231|emb|CAO95070.1| DNA polymerase I [Erwinia tasmaniensis Et1/99]
          Length = 929

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 114/705 (16%), Positives = 212/705 (30%), Gaps = 168/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   L+            +I  +F             HD            + 
Sbjct: 353 AFDLETDSLDTLS----------ANIIGLSFATAPGVAAYLPVAHDYLDAPAQLDRNDVL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
             LK  LEN     V  N  F+R VLK+  ++++   R   T++ + +         +  
Sbjct: 403 ARLKPLLENPQALKVGQNLKFDRGVLKSY-DIELQGIR-FDTMLESYALNSVIGRHDMDT 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +                L  +    E       +    ++ A    G Y   D  VT ++
Sbjct: 461 LALR------------WLNHKTVTFEEIAGKGKKQLTFNQIALEQAGHYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   KEQ            L  +   I   G  +D  +  T +Q +     +L+Q
Sbjct: 509 HLKMWPALEKEQGPKNVFEQLEMPLVPVMSRIERNGVLIDQGILATHSQELGSRLAELEQ 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   L      +    ++L+T LF + G+     T     +T + VL+      P    +
Sbjct: 569 KAHELAG-EPFNLSSPKQLQTILFEKQGIKPTKKTPGGAPSTSEEVLAELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             +R   S+      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEHR-GLSKLKSTYTDKLPLMINPHSGRVHTSYHQTVTATGRLSSSDPNLQNIPVRNDEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA  G ++V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPPGYRIVAADYSQIELRIMAHLSQDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF + +D++  T A  F V+  +V+ +QR   K +   L Y            +  
Sbjct: 722 GLLSAFASEQDIHRATAAEVFGVSLDKVSGEQRRSAKAINFGLIYGM-----SSFGLSRQ 776

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           L                                              ++    + +++  
Sbjct: 777 L---------------------------------------NIGAGEAKKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V +      +   +                             +    GR L   D+  +
Sbjct: 798 VLQYMESTRELAAE--------------------------KGYVSTLDGRRLYLPDINAS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT-------KAGYDIVLTVH 629
            +      +   R            +Q  + DI+   M+               +++ VH
Sbjct: 832 NAIRR---KAAERAAINAP------MQGTAADIIKRAMIAVDGWLEQQTSPDVKMIMQVH 882

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E        A + +  LM  +   A  +PL+ +      +
Sbjct: 883 DELVFEVRADAVEAASAQIRALMEGSM--ALDVPLRVDIGVGDNW 925


>gi|220921495|ref|YP_002496796.1| DNA polymerase I [Methylobacterium nodulans ORS 2060]
 gi|219946101|gb|ACL56493.1| DNA polymerase I [Methylobacterium nodulans ORS 2060]
          Length = 1024

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 110/715 (15%), Positives = 201/715 (28%), Gaps = 173/715 (24%)

Query: 3    TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
             L +D ET +            A    ++  +              H             
Sbjct: 437  VLAVDTETNALD----------AHRADLVGVSLATAPGRAAYIPLSHRGSEDLFGEGLLP 486

Query: 51   -----PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL 105
                   +   LK  LE+  V  V  N  ++  VL       I +  +  T++++     
Sbjct: 487  NQLPWEAVRARLKPLLEDPAVLKVGQNLKYDWLVLARH---GIEVRPYDDTMLISYVLDA 543

Query: 106  ---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCK 162
                  +  +             G + I                    R        Y  
Sbjct: 544  GKGSHGMDELARRH--------LGHQPITF----ADVTGTGRTKVTFDRVPLDKATAYAA 591

Query: 163  GDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             D  VT  +++ ++P            + E+ L  +   +   G  VD  +   L+    
Sbjct: 592  EDADVTLRLWRLMKPRLAAERRATVYETLERPLVPVLARMESCGIRVDRGMLSRLSGDFS 651

Query: 213  VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKK 268
                +L+ E++ +      S    +++   LF + GL     T +    T   +L     
Sbjct: 652  QSLARLEAEIQEMAG-ESFSVSSPKQIGDILFGKFGLPGAKKTPSGQWATPATLLEELAG 710

Query: 269  LTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQN 328
                  +      + S+      +TL E  + +     T   L A+ TGR S      QN
Sbjct: 711  QGHALPKKILEWRQLSKLKSTYTDTLQEHADRETNRVHTSFALAATTTGRLSSSDPNLQN 770

Query: 329  LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
            +P  +                              +R   +A EG KL+ AD + IE R+
Sbjct: 771  IPIRTEEGRR-------------------------IRQAFVADEGHKLISADYSQIELRL 805

Query: 389  LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
            LA +A      +AF  G D++  T +  F V   Q+T D R   K +             
Sbjct: 806  LAHIADIPQLREAFAAGIDIHAATASAMFGVPLDQMTPDLRRRAKTINF----------- 854

Query: 449  QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                   G++                                  A              K
Sbjct: 855  ---GIIYGIS------------------------------AFGLADRLGIPQGEAAAFIK 881

Query: 509  AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
             + ++   +    +++    +   + G                             GR  
Sbjct: 882  QYFERFPGIRAYIDDIK---KTCRDKGYVTTL-----------------------FGRVC 915

Query: 569  VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY------ 622
             Y  + +N          + R+           +Q  + DI+   M+    A        
Sbjct: 916  HYPQIRSNNP---QERASVERQAINAP------IQGSAADIIRRAMVRMEGALAAAGLTT 966

Query: 623  DIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWA--KGLPLKAEGYESKRYR 674
             ++L VHDE+V E PD +      ++  +M   P  A    +PL  E   +  ++
Sbjct: 967  RMLLQVHDELVFEAPDDEVERALPIIARVMEEAPHPAVQLRVPLAVEAKAATNWQ 1021


>gi|306826828|ref|ZP_07460129.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
 gi|304430991|gb|EFM33999.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
          Length = 643

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 214/700 (30%), Positives = 311/700 (44%), Gaps = 83/700 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + +D ET S  D+ K G+ KYA  ED  ++  ++  +   V L D       P+ LK
Sbjct: 1   MR-IDLDLETYSSNDI-KNGVYKYADAEDFDILFMSYSINFGDVVLVDLT-KEEFPEFLK 57

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD------IPIHRWICTLVLARSNGLPSALKAV 112
             + N D T  A N+ FER  L   F              W   +V A+  GLP++L+  
Sbjct: 58  NHILNADATFWAWNTVFERICLSMYFQKKGWSKGYFDPKNWKDIMVHAQELGLPASLERC 117

Query: 113 GEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVT 168
              L L  QK   GK LI  F   CK         RN P H  E W  +GEY   DV   
Sbjct: 118 ASYLGLEEQKDTRGKALIRYFSIPCKPTKANGGRTRNLPEHDPEKWEEYGEYNVQDVVTQ 177

Query: 169 REIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL+++T
Sbjct: 178 MAIAEKLESVPVHDREWDHYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAIT 237

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
                +     +L  WL    G     LT+     V    K    +  +V   +++ + S
Sbjct: 238 GLA--NPNSRAQLLPWLKEH-GYSANGLTK---ADVEQELKTAEGELKRVLELKLQTAMS 291

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH- 345
           ++ K   +  AM SDGR+ G LQF GASRTGRW+G V   QNL R      +  +     
Sbjct: 292 SLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDARGYVKK 351

Query: 346 --LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
             +             +   VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F 
Sbjct: 352 RDIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFS 411

Query: 404 TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M            
Sbjct: 412 THGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG----------- 460

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                        A+         + +   WR+ + ++ + W +
Sbjct: 461 -----------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKD 491

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNN 576
           + +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+ 
Sbjct: 492 VQRAAIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDK 545

Query: 577 RSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
             Y     +   T + TYGGKL ENIVQA +RDILAE ++    AG+ +V  VHDE + E
Sbjct: 546 IIYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAIIE 605

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                      +  LM   P WA+GLPL +EGY +K Y K
Sbjct: 606 ---GSGLTIEEVNDLMAQAPDWAEGLPLNSEGYVTKYYMK 642


>gi|152985854|ref|YP_001351604.1| DNA polymerase I [Pseudomonas aeruginosa PA7]
 gi|150961012|gb|ABR83037.1| DNA polymerase I [Pseudomonas aeruginosa PA7]
          Length = 917

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 108/706 (15%), Positives = 197/706 (27%), Gaps = 166/706 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 338 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPDQLERDAV 387

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALK 110
            + LK  LE+     V  ++ ++  VL               T++ +           + 
Sbjct: 388 LRALKPLLEDPQKLKVGQHAKYDINVLANASTPIAMQGVAYDTMLESYVLDSTATRHDMD 447

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
           ++             G   I      E       +     + A    G Y   D  VT  
Sbjct: 448 SLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLR 495

Query: 171 IFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           + + L                 E  L  +   I   G  VD  L    ++ +  +   L+
Sbjct: 496 LHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVALE 555

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQ 275
           ++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  +
Sbjct: 556 RQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELPK 614

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  + 
Sbjct: 615 VIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRTA 673

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA +G KL+ AD + IE R++A +A 
Sbjct: 674 EGRR-------------------------IRQAFIAPQGYKLLAADYSQIELRIMAHLAK 708

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++  L AF    D++  T A  F V    V+ DQR   K +                   
Sbjct: 709 DEGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GLI 754

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++    A  +                                     +     +  ++
Sbjct: 755 YGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFARY 784

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V            +                             +    GR L   ++ 
Sbjct: 785 PGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEIH 818

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTV 628
           +    +    +   R            +Q  + DI+   M+              ++L V
Sbjct: 819 SKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLRESGLDARVILQV 869

Query: 629 HDEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E  +         +  LM+   S    +PL  E      +
Sbjct: 870 HDELVLEVREDLVEQVREGIRPLMSGAAS--LDVPLVVEAGIGSNW 913


>gi|296392358|ref|ZP_06881833.1| DNA polymerase I [Pseudomonas aeruginosa PAb1]
          Length = 913

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 199/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF    D++  T A  F V    V+ DQR   K +                  
Sbjct: 704 KDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLLESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREDLVEQVREGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|116053643|ref|YP_793970.1| DNA polymerase I [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588864|gb|ABJ14879.1| DNA polymerase I [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 913

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 199/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF    D++  T A  F V    V+ DQR   K +                  
Sbjct: 704 KDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREDLVEQVREGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|319943201|ref|ZP_08017484.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
 gi|319743743|gb|EFV96147.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
          Length = 977

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 103/706 (14%), Positives = 192/706 (27%), Gaps = 166/706 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
             + ID ET S                 ++  +              H+           
Sbjct: 400 DRVAIDTETTSKDP----------HAARLVGISLAVTPWQGCYIPVGHNYAGVPEQLPLD 449

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SAL 109
            +  VLK  LE+     V  N  ++  VL     + +       T++ +          +
Sbjct: 450 EVLAVLKPWLESDAQQKVGQNIKYDMHVLANH-GITLR-GVVDDTMLESYVLEAHRTHGM 507

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            A+                L       E       +     + A  +   Y   D  VT 
Sbjct: 508 DALAGRH------------LNRTTITYEEVAGKGAKAIGFDQVALDVATPYAAEDADVTL 555

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L P               E     +   +   G  +D       +Q +  +  +L
Sbjct: 556 QLHRTLWPAIEASERLRHIYRNIEMPTLQVLYDMERHGVLLDRDRLRAQSQQLAEQLQEL 615

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   LF   GL +   T     +T + VL       P   
Sbjct: 616 ERQAHELAGQP-FNLGSTKQLGEILFERLGLPVVKKTPAGKPSTDESVLEKLALDYPLPK 674

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
            +       ++      + L E ++       T      + TGR +      QN+P  + 
Sbjct: 675 VLLQ-WRGLAKLKSTYTDKLPEMVDPKTGRVHTTYSQAVAITGRLASSDPNLQNIPVRTP 733

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA  G +++ AD + IE R++A ++ 
Sbjct: 734 EGRR-------------------------IREAFIAPPGHQMMSADYSQIELRIMAHISQ 768

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           +   LKAF  GED++  T +  F V  A+V  +QR                         
Sbjct: 769 DAGLLKAFADGEDVHRATASEVFGVPIAEVNSEQRRYA--------------KVINFGLI 814

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  A        A +     +  ++
Sbjct: 815 YGMS------------------------------AFGLAANLGIERGAAQAYIDRYFARY 844

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V+           +                             +    GR L   ++G
Sbjct: 845 PGVAAYMERTRAQARE--------------------------QGYVETVFGRRLWLPEIG 878

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTV 628
           ++            R            +Q  + D++   M++          G  +V+ V
Sbjct: 879 SSNMGRRQM---AERAAINAP------MQGTAADLIKLAMIDVHAWLRRENLGARLVMQV 929

Query: 629 HDEIVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E PD +       L   M         +PL AE    + +
Sbjct: 930 HDELVLEVPDAEVERLKTDLPARMAGVAQ--LSVPLLAEVGVGENW 973


>gi|268592231|ref|ZP_06126452.1| DNA polymerase I [Providencia rettgeri DSM 1131]
 gi|291312280|gb|EFE52733.1| DNA polymerase I [Providencia rettgeri DSM 1131]
          Length = 930

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 105/701 (14%), Positives = 216/701 (30%), Gaps = 159/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S             ++  ++  +F  +          HD            + 
Sbjct: 353 AFDTETDSLD----------TQEARLVGMSFAIEPGHAAYLPLGHDYLDAPVQLPLEEVL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
           +++K  LE+ ++  +  N  ++  VL+   ++++    +  T++ +      + +     
Sbjct: 403 ELMKPILESENILKIGQNLKYDAEVLENY-DIELKGIGY-DTMLESYVLNSVAGMG---- 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + +   L  +    E       +    ++ A      Y   D  VT  + + 
Sbjct: 457 --RHDMDSLADRH-LNHKTVSFEEIAGKGKKQLTFNQIALEEAANYAAEDADVTLLLHQA 513

Query: 175 LEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +  +G  +D  +    ++++     +L++E  
Sbjct: 514 LYPQLEAEPKLNHIFQNIEMPLVPVLVRMERKGVLIDANVLAAQSKVITARLAELEKEAF 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKKLTPQAIQVFNN 279
            L      +    ++L+T LF +  L +   T +    T + VL            +  +
Sbjct: 574 ELAG-EEFNLASPKQLQTILFEKLQLPVIKKTPSGAASTNEEVLEELALNHALPKLLLEH 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N   +   T      + TGR S      QN+P  +      
Sbjct: 633 R-SLAKLKSTYTDKLPLMINPRTQRVHTSYHQAVTATGRLSSRDPNLQNIPVRTEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA EG K++ AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAREGYKVMAADYSQIELRIMAHLSQDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F V   QVT DQR   K +                    G++ 
Sbjct: 727 TAFAEGKDIHKATAAEVFGVPLEQVTSDQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        +R    + +++  V  
Sbjct: 772 -----------------------------AFGLARQLGIPRGEAQRYMDLYFERYPGVLR 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                                                   +    GR L   D+ ++   
Sbjct: 803 YMENTRLQA--------------------------SEQGYVETLEGRRLYLADIKSSNGM 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                +   RE           +Q  + DI+ + M+         K   D+++ VHDE+V
Sbjct: 837 RR---KAAEREAINAP------MQGTAADIIKKAMIAVDNWLQTEKPHADMLMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +++     + +  LM  +      +PLK +      +
Sbjct: 888 FEVKESELERVQAQVQSLMEQSMK--LDVPLKVDVGIGDNW 926


>gi|327478747|gb|AEA82057.1| DNA polymerase I [Pseudomonas stutzeri DSM 4166]
          Length = 914

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 103/701 (14%), Positives = 195/701 (27%), Gaps = 160/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S            A+   ++  +F  +          H             + 
Sbjct: 338 AFDTETTSLD----------AQRAELVGVSFAVEPGQAAYVPLRHSYMGVPQQLELDAVL 387

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+   T +  +  ++  VL   + +++       T++ +              
Sbjct: 388 GALKPLLEDPAKTKICQHGKYDMNVLM-HYGIEMRGMA-FDTMLESYVLD--------AT 437

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
           A +     +   K L     + E       +     + A    G Y   D  VT  + + 
Sbjct: 438 ATRHDMDSLAL-KYLGRGTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLRLHQT 496

Query: 175 LEPLSSK-----------EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L     +           E  L  +   I   G  VD  L    +  +  +  +L++E  
Sbjct: 497 LLGKLEQTPSLLKVLTEIEMPLVPVLARIERNGALVDAQLLGQQSVELGDKLVQLEREAF 556

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L   L+ + G  +   T     +T + VL+   +      +V   
Sbjct: 557 DIAG-EEFNLGSPKQLCAILYDKLGCPVISKTAGGQPSTAESVLAELAEQDYPLPKVIMQ 615

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
               S+      + L + +N       T      + TGR S      QN+P  +      
Sbjct: 616 HRSLSKLKGTYTDKLPQQINPRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRTAEGRR- 674

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   +A+ G KL+ AD + IE R++A +A +   L
Sbjct: 675 ------------------------IRQAFVAAPGYKLLAADYSQIELRIMAHLAQDAGLL 710

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF+   D++  T A  F V   QV+ DQR   K +                    G++ 
Sbjct: 711 HAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINFG--------------LIYGMSA 756

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              A  +                                     +     +  ++  V  
Sbjct: 757 FGLAKQID------------------------------VGRKEAQEYIDRYFARYPGVLA 786

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                     +                             +    GR L   ++ +    
Sbjct: 787 YMERTRTQAAE--------------------------QGYVETLFGRRLYLPEINSKNGA 820

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEIV 633
           +    +   R            +Q  + DI+   M+              ++L VHDE+V
Sbjct: 821 MR---KGAERTAINAP------MQGTAADIIKRAMIAVDGWLQDSGLDARVILQVHDELV 871

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +         +  LM+        +PL  E      +
Sbjct: 872 LEVREDLVEQVREAICPLMSGAAQ--LDVPLLVEAGVGNSW 910


>gi|15600686|ref|NP_254180.1| DNA polymerase I [Pseudomonas aeruginosa PAO1]
 gi|81539387|sp|Q9HT80|DPO1_PSEAE RecName: Full=DNA polymerase I; Short=POL I
 gi|9951828|gb|AAG08878.1|AE004962_2 DNA polymerase I [Pseudomonas aeruginosa PAO1]
          Length = 913

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 199/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF    D++  T A  F V    V+ DQR   K +                  
Sbjct: 704 KDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREDLVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|239830974|ref|ZP_04679303.1| DNA polymerase I [Ochrobactrum intermedium LMG 3301]
 gi|239823241|gb|EEQ94809.1| DNA polymerase I [Ochrobactrum intermedium LMG 3301]
          Length = 985

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 104/714 (14%), Positives = 205/714 (28%), Gaps = 174/714 (24%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------- 50
           L  D ET S   +             ++ F+              H              
Sbjct: 398 LAFDTETTSVDPM----------QAELVGFSLALAPGRAAYIPLQHKSGAGDLLGGGTVE 447

Query: 51  -----PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL 105
                      LK  LE+  V  +A N  ++  +++      I    +  T++++     
Sbjct: 448 GQIPLGEALAALKTVLEDASVLKIAQNMKYDWLIMRRY---GINTVSFDDTMLISYVLDA 504

Query: 106 ---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCK 162
                 +  + E           G   IA     +        +             Y  
Sbjct: 505 GTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSSVTFDMVDIDRATAYAA 552

Query: 163 GDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
            D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  + 
Sbjct: 553 EDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLA 612

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKK 268
                 + E+  L      +    ++L   LF + GL     T+    +T  +VL     
Sbjct: 613 QAAAAYEDEIYELAG-ERFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLAA 671

Query: 269 LTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQN 328
                 +   +  + ++      + L   +N   R   T   + ++ TGR S      QN
Sbjct: 672 EGHPLPRKIVDWRQLTKLKSTYTDALPGFINPATRRVHTCYAMASTSTGRLSSSDPNLQN 731

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
           +P  +    +                         +R+  IA  G KL+ AD + IE RV
Sbjct: 732 IPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELRV 766

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           LA +A      +AF  G D++  T +  F V    +  + R   K +             
Sbjct: 767 LAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF----------- 815

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                  G++    A+ +                                      +  +
Sbjct: 816 ---GIIYGISAFGLANQLSI------------------------------PREEAGQYIR 842

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            + ++   + +          +                          +  +    GR  
Sbjct: 843 TYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRRA 876

Query: 569 VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGY 622
            Y D+  +            R            +Q  + DI+   M+         K   
Sbjct: 877 HYPDIRASNP---QIRAFNERAAINAP------IQGSAADIIRRAMIRMEDALAKEKLAA 927

Query: 623 DIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
            ++L VHDE++ E P+ +     S++ H+M +   P+ +  +PL  +   +  +
Sbjct: 928 RMLLQVHDELIFEVPENEVEKTVSVVRHVMENAAMPAVSLAVPLHVDARAAHNW 981


>gi|107104595|ref|ZP_01368513.1| hypothetical protein PaerPA_01005674 [Pseudomonas aeruginosa PACS2]
          Length = 913

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 199/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF    D++  T A  F V    V+ DQR   K +                  
Sbjct: 704 KDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREELVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|218894596|ref|YP_002443466.1| DNA polymerase I [Pseudomonas aeruginosa LESB58]
 gi|218774825|emb|CAW30643.1| DNA polymerase I [Pseudomonas aeruginosa LESB58]
          Length = 913

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 200/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF  G D++  T A  F V    V+ DQR   K +                  
Sbjct: 704 KDDGLLDAFRHGLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREELVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|197286655|ref|YP_002152527.1| DNA polymerase I [Proteus mirabilis HI4320]
 gi|194684142|emb|CAR45571.1| DNA polymerase I [Proteus mirabilis HI4320]
          Length = 932

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 108/702 (15%), Positives = 221/702 (31%), Gaps = 162/702 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  ++          D  +I  +F  +          HD            + 
Sbjct: 356 AFDTETDSLNNI----------DARLIGLSFAVEPGKAAYIPLRHDYLDAPEQLPVDEVL 405

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+  +  +  N  F+R +++    +++    +  T++ +      S+      
Sbjct: 406 TALKPILEDKTILKIGQNLKFDRGIMEN-EGIELNGI-YFDTMLESYVLNSVSS------ 457

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + E K L  +    E            ++        Y   D  +T  + + 
Sbjct: 458 --RHDMDTLAE-KHLNHKTTTFEEIAGKGKGQLTFNQIEVEQATLYAAEDADITLLLHQA 514

Query: 175 LEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +  +G  +D  +    +Q +     ++++E  
Sbjct: 515 LYPQIEAIAPLKHVYHDIEMPLVPVLSRMERKGVLIDAQVLAMQSQEITQRLAEIEKETF 574

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
           +L      +    ++L+  LF +  L +   T     +T + VL +          +  +
Sbjct: 575 ALAGQ-EFNLSSPKQLQEILFEKLNLPIIKKTPKGAPSTNEEVLEALAHSHELPRLILEH 633

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +NS  +   T      + TGR S      QN+P  +      
Sbjct: 634 R-GLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRR- 691

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA +G K+V AD + IE R++A ++ ++  L
Sbjct: 692 ------------------------IRQAFIARDGFKIVAADYSQIELRIMAHLSQDKGLL 727

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T +  F +   +VT +QR   K +                    G++ 
Sbjct: 728 DAFAQGKDIHRATASEVFGIPLDEVTSEQRRSAKAINFG--------------LIYGMSA 773

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              +  +                                     +R    + +++  V +
Sbjct: 774 FGLSQQI------------------------------GVERKEAQRYMDLYFERYPGVLD 803

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                 +  +Q  + G                             GR L   ++ +  + 
Sbjct: 804 YM---ERTRKQASQQGYVETL-----------------------DGRRLYLPEINSKNAI 837

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTVHDEI 632
                +   RE           +Q  + DI+ + M+               +++ VHDE+
Sbjct: 838 RR---KASEREAINAP------MQGTAADIIKKAMIAVDNWICHECPDDVHMIMQVHDEL 888

Query: 633 VCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  ++    A +M++ LM S+   A  +PLK E      +
Sbjct: 889 VFEVRESYLEKANAMIHKLMESSMELA--IPLKVEVGVGNNW 928


>gi|254500698|ref|ZP_05112849.1| DNA polymerase I superfamily [Labrenzia alexandrii DFL-11]
 gi|222436769|gb|EEE43448.1| DNA polymerase I superfamily [Labrenzia alexandrii DFL-11]
          Length = 1001

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 107/716 (14%), Positives = 201/716 (28%), Gaps = 175/716 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            +  D ET S            A    ++  +              H             
Sbjct: 412 YVAFDTETTSLD----------AMQAELVGISLSCKPGKACYIPLTHKDGEGDLLGGGGL 461

Query: 51  -------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSN 103
                      + LK  LE+  +  +A N  ++  V+       + +  +  T++L+ + 
Sbjct: 462 LPDQIPLDDALKALKPMLEDRGILKIAQNLKYDWLVMTRH---GVDVDPYDDTMLLSYTV 518

Query: 104 GLPSA---LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEY 160
                   +  + E           G + I      +             + A      Y
Sbjct: 519 DAGKGGNGMDELSERW--------LGHKPIPF----KEVCGSGKSMITFDKVAIDKATAY 566

Query: 161 CKGDVTVTREIFKRLEPLSSKEQ----------ELWYLDQTINDRGYCVDVALAHTLNQI 210
              D  VT  ++  L+P  + +            +  +   +  RG  VD  +   L+  
Sbjct: 567 AAEDADVTLRLWLTLKPRLASDHMATVYETLERPMVPVLARMEKRGISVDRQMLSRLSGD 626

Query: 211 VDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSN 266
                  L+ E+  L      +    ++L   LF + GL     T+    +T  +VL   
Sbjct: 627 FAQGAAALESEIYELAG-ETFNVGSPKQLGDILFGKMGLPGGKKTKTGAWSTSAQVLEDL 685

Query: 267 KKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPP 326
                          + S+      + L   +N + +   T   L A+ TGR S      
Sbjct: 686 AAEGHPLPSKIVEWRQLSKLKSTYTDALPGYINPETKRVHTSYSLAATTTGRLSSSEPNL 745

Query: 327 QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
           QN+P  + +  +                         +R   IA +G+KL+ AD + IE 
Sbjct: 746 QNIPVRTEAGRK-------------------------IRQAFIAEKGQKLISADYSQIEL 780

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           RVLA MA      KAFE G D++  T +  F      +    R   K +           
Sbjct: 781 RVLAHMADIPQLKKAFEDGLDIHAMTASEMFGTPIEGMDPMVRRQAKAINF--------- 831

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
                    G++                                  A +           
Sbjct: 832 -----GIIYGIS------------------------------AFGLANQLGISRGEAGDY 856

Query: 507 KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
            K + Q+   + +    + +                              +  +    GR
Sbjct: 857 IKTYFQRFPGIKDYMEAVKKQVH--------------------------ADGYVTTIFGR 890

Query: 567 SLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KA 620
              Y +V      +        R            +Q  + DIL   M+         K 
Sbjct: 891 KAHYPEVNTKNPNMR---AFYERAAINAP------IQGSAADILRRAMVRMEDRLTASKL 941

Query: 621 GYDIVLTVHDEIVCETPDTDEFN-ASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
              ++L VHDE++ E P+        ++  +M +   P+    +PL+ +   +  +
Sbjct: 942 DAQMLLQVHDELIFEVPEDQVEATIPLIKDVMENACDPALKFSVPLQVDARAADNW 997


>gi|313111566|ref|ZP_07797365.1| DNA polymerase I [Pseudomonas aeruginosa 39016]
 gi|310883867|gb|EFQ42461.1| DNA polymerase I [Pseudomonas aeruginosa 39016]
          Length = 913

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 198/707 (28%), Gaps = 168/707 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   V+  +F   +         H             +
Sbjct: 334 IAFDTETTS----------IDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLP---SAL 109
            + LK  LE+     V  ++ ++  VL      + +    +  T++ +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++             G   I      E       +     + A    G Y   D  VT 
Sbjct: 443 DSLALKY--------LGHSTIRF----EDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTL 490

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + + L                 E  L  +   I   G  VD  L    ++ +  +   L
Sbjct: 491 RLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVAL 550

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L   L+ + GL +   T     +T + VL+   +   +  
Sbjct: 551 ERQAYDLAGQ-EFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELP 609

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMN-SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           +V       S+      + L E +N   GR+  +     A+ TGR S      QN+P  +
Sbjct: 610 KVIMQYRSMSKLKSTYTDRLPEQINLRTGRIHTSYHQAVAA-TGRLSSSDPNLQNIPIRT 668

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A +G KL+ AD + IE R++A +A
Sbjct: 669 AEGRR-------------------------IRQAFVAPQGYKLLAADYSQIELRIMAHLA 703

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   L AF    D++  T A  F V    V  DQR   K +                  
Sbjct: 704 KDDGLLDAFRHDLDVHRATAAEVFGVPLEDVNGDQRRSAKAINF--------------GL 749

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 750 IYGMSAFGLAKQI------------------------------GVERKEAQAYIDRYFAR 779

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V            +                             +    GR L   ++
Sbjct: 780 YPGVLAYMERTRAQAAE--------------------------QGFVETLFGRRLYLPEI 813

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
            +    +    +   R            +Q  + DI+   M+              ++L 
Sbjct: 814 HSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVILQ 864

Query: 628 VHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +         +  LM+   +    +PL  E      +
Sbjct: 865 VHDELVLEVREDLVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|306842589|ref|ZP_07475238.1| DNA polymerase I [Brucella sp. BO2]
 gi|306287234|gb|EFM58722.1| DNA polymerase I [Brucella sp. BO2]
          Length = 978

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 204/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 VLAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                       LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDAALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|306844396|ref|ZP_07476986.1| DNA polymerase I [Brucella sp. BO1]
 gi|306275209|gb|EFM56959.1| DNA polymerase I [Brucella sp. BO1]
          Length = 978

 Score =  439 bits (1128), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 204/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 VLAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                       LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDAALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTISSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|313200166|ref|YP_004038824.1| DNA polymerase i [Methylovorus sp. MP688]
 gi|312439482|gb|ADQ83588.1| DNA polymerase I [Methylovorus sp. MP688]
          Length = 918

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 118/705 (16%), Positives = 202/705 (28%), Gaps = 168/705 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD-----PVMP---- 54
           +  D ET S   LT            ++  +F             HD       +P    
Sbjct: 343 VCFDTETTSLDPLT----------AKLVGMSFSIKAGEAAYLPLTHDYPGAPDQLPFAAT 392

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SALKA 111
              +K  LEN  +  V  N  +++ VL     + +       TL+ +          +  
Sbjct: 393 LARIKPLLENPAIKKVGQNLKYDKHVLANH-GIVLNGIA-HDTLLQSYVLESHRTHGMDD 450

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +             G + I      E       +     + A     EY   D  VT ++
Sbjct: 451 LAMRH--------LGVQTITY----EQVAGKGAKQVSFSQVALEQASEYAAEDADVTLQL 498

Query: 172 FKRLEP-----------LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               E  +  +  TI   G  +D  + +  +  +  +   L+Q
Sbjct: 499 HENLYPQVAEDAKLEFVYRQIEMPVLDILFTIERNGVLIDNDMLNRQSHEIGQKLMALEQ 558

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHL----EDLTETTCQRVLSSNKKLTPQAIQV 276
           +   L      +    ++L+  LF + G+         T +T + VL       P    +
Sbjct: 559 QAYELAGQP-FNLGSPKQLQEILFGKLGIKPLKKTPSGTPSTDEDVLQELALDYPLPKVL 617

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
              R   ++      + L   +N   GR+  +     A  TGR S      QN+P  +  
Sbjct: 618 LEYR-GLAKLKSTYTDKLPRMINPTTGRVHTSYSQAVA-VTGRLSSSDPNLQNIPVRTAE 675

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   +A  G  +V AD + IE R++A ++ +
Sbjct: 676 GRR-------------------------IREAFVAPAGGHIVSADYSQIELRIMAHLSQD 710

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
              L AF  GED++  T A  F V    V+ +QR   KV+   L Y   A          
Sbjct: 711 DGLLTAFAAGEDIHRATAAEIFGVERDAVSSEQRRYAKVINFGLIYGMSA-----FGLAQ 765

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
            L +   A           +    ++ +  +E        + F G               
Sbjct: 766 NLGIERQAAQNYIERYFTRYPGVRDYMQNTRERAKAQGYVETFFGR-------------- 811

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
               LW                                      +  P+G          
Sbjct: 812 ---RLW-----------------------------------VPEINSPNGMRRA------ 827

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA------TKAGYDIVLTVH 629
                        R            +Q  + D++   M+         K    +++ VH
Sbjct: 828 ----------GAERAAINAP------MQGTAADLIKLAMIAVQGWLESEKLATKLIMQVH 871

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E PD +       L  LM         +PL AE      +
Sbjct: 872 DELVLEVPDNELALVKEKLPQLMQDVAK--LDVPLLAEVGVGSNW 914


>gi|318064432|gb|ADV36447.1| DNA polymerase I [Edwardsiella phage eiAU]
 gi|318064540|gb|ADV36499.1| DNA polymerase I [Edwardsiella phage eiDWF]
 gi|318064644|gb|ADV36551.1| DNA polymerase I [Edwardsiella phage eiMSLS]
          Length = 735

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 244/735 (33%), Positives = 349/735 (47%), Gaps = 67/735 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWD--CVHDPV------- 52
           LF+DFET S  DL K G   YAE     ++L ++ FDD P ++WD  C            
Sbjct: 5   LFLDFETFSEADLKKVGAYAYAEHDSTEILLASYAFDDGPAKVWDATCASGESDIDLDNN 64

Query: 53  -MPQVLKEALENTD---VTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPS 107
             P  L   L       V +V HN   F+R +++ C  LDIP      T+V A  + LP 
Sbjct: 65  SAPDDLLRGLRRAKRGRVKLVMHNGLMFDRLIIRECLGLDIPPEHIHDTMVQAFRHALPG 124

Query: 108 ALKAVGEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGD 164
           +L  + E L + +   K + GK LI RFCK         R ++  H + W+ F  Y + D
Sbjct: 125 SLDKLCEVLNVDADLAKDKAGKALIKRFCKPTPKNYKIRRYDRNTHPDEWKQFKHYARND 184

Query: 165 VTVTREIFKRLEPL--SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           +T  REI+ ++       KE E+  LDQ INDRG+ VD  LA      V   R +L +  
Sbjct: 185 ITAMREIYYKMPSWGEIDKENEILALDQRINDRGFYVDTDLAKAATAAVAAARAELQEAA 244

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           ++   G ++ +  L  L+          + +  ++T   +   +  L  +A QV   R+ 
Sbjct: 245 QATYGGGLTGADFLPLLRDLAPAHH---IPNAQKSTLGDL-LDDADLPDEARQVIEMRLG 300

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
           A+ +A  K   L+  M++DGR RG LQ+ GA RT RW+G  F PQNL R     + L + 
Sbjct: 301 AASTASTKYAPLLNGMSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYFKEKPLARG 360

Query: 343 ITHLPTSITSD-PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
           I  L         D +++ +  VR C+I + GKKLVVAD + +E R LAW+AGE   L  
Sbjct: 361 IEALKRGTAEYAFDVMKLAASTVRGCIIPAPGKKLVVADYSNVEGRGLAWLAGEDSALDT 420

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNT 461
           F  G D+Y  T  + F ++P  V   +R IGK  EL LGY GG  AF   +   GL+L  
Sbjct: 421 FRAGLDIYKVTAGKMFGISPDDVDGYRRQIGKACELGLGYGGGVAAFLTFSKNLGLDLEE 480

Query: 462 FA------------HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
            A                      + ++ +      +++     +        C+ +K+ 
Sbjct: 481 MAVTMAGTFPDYHWRAALRAYEFMKLQEVKRKPLPGKKDDRTTVVLSKKAWLTCDCIKRM 540

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARK-----------RRDVPLVYMKKDKNNL 558
           WR+ H R  + W +L +A    I+N  A                R +  L    K  N L
Sbjct: 541 WRESHPRTVQFWYDLEEACLMAIDNPGASYWAGAKVRQDGKRAIRIERTLTRSGKPGNWL 600

Query: 559 ILMLPSGRSLVYRDVG------------------NNRSYLNTTTRQLTREYTYGGKLTEN 600
            + LPSGR L Y  +G                        N  TRQ   ++TYGGKL EN
Sbjct: 601 KIELPSGRILSYPGIGVSMEKTNEDDPGEKARPRIKYRGENQLTRQWGWQHTYGGKLAEN 660

Query: 601 IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG 660
           + QA+ RDILA  M+    AGY+I+L+VHDE++ ETPDT E+N + L  LM   P+WAKG
Sbjct: 661 VTQALCRDILAWCMLPVDNAGYEIILSVHDELITETPDTAEYNVAELERLMCDLPAWAKG 720

Query: 661 LPLKAEGYESKRYRK 675
            PLKAEG+E  RY+K
Sbjct: 721 FPLKAEGWEGYRYKK 735


>gi|254447582|ref|ZP_05061048.1| DNA polymerase I [gamma proteobacterium HTCC5015]
 gi|198262925|gb|EDY87204.1| DNA polymerase I [gamma proteobacterium HTCC5015]
          Length = 900

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 100/707 (14%), Positives = 199/707 (28%), Gaps = 170/707 (24%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   +             ++  +F  + +        HD            + 
Sbjct: 324 SFDTETTSLNYM----------QAEIVGVSFAVEYNKAAYVPLGHDYPGAPEQLDRDAVL 373

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
             LK  LE+T    V  +  +++ VL     +++       T++ +           + +
Sbjct: 374 NALKPLLEDTGKAKVGQHLKYDKNVLARY-GIELKGIA-HDTMLASYVLNSVAGRHDMDS 431

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L       E       +    ++        Y   D  +T ++
Sbjct: 432 LAERY------------LDRHTVHYEDIAGKGAKQLTFNQIDLEQAAPYAAEDADITLQL 479

Query: 172 FKRLEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P    E             L  +   I   G  VD    +  +Q +     + ++
Sbjct: 480 HRELWPKLQTEPSLERVYQSLEVPLVDVLARIEQNGVKVDADALYAQSQELAEGMRQAEE 539

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKL-TPQAIQ 275
              +       +    ++L+  LF + GL           +T + VL        P    
Sbjct: 540 AAHNEAG-ESFNLGSPKQLQAILFEKQGLPVVRKTPKGQPSTAEDVLEELAAQGHPLPQW 598

Query: 276 VFNNRMRASRSAVLKLNTLVEAMN-SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           +   R   S+      + L + ++   GR+  +     A+ TGR S      QN+P  S 
Sbjct: 599 ILRYR-ALSKLKSTYTDKLPQLIDSKTGRVHTSYHQAVAA-TGRLSSSDPNLQNIPIRSE 656

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   +A  G K++ AD + IE R++A ++G
Sbjct: 657 EGRR-------------------------IREAFVAEPGHKILAADYSQIELRIMAHLSG 691

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++  ++AF+ G D++  T +  F V   +V  +QR   K +                   
Sbjct: 692 DETLIRAFKEGRDIHQATASEVFGVPLDEVESEQRRRAKAVN--------------FGLI 737

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  A +        +     + +++
Sbjct: 738 YGMS------------------------------AFGLAKQLGISRGEAQGYVDTYFERY 767

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V +      +   +                             +    GR L   ++ 
Sbjct: 768 PGVRDYMERTREQARE--------------------------QGYVETEFGRRLYLPEIQ 801

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTV 628
           +             R            +Q  + DI+   M+    A         +V+ V
Sbjct: 802 SRNVPRRQH---AERTAINAP------MQGTAADIIKRAMIAIHDALEKELPDVRMVMQV 852

Query: 629 HDEIVCETPDTDEFNASMLYHL-MTSNPSWAKGLPLKAEGYESKRYR 674
           HDE+V E P+        L    M         + L  E   +  + 
Sbjct: 853 HDELVFEVPEDQAKQTQALVETKMVEAAD--LRVALDVESDIADSWG 897


>gi|261218126|ref|ZP_05932407.1| DNA polymerase I [Brucella ceti M13/05/1]
 gi|261321027|ref|ZP_05960224.1| DNA polymerase I [Brucella ceti M644/93/1]
 gi|260923215|gb|EEX89783.1| DNA polymerase I [Brucella ceti M13/05/1]
 gi|261293717|gb|EEX97213.1| DNA polymerase I [Brucella ceti M644/93/1]
          Length = 994

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|118591476|ref|ZP_01548873.1| DNA polymerase I [Stappia aggregata IAM 12614]
 gi|118435804|gb|EAV42448.1| DNA polymerase I [Stappia aggregata IAM 12614]
          Length = 996

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 110/716 (15%), Positives = 200/716 (27%), Gaps = 175/716 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            +  D ET S            A    ++  +   +          H             
Sbjct: 407 YVSFDTETTSLD----------AMQAELVGVSLSTEPGKACYVPLGHVDGEGDLLGGGGL 456

Query: 51  -------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSN 103
                       VLK  LE+  V  +A N  ++  V+       I I  +  T++L+ + 
Sbjct: 457 VEGQIPLKDALDVLKPMLEDRSVLKIAQNLKYDWLVMTRY---GIDITPFDDTMLLSYTV 513

Query: 104 GLPSA---LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEY 160
                   +  + E              L  +    +             + A      Y
Sbjct: 514 DAGKGGNGMDELSER------------WLDHKPIPFKEICGSGKSMITFDKVAIDKATAY 561

Query: 161 CKGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQI 210
              D  VT  ++  L+P            + E+ +  +   +  RG  VD  +   L+  
Sbjct: 562 AAEDADVTLRLWLILKPRLASERMATVYETLERPMVPVLARMEKRGISVDRQMLSRLSGE 621

Query: 211 VDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSN 266
                   + E+  L      +    ++L   LF + GL     T+    +T  +VL   
Sbjct: 622 FAQGMAGKESEIYELAG-ENFNIGSPKQLGDILFGKMGLPGGKKTKTGAWSTSAQVLEDL 680

Query: 267 KKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPP 326
                +      +  + S+      + L   +N +     T   L A+ TGR S      
Sbjct: 681 AAEGHELPSRIVSWRQLSKLKSTYTDALPGYINPETGRVHTSYALAATTTGRLSSSEPNL 740

Query: 327 QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
           QN+P  +    +                         +R   IA +G KL+ AD + IE 
Sbjct: 741 QNIPVRTEEGRK-------------------------IRKAFIAEKGHKLISADYSQIEL 775

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           RVLA MA      KAF+ G D++  T +  F      +    R   K +           
Sbjct: 776 RVLAHMADIPQLKKAFDDGLDIHAMTASEMFGTPIEGMDPMVRRRAKAINF--------- 826

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
                    G++                                  A +           
Sbjct: 827 -----GIIYGIS------------------------------AFGLANQLGISRGEAGDY 851

Query: 507 KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
            K + ++   + +    + +                              N  +    GR
Sbjct: 852 IKTYFERFPGIKDYMEAIKKQVH--------------------------ANGYVTTIFGR 885

Query: 567 SLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KA 620
              Y +V      +        R            +Q  + DIL   M+         K 
Sbjct: 886 KAHYPEVNTKNPNMR---AFYERAAINAP------IQGSAADILRRAMVRMENRLEGSKL 936

Query: 621 GYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
              ++L VHDE++ E PD        ++  +M +   P+    +PL+ +   +  +
Sbjct: 937 DAQMLLQVHDELIFEVPDAQVETTIPVIKDVMENACDPALKLSVPLQVDARAANNW 992


>gi|261314660|ref|ZP_05953857.1| DNA polymerase I [Brucella pinnipedialis M163/99/10]
 gi|261316782|ref|ZP_05955979.1| DNA polymerase I [Brucella pinnipedialis B2/94]
 gi|261324239|ref|ZP_05963436.1| DNA polymerase I [Brucella neotomae 5K33]
 gi|265987853|ref|ZP_06100410.1| DNA polymerase I [Brucella pinnipedialis M292/94/1]
 gi|261296005|gb|EEX99501.1| DNA polymerase I [Brucella pinnipedialis B2/94]
 gi|261300219|gb|EEY03716.1| DNA polymerase I [Brucella neotomae 5K33]
 gi|261303686|gb|EEY07183.1| DNA polymerase I [Brucella pinnipedialis M163/99/10]
 gi|264660050|gb|EEZ30311.1| DNA polymerase I [Brucella pinnipedialis M292/94/1]
          Length = 994

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|261751451|ref|ZP_05995160.1| DNA polymerase I [Brucella suis bv. 5 str. 513]
 gi|261741204|gb|EEY29130.1| DNA polymerase I [Brucella suis bv. 5 str. 513]
          Length = 994

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|17988108|ref|NP_540742.1| DNA polymerase I [Brucella melitensis bv. 1 str. 16M]
 gi|265992327|ref|ZP_06104884.1| DNA polymerase I [Brucella melitensis bv. 1 str. Rev.1]
 gi|17983861|gb|AAL53006.1| DNA polymerase i [Brucella melitensis bv. 1 str. 16M]
 gi|263003393|gb|EEZ15686.1| DNA polymerase I [Brucella melitensis bv. 1 str. Rev.1]
          Length = 994

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 100/715 (13%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           +LA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 ILAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|261756014|ref|ZP_05999723.1| DNA polymerase I [Brucella suis bv. 3 str. 686]
 gi|261745767|gb|EEY33693.1| DNA polymerase I [Brucella suis bv. 3 str. 686]
          Length = 995

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 407 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 456

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 457 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 513

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 514 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 561

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 562 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 621

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 622 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 680

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 681 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 740

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 741 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 775

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 776 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 825

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 826 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 851

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 852 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 885

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 886 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 936

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 937 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 991


>gi|253998100|ref|YP_003050163.1| DNA polymerase I [Methylovorus sp. SIP3-4]
 gi|253984779|gb|ACT49636.1| DNA polymerase I [Methylovorus sp. SIP3-4]
          Length = 918

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 118/705 (16%), Positives = 202/705 (28%), Gaps = 168/705 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD-----PVMP---- 54
           +  D ET S   LT            ++  +F             HD       +P    
Sbjct: 343 VCFDTETTSLDPLT----------AKLVGMSFSIKAGEAAYLPLTHDYPGAPDQLPFAAT 392

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SALKA 111
              +K  LEN  +  V  N  +++ VL     + +       TL+ +          +  
Sbjct: 393 LARIKPLLENPAIKKVGQNLKYDKHVLANH-GIALNGIA-HDTLLQSYVLESHRTHGMDD 450

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +             G + I      E       +     + A     EY   D  VT ++
Sbjct: 451 LAMRH--------LGVQTITY----EQVAGKGAKQVSFSQVALEQASEYAAEDADVTLQL 498

Query: 172 FKRLEP-----------LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               E  +  +  TI   G  +D  + +  +  +  +   L+Q
Sbjct: 499 HENLYPQVAEDAKLEFVYRQIEMPVLDILFTIERNGVLIDNDMLNRQSHEIGQKLMALEQ 558

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHL----EDLTETTCQRVLSSNKKLTPQAIQV 276
           +   L      +    ++L+  LF + G+         T +T + VL       P    +
Sbjct: 559 QAYELAGQP-FNLGSPKQLQEILFGKLGIKPLKKTPSGTPSTDEDVLQELALDYPLPKVL 617

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
              R   ++      + L   +N   GR+  +     A  TGR S      QN+P  +  
Sbjct: 618 LEYR-GLAKLKSTYTDKLPRMINPTTGRVHTSYSQAVA-VTGRLSSSDPNLQNIPVRTAE 675

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   +A  G  +V AD + IE R++A ++ +
Sbjct: 676 GRR-------------------------IREAFVAPAGGHIVSADYSQIELRIMAHLSQD 710

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
              L AF  GED++  T A  F V    V+ +QR   KV+   L Y   A          
Sbjct: 711 DGLLTAFAAGEDIHRATAAEIFGVERDAVSSEQRRYAKVINFGLIYGMSA-----FGLAQ 765

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
            L +   A           +    ++ +  +E        + F G               
Sbjct: 766 NLGIERQAAQNYIERYFTRYPGVRDYMQNTRERAKAQGYVETFFGR-------------- 811

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
               LW                                      +  P+G          
Sbjct: 812 ---RLW-----------------------------------VPEINSPNGMRRA------ 827

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA------TKAGYDIVLTVH 629
                        R            +Q  + D++   M+         K    +++ VH
Sbjct: 828 ----------GAERAAINAP------MQGTAADLIKLAMIAVQGWLESEKLATKLIMQVH 871

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E PD +       L  LM         +PL AE      +
Sbjct: 872 DELVLEVPDNELALVKEKLPQLMQDVAK--LDVPLLAEVGVGSNW 914


>gi|261221353|ref|ZP_05935634.1| DNA polymerase I [Brucella ceti B1/94]
 gi|265997313|ref|ZP_06109870.1| DNA polymerase I [Brucella ceti M490/95/1]
 gi|260919937|gb|EEX86590.1| DNA polymerase I [Brucella ceti B1/94]
 gi|262551781|gb|EEZ07771.1| DNA polymerase I [Brucella ceti M490/95/1]
          Length = 994

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|157163334|ref|YP_001460652.1| DNA polymerase I [Escherichia coli HS]
 gi|157069014|gb|ABV08269.1| DNA polymerase I [Escherichia coli HS]
          Length = 928

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 103/704 (14%), Positives = 206/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N   R   T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTRRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|182679659|ref|YP_001833805.1| DNA polymerase I [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635542|gb|ACB96316.1| DNA polymerase I [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 1043

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 109/716 (15%), Positives = 205/716 (28%), Gaps = 176/716 (24%)

Query: 4    LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------- 50
            L ID ET S   +             +   +   +          H              
Sbjct: 454  LAIDTETTSLDPML----------ADLAGLSLCAEPGKAFYVPVGHTSGEGQDLFEGKGL 503

Query: 51   -------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSN 103
                    V+ + LK  LE+  +  +  N  ++  VLK      + +     TL+L+   
Sbjct: 504  LPGQLPIGVVLERLKPLLEDPSILKIGQNVKYDWIVLKQH---GVEMRPLDDTLLLSYVL 560

Query: 104  GLP---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEY 160
                    +  + E           G + I                    R A     EY
Sbjct: 561  DAGLTDHGMDVLSEKH--------LGHKPIPFSA----VAGSGRTFIGFARVAIDKATEY 608

Query: 161  CKGDVTVTREIFKRLEPLSSKE----------QELWYLDQTINDRGYCVDVALAHTLNQI 210
               D  VT  +++ L+P    E          + +  +   +  RG  +D  L   L+  
Sbjct: 609  AAEDADVTLRLWRVLKPRLPAEKMTTVYETLERPMIDVLARMERRGVAIDPPLLGRLSSD 668

Query: 211  VDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSN 266
               +  + + E+  L      +    ++L   LF + GL     T     +T   VL   
Sbjct: 669  FAQDMARYEAEIYELAG-EKFNLGSPKQLGDILFGKLGLPGAKKTATGAWSTAAGVLEDL 727

Query: 267  KKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPP 326
             +          +  + ++      + L   +N       T   L A+ TGR S      
Sbjct: 728  AEQGVDLAARILDWRQLAKLKSTYTDALPNYINPSSGRVHTSYALAATTTGRLSSSEPNL 787

Query: 327  QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
            QN+P  + +  +                         +R   IA  G+KLV AD + IE 
Sbjct: 788  QNIPVRNEAGRK-------------------------IRRAFIAPPGRKLVSADYSQIEL 822

Query: 387  RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
            R+LA +A  +    AF    D++  T +  F V    +  + R   K +           
Sbjct: 823  RLLAHIADIKSLKNAFAENLDIHAMTASEMFGVPVEGMPSEIRRRAKAINF--------- 873

Query: 447  AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
                     G++    A+ +                                        
Sbjct: 874  -----GIIYGISAFGLANQLAI------------------------------PREEAAAY 898

Query: 507  KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
             K + ++   +    ++  +   +                          N  +    GR
Sbjct: 899  IKKYFERFPGIRAYMDDTKKKARE--------------------------NGYVETIFGR 932

Query: 567  SLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KA 620
               Y  +  +            R            +Q  + DI+   M++        K 
Sbjct: 933  KCHYPRIKASNPSERAL---NERAAINAP------IQGSAADIIRRAMIHMEAALAAEKL 983

Query: 621  GYDIVLTVHDEIVCETPDTDEFN-ASMLYHLMTSNPSWA--KGLPLKAEGYESKRY 673
               ++L VHDE++ E PD +     +++  +M   P  A    +PL+ +   ++ +
Sbjct: 984  SAQMLLQVHDELIFEVPDDEVEATIAVVRKIMVEAPLPAVHLSVPLQVDAKAAQNW 1039


>gi|88705360|ref|ZP_01103071.1| DNA polymerase I [Congregibacter litoralis KT71]
 gi|88700450|gb|EAQ97558.1| DNA polymerase I [Congregibacter litoralis KT71]
          Length = 909

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 104/701 (14%), Positives = 194/701 (27%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVMP 54
             D ET S           Y E   ++  +F  +          H             + 
Sbjct: 334 AFDTETTSLN---------YME-ADIVGLSFAVERGEAAYVPLAHSYPGAPAQLDRDAIL 383

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+     +  N  ++ +VL    ++ +       T++ +              
Sbjct: 384 AALKPLLEDPAKPKLGQNLKYDASVLARY-DIHMQGIA-FDTMLESYVLDSTGT------ 435

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     +   K L       E       +     +      G Y   D  VT  + + 
Sbjct: 436 --RHDMDSLAL-KYLGRSTTHFEDVAGKGAKQITFDQVGIEQAGPYAAEDAEVTLALHET 492

Query: 175 LEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +   G  +D       ++ +      L++E  
Sbjct: 493 LWPKLQESAGLASVFSDIELPLVPVLSRMERTGALLDEERLWEQSRELGGRLQALEEEAH 552

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
           +L    V +    ++L   LF +  L +   T     +T + VL       P    +  +
Sbjct: 553 NLAGQ-VFNLGSPKQLGQILFEKLELPVIKKTPKGAPSTAEEVLQELALDYPLPKLLIEH 611

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   S+      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 612 R-GLSKLKSTYTDKLPGMINPRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRTEEGRR- 669

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA+EG ++V AD + IE R++A ++ +   L
Sbjct: 670 ------------------------IRQAFIAAEGYQVVAADYSQIELRIMAHLSKDAGLL 705

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           +AF    D++  T A  F V+   V+ +QR   K +                    G++ 
Sbjct: 706 EAFRENLDVHSATAAEVFGVSLDAVSGEQRRKAKAINF--------------GLIYGMS- 750

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        +R    + +++  V E
Sbjct: 751 -----------------------------AFGLARQLRLDRGEAQRYIDVYFERYPGVRE 781

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
             +       +                             +    GR L   ++      
Sbjct: 782 YMDNTRALAHE--------------------------QGYVETLFGRRLYLPEINVRNKN 815

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEIV 633
                    R            +Q  + DI+   M+   +          +++ VHDE+V
Sbjct: 816 RQQA---AERTAINAP------MQGTAADIIKRAMITVDRWIADDSVDAKMIMQVHDELV 866

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +         L   M++    A  +PL  E      +
Sbjct: 867 LEVAEDQLDPVCDELCKQMSAAAELA--VPLLVEVGRGANW 905


>gi|254713302|ref|ZP_05175113.1| DNA polymerase I [Brucella ceti M644/93/1]
 gi|254716344|ref|ZP_05178155.1| DNA polymerase I [Brucella ceti M13/05/1]
          Length = 978

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|163842398|ref|YP_001626802.1| DNA polymerase I [Brucella suis ATCC 23445]
 gi|163673121|gb|ABY37232.1| DNA polymerase I [Brucella suis ATCC 23445]
          Length = 978

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QGELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|254707180|ref|ZP_05169008.1| DNA polymerase I [Brucella pinnipedialis M163/99/10]
 gi|254709275|ref|ZP_05171086.1| DNA polymerase I [Brucella pinnipedialis B2/94]
 gi|256030798|ref|ZP_05444412.1| DNA polymerase I [Brucella pinnipedialis M292/94/1]
 gi|256060266|ref|ZP_05450441.1| DNA polymerase I [Brucella neotomae 5K33]
 gi|256368587|ref|YP_003106093.1| DNA polymerase I [Brucella microti CCM 4915]
 gi|260169702|ref|ZP_05756513.1| DNA polymerase I [Brucella sp. F5/99]
 gi|261759239|ref|ZP_06002948.1| DNA polymerase I [Brucella sp. F5/99]
 gi|255998745|gb|ACU47144.1| DNA polymerase I [Brucella microti CCM 4915]
 gi|261739223|gb|EEY27219.1| DNA polymerase I [Brucella sp. F5/99]
          Length = 978

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|227355154|ref|ZP_03839565.1| DNA polymerase I [Proteus mirabilis ATCC 29906]
 gi|227164941|gb|EEI49788.1| DNA polymerase I [Proteus mirabilis ATCC 29906]
          Length = 949

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 107/702 (15%), Positives = 220/702 (31%), Gaps = 162/702 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  ++          D  +I  +F  +          HD            + 
Sbjct: 373 AFDTETDSLNNI----------DARLIGLSFAVEPGKAAYIPLRHDYLDAPEQLPVDEVL 422

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+  +  +  N  F+R +++    +++    +  T++ +      S+      
Sbjct: 423 TALKPILEDKTILKIGQNLKFDRGIMEN-EGIELNGI-YFDTMLESYVLNSVSS------ 474

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + E K L  +    E            ++        Y   D  +T  + + 
Sbjct: 475 --RHDMDTLAE-KHLNHKTTTFEEIAGKGKGQLTFNQIEVEQATLYAAEDADITLLLHQA 531

Query: 175 LEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +  +G  +D  +    +Q +     ++++E  
Sbjct: 532 LYPQIEAIAPLKHVYHDIEMPLVPVLSRMERKGVLIDAQVLAMQSQEITQRLAEIEKETF 591

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
           +L      +    ++L+  LF +  L +   T     +T + VL +          +  +
Sbjct: 592 ALAGQ-EFNLSSPKQLQEILFEKLNLPIIKKTPKGAPSTNEEVLEALAHSHELPRLILEH 650

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +NS  +   T      + TGR S      QN+P  +      
Sbjct: 651 R-GLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRR- 708

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   I  +G K+V AD + IE R++A ++ ++  L
Sbjct: 709 ------------------------IRQAFIVRDGFKIVAADYSQIELRIMAHLSQDKGLL 744

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T +  F +   +VT +QR   K +                    G++ 
Sbjct: 745 DAFAQGKDIHRATASEVFGIPLDEVTAEQRRSAKAINFG--------------LIYGMSA 790

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              +  +                                     +R    + +++  V +
Sbjct: 791 FGLSQQI------------------------------GVERKEAQRYMDLYFERYPGVLD 820

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                 +  +Q  + G                             GR L   ++ +  + 
Sbjct: 821 YM---ERTRKQASQQGYVETL-----------------------DGRRLYLPEINSKNAI 854

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTVHDEI 632
                +   RE           +Q  + DI+ + M+               +++ VHDE+
Sbjct: 855 RR---KASEREAINAP------MQGTAADIIKKAMIAVDNWICHECPDDVHMIMQVHDEL 905

Query: 633 VCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  ++    A +M++ LM S+   A  +PLK E      +
Sbjct: 906 VFEVRESYLEKANAMIHKLMESSMELA--IPLKVEVGVGNNW 945


>gi|254700935|ref|ZP_05162763.1| DNA polymerase I [Brucella suis bv. 5 str. 513]
          Length = 978

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|261344431|ref|ZP_05972075.1| DNA polymerase I [Providencia rustigianii DSM 4541]
 gi|282567335|gb|EFB72870.1| DNA polymerase I [Providencia rustigianii DSM 4541]
          Length = 934

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 209/701 (29%), Gaps = 159/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S             ++  ++  +F  +          HD            + 
Sbjct: 357 AFDTETDSLD----------TQEARLVGMSFAIEAGHAAYLPIGHDYLDAPVQLSLDDVI 406

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            V+K  LEN  +  +  N  ++  VL+    +++       T++ +      + +     
Sbjct: 407 AVMKPILENEKIGKIGQNLKYDAEVLENY-GIELKGIA-FDTMLESYVLNSVAGMG---- 460

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + +   L  +    E       +    ++        Y   D  VT  + + 
Sbjct: 461 --RHDMDSLADRH-LNHKTVSFEEIAGKGKKQLTFNQIPLEQAANYAAEDADVTLLLHQA 517

Query: 175 LEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +  +G  +D       ++I+     +L+++  
Sbjct: 518 LFPQLEEEPKLAHVFQNIEMPLVPVLVRMERKGVLIDAPTLAAQSKIITARLAELEKQAF 577

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKKLTPQAIQVFNN 279
            L      +    ++L+T LF +  L +   T +    T + VL            +  +
Sbjct: 578 ELAG-EEFNLASPKQLQTILFEKLQLPVIKKTPSGAASTNEEVLEELALNHELPKLLLEH 636

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 637 R-SLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSRDPNLQNIPVRTEEGRR- 694

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA +G K++ AD + IE R++A ++ ++  L
Sbjct: 695 ------------------------IRQAFIARKGYKVMAADYSQIELRIMAHLSQDKGLL 730

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F V   QVT DQR   K +                    G++ 
Sbjct: 731 TAFAEGKDIHKATAAEVFGVPLDQVTSDQRRSAKAINF--------------GLIYGMS- 775

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        +R    + +++  V  
Sbjct: 776 -----------------------------AFGLARQLGIPRGEAQRYMDLYFERYPGVLR 806

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                                                   +    GR L   D+ ++   
Sbjct: 807 YMENTRLQA--------------------------SEQGYVETLEGRRLYLADIKSSNGM 840

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                +   RE           +Q  + DI+ + M+         K   D+++ VHDE+V
Sbjct: 841 RR---KAAEREAINAP------MQGTAADIIKKAMIAVDHWLQTEKPEADMLMQVHDELV 891

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +++     + +  LM  +      +PLK E      +
Sbjct: 892 FEVKESELEKVQAKVQELMEQSMK--LDVPLKVEVGVGMNW 930


>gi|226327657|ref|ZP_03803175.1| hypothetical protein PROPEN_01529 [Proteus penneri ATCC 35198]
 gi|225204183|gb|EEG86537.1| hypothetical protein PROPEN_01529 [Proteus penneri ATCC 35198]
          Length = 949

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 110/702 (15%), Positives = 221/702 (31%), Gaps = 162/702 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  ++          D  +I  +F  +          H+            + 
Sbjct: 373 AFDTETDSLNNI----------DARLIGMSFAIEPGKAAYIPLRHEYLDAPEQLPVNDVL 422

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+ ++  +  N  F+R +++    +++       T++ +      S       
Sbjct: 423 AALKPILEDKNILKIGQNLKFDRGIMEN-EGIELNGIH-FDTMLESYVLNSVSN------ 474

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + E K L  +    E            ++        Y   D  +T  + + 
Sbjct: 475 --RHDMDTLAE-KHLNHKTTTFEEIAGKGKGQLTFNQIEVEQATLYAAEDADITLLLHQA 531

Query: 175 LEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           L P               E  L  +   +  +G  +D  +    +Q +     ++++E  
Sbjct: 532 LYPQIEAIEPLKHVYRDIEMPLVPVLSRMERKGVLIDAQVLAVQSQEITQRLAEIEKETF 591

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
           +L      +    ++L+  LF +  L +   T     +T + VL            +  +
Sbjct: 592 ALAGQ-EFNLSSPKQLQEILFDKLQLPVIKKTPKGAPSTNEEVLEELAHSHELPRLILEH 650

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +NS  +   T      + TGR S      QN+P  +      
Sbjct: 651 R-GLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRR- 708

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA EG K+V AD + IE R++A ++ ++  L
Sbjct: 709 ------------------------IRQAFIAREGFKIVAADYSQIELRIMAHLSQDKGLL 744

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T +  F +   +VT +QR   K +                    G++ 
Sbjct: 745 DAFAQGKDIHRATASEVFGIPLEEVTSEQRRSAKAINF--------------GLIYGMSA 790

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              +  +                                     +R    + +++  V +
Sbjct: 791 FGLSQQI------------------------------GVERREAQRYMDLYFERYPGVLD 820

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                 +  +Q  E G                             GR L   ++ +  + 
Sbjct: 821 YM---ERTRKQASEQGYVETLE-----------------------GRRLYLPEINSKNAI 854

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTVHDEI 632
                +   RE           +Q  + DI+ + M+           A   +++ VHDE+
Sbjct: 855 RR---KASEREAINAP------MQGTAADIIKKAMIAVDNWICNECPADVHMIMQVHDEL 905

Query: 633 VCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  ++   NA++ ++ LM S+   A  +PLK E      +
Sbjct: 906 VFEVRESYLENANIMIHKLMESSMELA--IPLKVEVGVGNNW 945


>gi|256045914|ref|ZP_05448788.1| DNA polymerase I [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563200|ref|ZP_05833686.1| DNA polymerase I [Brucella melitensis bv. 1 str. 16M]
 gi|260153216|gb|EEW88308.1| DNA polymerase I [Brucella melitensis bv. 1 str. 16M]
          Length = 978

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 100/715 (13%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           +LA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 ILAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|23501037|ref|NP_697164.1| DNA polymerase I [Brucella suis 1330]
 gi|161618111|ref|YP_001591998.1| DNA polymerase I [Brucella canis ATCC 23365]
 gi|254705303|ref|ZP_05167131.1| DNA polymerase I [Brucella suis bv. 3 str. 686]
 gi|260567234|ref|ZP_05837704.1| DNA polymerase I [Brucella suis bv. 4 str. 40]
 gi|23346901|gb|AAN29079.1| DNA polymerase I [Brucella suis 1330]
 gi|161334922|gb|ABX61227.1| DNA polymerase I [Brucella canis ATCC 23365]
 gi|260156752|gb|EEW91832.1| DNA polymerase I [Brucella suis bv. 4 str. 40]
          Length = 979

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 391 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 440

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 441 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 497

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 498 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 545

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 546 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 605

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 606 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 664

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 665 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 724

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 725 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 759

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 760 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 809

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 810 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 835

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 836 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 869

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 870 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 920

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 921 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 975


>gi|256158819|ref|ZP_05456680.1| DNA polymerase I [Brucella ceti M490/95/1]
 gi|256254204|ref|ZP_05459740.1| DNA polymerase I [Brucella ceti B1/94]
          Length = 978

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|225851663|ref|YP_002731896.1| DNA polymerase I [Brucella melitensis ATCC 23457]
 gi|256264827|ref|ZP_05467359.1| DNA polymerase I [Brucella melitensis bv. 2 str. 63/9]
 gi|225640028|gb|ACN99941.1| DNA polymerase I [Brucella melitensis ATCC 23457]
 gi|263095282|gb|EEZ18909.1| DNA polymerase I [Brucella melitensis bv. 2 str. 63/9]
 gi|326408142|gb|ADZ65207.1| DNA polymerase I [Brucella melitensis M28]
 gi|326537853|gb|ADZ86068.1| DNA polymerase I [Brucella melitensis M5-90]
          Length = 978

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTDSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|237814595|ref|ZP_04593593.1| DNA polymerase I [Brucella abortus str. 2308 A]
 gi|260755980|ref|ZP_05868328.1| DNA polymerase I [Brucella abortus bv. 6 str. 870]
 gi|260759204|ref|ZP_05871552.1| DNA polymerase I [Brucella abortus bv. 4 str. 292]
 gi|260760926|ref|ZP_05873269.1| DNA polymerase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885001|ref|ZP_05896615.1| DNA polymerase I [Brucella abortus bv. 9 str. C68]
 gi|237789432|gb|EEP63642.1| DNA polymerase I [Brucella abortus str. 2308 A]
 gi|260669522|gb|EEX56462.1| DNA polymerase I [Brucella abortus bv. 4 str. 292]
 gi|260671358|gb|EEX58179.1| DNA polymerase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676088|gb|EEX62909.1| DNA polymerase I [Brucella abortus bv. 6 str. 870]
 gi|260874529|gb|EEX81598.1| DNA polymerase I [Brucella abortus bv. 9 str. C68]
          Length = 994

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 206/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                 ++   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLLRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 THYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|148560597|ref|YP_001258160.1| DNA polymerase I [Brucella ovis ATCC 25840]
 gi|148371854|gb|ABQ61833.1| DNA polymerase I [Brucella ovis ATCC 25840]
          Length = 978

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 LP---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGRHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|260599983|ref|YP_003212554.1| DNA polymerase I [Cronobacter turicensis z3032]
 gi|260219160|emb|CBA34515.1| DNA polymerase I [Cronobacter turicensis z3032]
          Length = 966

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 103/706 (14%), Positives = 211/706 (29%), Gaps = 167/706 (23%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PV 52
            + +D ET S  +LT            ++  +F  +          HD            
Sbjct: 389 VVAVDTETDSLDNLT----------ANLVGISFATEPGLAAYIPVAHDYLDAPDQLPRDR 438

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSAL 109
           + ++LK  LE+  +  V  N  F+R +L+    +++       T++ +           +
Sbjct: 439 VLELLKPLLEDESLVKVGQNLKFDRGILQNY-GIELRGI-VFDTMLESYILDSVSGRHDM 496

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++                L       E            ++      G Y   D  VT 
Sbjct: 497 DSLSSR------------WLKHTTITFEQIAGKGKNQLTFNQIDLEQAGRYAAEDADVTL 544

Query: 170 EIFKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++  ++ P   +              L  +   I   G  +D A+ H  +Q + ++  +L
Sbjct: 545 QLHLKMWPKLQQHKGPLNIFEHIEMPLVPVLSRIERNGVKIDPAVLHAHSQEIALKLAEL 604

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAI 274
           +Q+   +      +    ++L+T LF + G+     T     +T + VL       P   
Sbjct: 605 EQKAHEIAG-EPFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPK 663

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
            +   R   ++      + L + +N       T      + TGR S      QN+P  + 
Sbjct: 664 VILQYR-GLAKLKSTYTDKLPQMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRND 722

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA E   +V AD + IE R++A ++ 
Sbjct: 723 EGRR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSR 757

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++  L AF  G+D++  T A  F +    V+ +QR   K +                   
Sbjct: 758 DKGLLSAFAEGKDIHRATAAEVFGLPLESVSNEQRRSAKAINF--------------GLI 803

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  + +        ++    + +++
Sbjct: 804 YGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFERY 833

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V E      +  ++                             +    GR L   D+ 
Sbjct: 834 PGVLEYMERTRKQAKE--------------------------QGYVETLDGRRLYLPDIN 867

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTV 628
            + +       +               +Q  + DI+   M+         +    +++ V
Sbjct: 868 ASNAARRAGAER---------AAINAPMQGTAADIIKRAMIAVDGWLEKEQPRVKMIMQV 918

Query: 629 HDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E    D       ++ LM ++      +PL  E      +
Sbjct: 919 HDELVFEVHKDDVEAVSQKIHELMENSMQ--LDVPLLVEVGSGVNW 962


>gi|294851526|ref|ZP_06792199.1| DNA polymerase I [Brucella sp. NVSL 07-0026]
 gi|294820115|gb|EFG37114.1| DNA polymerase I [Brucella sp. NVSL 07-0026]
          Length = 978

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 VQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|331665510|ref|ZP_08366408.1| DNA polymerase I (POL I) [Escherichia coli TA143]
 gi|331057195|gb|EGI29185.1| DNA polymerase I (POL I) [Escherichia coli TA143]
          Length = 928

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V +         ++                             +    GR L   D+ ++
Sbjct: 798 VLQYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|256112629|ref|ZP_05453550.1| DNA polymerase I [Brucella melitensis bv. 3 str. Ether]
          Length = 696

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 108 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 157

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 158 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 214

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 215 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 262

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 263 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 322

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 323 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 381

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 382 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 441

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 442 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 476

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 477 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 526

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 527 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 552

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 553 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 586

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 587 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 637

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 638 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 692


>gi|62289104|ref|YP_220897.1| DNA polymerase I [Brucella abortus bv. 1 str. 9-941]
 gi|82699042|ref|YP_413616.1| DNA polymerase I [Brucella melitensis biovar Abortus 2308]
 gi|189023378|ref|YP_001934146.1| DNA polymerase I [Brucella abortus S19]
 gi|254690432|ref|ZP_05153686.1| DNA polymerase I [Brucella abortus bv. 6 str. 870]
 gi|254696548|ref|ZP_05158376.1| DNA polymerase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731463|ref|ZP_05190041.1| DNA polymerase I [Brucella abortus bv. 4 str. 292]
 gi|256258684|ref|ZP_05464220.1| DNA polymerase I [Brucella abortus bv. 9 str. C68]
 gi|260546401|ref|ZP_05822141.1| DNA polymerase I [Brucella abortus NCTC 8038]
 gi|297247520|ref|ZP_06931238.1| DNA polymerase I [Brucella abortus bv. 5 str. B3196]
 gi|62195236|gb|AAX73536.1| PolA, DNA polymerase I [Brucella abortus bv. 1 str. 9-941]
 gi|82615143|emb|CAJ10076.1| 5'3'-Exonuclease N-and I-domain:DNA-directed DNA polymerase:DNA
           polymerase, family A:5'-3' exonuclease:3'-5'
           exonuclease:Hel [Brucella melitensis biovar Abortus
           2308]
 gi|189018950|gb|ACD71672.1| DNA polymerase I [Brucella abortus S19]
 gi|260096508|gb|EEW80384.1| DNA polymerase I [Brucella abortus NCTC 8038]
 gi|297174689|gb|EFH34036.1| DNA polymerase I [Brucella abortus bv. 5 str. B3196]
          Length = 978

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 206/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                 ++   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLLRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 THYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|262041646|ref|ZP_06014839.1| DNA polymerase I [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259040999|gb|EEW42077.1| DNA polymerase I [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 927

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 352 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 401

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  V  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 402 ALLKPLLEDEKVLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 453

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 454 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 510

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 511 MWPKLQQHEGPLNIFQHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 570

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 571 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 629

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 630 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 687

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 688 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 723

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 724 TAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 768

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 769 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 799

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 800 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 833

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+         K    +++ VHDE+V
Sbjct: 834 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRSEKPRVRMIMQVHDELV 884

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 885 FEVHKDELDAVSKKIHELMENSTTLA--VPLLVEVGSGENW 923


>gi|119773235|ref|YP_925975.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
 gi|119765735|gb|ABL98305.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
          Length = 923

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 111/705 (15%), Positives = 210/705 (29%), Gaps = 166/705 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVM 53
           + +D ET S   +             ++  +F  +          HD             
Sbjct: 346 IAVDTETTSLDYM----------QAELVGLSFAIEAGKAAYLPLGHDYPGAPSQLPREAT 395

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA-LKAV 112
              LK  LEN D+  V  N  ++ +VL     + +       T++ +      ++     
Sbjct: 396 LAKLKPLLENPDIKKVGQNLKYDMSVLANA-GIQLKGVA-FDTMLESYVFNSVASRHDMD 453

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
           G ALK    K    +E                +    ++ A      Y   D  +T  + 
Sbjct: 454 GLALKYLGHKNISFEE----------IAGKGAKQLTFNQIALEQAAPYAAEDADITLRLH 503

Query: 173 KRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           + L P               E  L  +   I  RG  +D  L    ++ +  +  +L+Q 
Sbjct: 504 QHLWPRLSKEEGLESVFTELELPLIEVLSDIERRGVLIDSMLLGQQSEELARKIDELEQH 563

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVF 277
              +      +    ++L+   F + G  +   T     +T + VL       P    + 
Sbjct: 564 AHEIAG-EPFNLSSTKQLQELFFTKLGYPVIKKTPKGAPSTAEEVLVELALDYPLPKIIL 622

Query: 278 NNRMRASRSAVLKLNTLVEAMN-SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
            +R   ++      + L   +N   GR+  +     A+ TGR S      QN+P  +   
Sbjct: 623 EHR-SLTKLKSTYTDKLPLMINGRTGRVHTSYHQANAA-TGRLSSSDPNLQNIPIRTEEG 680

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   +A EGK+++ AD + IE R++A ++ ++
Sbjct: 681 RR-------------------------IRQAFVAPEGKRILAADYSQIELRIMAHLSQDE 715

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L+AF  G+D++  T A  F+VA   VT +QR   K +                    G
Sbjct: 716 GLLRAFAEGKDIHRATAAEVFDVAFETVTSEQRRRAKAVN--------------FGLIYG 761

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++    A  +                                     +     + +++  
Sbjct: 762 MSAFGLARQLDI------------------------------PRNEAQSYIDTYFKRYPG 791

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V +   E                                    +    GR L   ++ + 
Sbjct: 792 VLKYMEETRAMA--------------------------SEQGYVSTLFGRRLYLPEIRDR 825

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTVH 629
            +          R            +Q  + DI+ + M+               +++ VH
Sbjct: 826 NAMRRQA---AERAAINAP------MQGTAADIIKKAMIAIQHWIKTETQGEIQMIMQVH 876

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E            +  LM +  S    +PL AE      +
Sbjct: 877 DELVFEVDADKADALKEKVCELMAAAAS--LDVPLLAEAGLGDNW 919


>gi|71276267|ref|ZP_00652545.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900322|ref|ZP_00682457.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71162875|gb|EAO12599.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729897|gb|EAO31993.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 273/726 (37%), Positives = 367/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     MP+ L  AL 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           N  V +  HNS+F+RTVL     +DIP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQ 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL   +
Sbjct: 128 AKAKDGKRLVALFCKPRPAHCTLRRATRDTHPTEWAQFVEYARRDVAAMRDVVKRLPSHN 187

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               EL  W+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   +
Sbjct: 188 YTGAELALWFLDQTINDRGVMVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L  E G+ L D+ + T +R L  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCL-DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S   +   I  +          D
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGTW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  VTK+QR IGKV 
Sbjct: 427 HSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   ++A    +W + N       
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMAEQAAL--PPLLLQEAVEALQWTKANQRPTFGL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + M+  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWKALQFAATDAIRHPETA-----HTCCGITMQYSR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG++
Sbjct: 660 LAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQ 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 THRYRK 725


>gi|12001918|gb|AAG43102.1|AF038542_1 DNA polymerase I [Pseudomonas fluorescens]
          Length = 939

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 104/712 (14%), Positives = 200/712 (28%), Gaps = 168/712 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DP 51
                D ET              A+   ++  +F    +        H            
Sbjct: 352 KLFAFDTETT----------GIDAQQAQLVGLSFAVQANEAAYIPLTHSYIGVPEQLDRD 401

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACF-------NLDIPIHRWICTLVLARSNG 104
            + + LK  LE+ +   V  ++ F+  +L  C         + +       T++ +    
Sbjct: 402 TVLRALKPILEDPNKLKVGQHAKFDMNILANCAIGGDQNEGITVRGIA-FDTMLESYVLN 460

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGD 164
             +         +     + + K L       +       +     + A    G Y   D
Sbjct: 461 STAT--------RHDMDSLAQ-KYLNHTTVSFQDIAGKGAKQLTFDQIALEQAGPYAAED 511

Query: 165 VTVTREIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDV 213
             VT  + + L                 E  L  +   I  +G  VD  L    +  +  
Sbjct: 512 ADVTLRLHQTLFEKLSAIPSLASVLTDIEIPLVPVLARIERQGAFVDADLLGIQSIELGN 571

Query: 214 ERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKL 269
           +   L++E   +      +    ++L   L+ + GL +   T     +T + VL+   + 
Sbjct: 572 KMVALEREAFEIAG-EEFNLGSPKQLGVILYEKLGLPVLKKTAKGQPSTAEEVLAKLAED 630

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQN 328
             +  +V       S+      + L E +N   GR+  +     A  TGR S      QN
Sbjct: 631 DHRLPKVLMEHRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-STGRLSSSDPNLQN 689

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
           +P  +                              +R   +A +G KL+ AD + IE R+
Sbjct: 690 IPVRTAEGRR-------------------------IRQAFVAPKGYKLLAADYSQIELRI 724

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           +A ++ ++  + AF    D++  T A  F V   +VT DQR   K +             
Sbjct: 725 MAHLSRDEGLMNAFRNNLDVHTATAAEVFKVELNEVTSDQRRGAKAINF----------- 773

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                  G+                                 +   +        +    
Sbjct: 774 ---GLIYGMG------------------------------AQKLGKDIGVDTKTAKAYID 800

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            +  ++  V E  +                                 +   +    GR L
Sbjct: 801 TYFARYPGVREYMDRTRAQA--------------------------ADQGFVETIFGRRL 834

Query: 569 VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGY 622
              D+ +N+           R            +Q  + DI+ + M+             
Sbjct: 835 YLPDINSNKP---QERAAAERTAINAP------MQGTAADIIKKAMVAVDNWLCASGLDA 885

Query: 623 DIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            ++L VHDE+V E  +         +   M+        +PL  E      +
Sbjct: 886 KVILQVHDELVLEVREDLVDQVREEIRVHMSEAAK--LDVPLLVEVGVGNNW 935


>gi|260870580|ref|YP_003236982.1| DNA polymerase I [Escherichia coli O111:H- str. 11128]
 gi|300906177|ref|ZP_07123891.1| DNA-directed DNA polymerase [Escherichia coli MS 84-1]
 gi|301303329|ref|ZP_07209453.1| DNA-directed DNA polymerase [Escherichia coli MS 124-1]
 gi|301328175|ref|ZP_07221307.1| DNA-directed DNA polymerase [Escherichia coli MS 78-1]
 gi|257766936|dbj|BAI38431.1| DNA polymerase I [Escherichia coli O111:H- str. 11128]
 gi|300402027|gb|EFJ85565.1| DNA-directed DNA polymerase [Escherichia coli MS 84-1]
 gi|300841283|gb|EFK69043.1| DNA-directed DNA polymerase [Escherichia coli MS 124-1]
 gi|300845357|gb|EFK73117.1| DNA-directed DNA polymerase [Escherichia coli MS 78-1]
 gi|315254225|gb|EFU34193.1| DNA-directed DNA polymerase [Escherichia coli MS 85-1]
          Length = 928

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|218701437|ref|YP_002409066.1| DNA polymerase I [Escherichia coli IAI39]
 gi|218371423|emb|CAR19256.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli IAI39]
          Length = 928

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|331649706|ref|ZP_08350786.1| DNA polymerase I (POL I) [Escherichia coli M605]
 gi|330908181|gb|EGH36700.1| DNA polymerase 1 [Escherichia coli AA86]
 gi|331041339|gb|EGI13489.1| DNA polymerase I (POL I) [Escherichia coli M605]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|301023768|ref|ZP_07187505.1| DNA-directed DNA polymerase [Escherichia coli MS 69-1]
 gi|300396890|gb|EFJ80428.1| DNA-directed DNA polymerase [Escherichia coli MS 69-1]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|227885402|ref|ZP_04003207.1| DNA polymerase I [Escherichia coli 83972]
 gi|300937085|ref|ZP_07151949.1| DNA-directed DNA polymerase [Escherichia coli MS 21-1]
 gi|300976637|ref|ZP_07173526.1| DNA-directed DNA polymerase [Escherichia coli MS 45-1]
 gi|301046666|ref|ZP_07193796.1| DNA-directed DNA polymerase [Escherichia coli MS 185-1]
 gi|227837660|gb|EEJ48126.1| DNA polymerase I [Escherichia coli 83972]
 gi|300301386|gb|EFJ57771.1| DNA-directed DNA polymerase [Escherichia coli MS 185-1]
 gi|300410020|gb|EFJ93558.1| DNA-directed DNA polymerase [Escherichia coli MS 45-1]
 gi|300457842|gb|EFK21335.1| DNA-directed DNA polymerase [Escherichia coli MS 21-1]
 gi|307556005|gb|ADN48780.1| DNA polymerase I [Escherichia coli ABU 83972]
 gi|315292801|gb|EFU52153.1| DNA-directed DNA polymerase [Escherichia coli MS 153-1]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|306813871|ref|ZP_07448047.1| DNA polymerase I [Escherichia coli NC101]
 gi|305852869|gb|EFM53316.1| DNA polymerase I [Escherichia coli NC101]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+  LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQNILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|53803295|ref|YP_114980.1| DNA polymerase I [Methylococcus capsulatus str. Bath]
 gi|53757056|gb|AAU91347.1| DNA polymerase I [Methylococcus capsulatus str. Bath]
          Length = 906

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 106/705 (15%), Positives = 202/705 (28%), Gaps = 169/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPV----------MP 54
             D ET S   +             VI  +F  +          HD            + 
Sbjct: 331 AFDTETSSLDYMR----------AEVIGLSFAVEPGAAAYVPLAHDYPGAPPQLDRAMVL 380

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
           + L+  LE+     +  +  ++  VL     + +   R   T++ +           + +
Sbjct: 381 ERLRPLLEDPGKAKLGQHLKYDANVLLNH-GIMLRGIR-HDTMLESYVLNSTATRHDMDS 438

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E       +  P  R +      Y   D  VT  +
Sbjct: 439 LAERY------------LDRKTLHYEDVAGKGAKQIPFARVSVEDACRYAAEDADVTLCL 486

Query: 172 FKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               E  L  +   I   G  VDV      ++ ++    +++ 
Sbjct: 487 HRALWPRLESIPSLRAVYETIEIPLVPVLSRIERAGVLVDVYKLAEQSRELERRMAEVEA 546

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           E  ++      +    ++++T L+ + GL +   T     +T + VL    +       +
Sbjct: 547 EARAVAG-ETFNLGSPKQIQTILYDKLGLPVIKKTPTGQPSTDESVLQDLAETFELPRLI 605

Query: 277 FNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
              R   S+      + L   +N   GR+  +     A+ TGR S      QN+P  +  
Sbjct: 606 LEYR-SLSKLKSTYTDKLPHQVNPVSGRVHTSYHQAVAA-TGRLSSSDPNLQNIPVRTEE 663

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   +A  G KL+ AD + IE R++A ++G+
Sbjct: 664 GRR-------------------------IRQAFVAPPGHKLLAADYSQIELRIMAHLSGD 698

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
              L AF    D++  T A  F VA  +VT  QR   K +                    
Sbjct: 699 ANLLAAFAEDADVHRATAAEVFGVALEEVTSSQRRSAKAIN--------------FGLIY 744

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        +     +  ++ 
Sbjct: 745 GMS------------------------------AFGLAKQLGIQQKLAQGYIDLYFARYP 774

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V    +   ++  +                             +    GR L   D+ +
Sbjct: 775 GVRAYMDRTRESARE--------------------------LGYVETLFGRRLHVPDIQS 808

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVH 629
                        R            +Q  + DI+   M+          A   +++ VH
Sbjct: 809 RNGQRRQY---AERTAINAP------MQGTAADIIKRAMIALDAWIESSGAPLRMIMQVH 859

Query: 630 DEIVCETPDTDE-FNASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +       + +   M+     A  +PL  +      +
Sbjct: 860 DELVFEVAEDFVSEATATVREHMSRAAELA--VPLMVDIGTGDNW 902


>gi|300714614|ref|YP_003739417.1| DNA polymerase I [Erwinia billingiae Eb661]
 gi|299060450|emb|CAX57557.1| DNA polymerase I [Erwinia billingiae Eb661]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 110/703 (15%), Positives = 222/703 (31%), Gaps = 164/703 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   L+            ++  +F  +          HD            + 
Sbjct: 352 AFDLETDSLDTLS----------ANIVGISFAIEPGKAAYLPVAHDYLDAPAQLDRNSVL 401

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
           + LK  LE+  +  V  N  ++R VLK   ++++   +   T++ + +     +      
Sbjct: 402 ERLKPLLEDPALLKVGQNLKYDRGVLKNY-DIELQGIK-FDTMLESYALSSVGS------ 453

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     +   + L  +    E       +    ++        Y   D  VT ++  +
Sbjct: 454 --RHDMDTLSS-RWLNHKTVSFEEIAGKGKKQLTFNQIDLEQAAHYAAEDADVTLQLHLK 510

Query: 175 LEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   KEQ            L  +   I   G  +D  +    ++ + +   +L+Q+  
Sbjct: 511 MWPELEKEQGPKEVFENIEMPLLTVISRIERNGVLIDQGILAAHSKELTIRLAELEQKAH 570

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            L      +    ++L+T LF + G+     T     +T + VL+      P    +  N
Sbjct: 571 ELAG-EPFNLSSPKQLQTILFEKQGIKPTKKTPGGAPSTSEEVLAELALDYPLPKVILEN 629

Query: 280 RMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
           R   ++      + L   +N   GR+  +      + TGR S      QN+P  +     
Sbjct: 630 R-GLAKLKSTYTDKLPLMINPITGRVHTSYHQAV-TATGRLSSTDPNLQNIPVRNEEGRR 687

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    +R   IAS+G K+V AD + IE R++A ++ ++  
Sbjct: 688 -------------------------IRQAFIASKGHKIVAADYSQIELRIMAHLSQDKGL 722

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L AF  G D++  T A  F +A  +VT +QR   K +                    G++
Sbjct: 723 LSAFAEGMDIHRATAAEVFGMALDKVTGEQRRSAKAIN--------------FGLIYGMS 768

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             + +        ++    + +++  V 
Sbjct: 769 ------------------------------AFGLSRQLNIGAGEAKKYMDLYFERYPGVL 798

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
           E      Q   +                             +    GR L   D+  + +
Sbjct: 799 EYMESTRQQAAE--------------------------KGYVSTLDGRRLYLPDINASNA 832

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT-------KAGYDIVLTVHDE 631
                 +   R            +Q  + DI+ + M+               +++ VHDE
Sbjct: 833 MRR---KAAERAAINAP------MQGTAADIIKKAMIAVDGWLTPQSAPDVKMIMQVHDE 883

Query: 632 IVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           +V E   ++   A + +  LM ++      +PL+ +      +
Sbjct: 884 LVFEVKTSEVEAATAKIRDLMENSMK--LDVPLQVDVGVGDNW 924


>gi|226942232|ref|YP_002797305.1| DNA polymerase I [Azotobacter vinelandii DJ]
 gi|226717159|gb|ACO76330.1| DNA polymerase I [Azotobacter vinelandii DJ]
          Length = 908

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 107/702 (15%), Positives = 196/702 (27%), Gaps = 160/702 (22%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVM 53
           +  D ET S            A+   ++  +F             H             +
Sbjct: 331 IAFDSETTSLD----------AQQAELVGLSFAVAPLEAAYIPLAHSYMGVPDQLDRDAV 380

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
              L+  LE+     V  ++ ++  VL   + +++    +  T++ +      +      
Sbjct: 381 LAALRPILEDPARAKVGQHAKYDMNVLA-HYGIEVRGVAY-DTMLESYVLDSTAT----- 433

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
              +     +   K L     + E       +     + A    G Y   D  VT  + +
Sbjct: 434 ---RHDMDSLAL-KYLGQGTIRFEDIAGKGAKQLTFDQIALEQAGPYAAEDADVTLRLHQ 489

Query: 174 RLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
            L                 E  L  +   I   G  VD  L    +  +  +  +L++E 
Sbjct: 490 CLWQKLEAIPALAKVLKEIEMPLVPVLARIERHGALVDAKLLGEQSLELGEKLQQLEREA 549

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFN 278
             L      +    ++L   L+ + GL +   T     +T + VL+   +      QV  
Sbjct: 550 HELAG-EPFNLASPKQLGAILYDKLGLPVLSKTAKGQPSTAESVLADLAEQGYPLPQVIM 608

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
                ++      + L + +N       T      + TGR S      QN+P  +     
Sbjct: 609 RHRSLNKLKGTYTDKLPQQINPRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRTTEGRR 668

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    +R   +A EG +LV AD + IE R++A +A +   
Sbjct: 669 -------------------------IRQAFVAPEGYRLVAADYSQIELRIMAHLAQDTSL 703

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L AF    D++  T A  F VAP  V+ DQR   K +                    G++
Sbjct: 704 LHAFRNDLDVHRATAAEVFGVAPEAVSADQRRSAKAINF--------------GLIYGMS 749

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A +        +     +  ++  V 
Sbjct: 750 ------------------------------AFGLARQIGVERKEAQAYIDRYFARYPGVL 779

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
                      +                             +    GR L   ++ +   
Sbjct: 780 AYMERTRAQAAE--------------------------QGYVETLFGRRLYLPEIHSKNG 813

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEI 632
            L    +   R            +Q  + DI+   M+              ++L VHDE+
Sbjct: 814 ALR---KAAERTAINAP------MQGSAADIIKRAMVTVDAWLLESGLDARMILQVHDEL 864

Query: 633 VCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  +         L   M+     A  +PL  E      +
Sbjct: 865 VLEVREDQVEALKAGLLPRMSGAA--ALDVPLLVEAGVGGNW 904


>gi|90581061|ref|ZP_01236861.1| DNA polymerase I [Vibrio angustum S14]
 gi|90437757|gb|EAS62948.1| DNA polymerase I [Vibrio angustum S14]
          Length = 923

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 96/708 (13%), Positives = 199/708 (28%), Gaps = 168/708 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
                D ET     +T            V+  +F  ++         HD           
Sbjct: 344 KAFAFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRD 393

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSA 108
            + + LK  LE+     +  N  F+ +++     +++       T++ +           
Sbjct: 394 WVLEQLKPLLEDPKQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHD 451

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVT 168
           + ++                L  +    E       +    ++      G Y   D  +T
Sbjct: 452 MDSLALRY------------LEHKNISFEEVAGKGKKQLTFNQIDLEQAGPYAAEDADIT 499

Query: 169 REIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK 217
             +   L P               E  L  +   +   G  VD  L    +  +     +
Sbjct: 500 LRLHNTLYPKVEADDKLNHVFETIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAARLDE 559

Query: 218 LDQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQA 273
           ++++   +      +    ++L+  LF + GL         T +T + VL       P  
Sbjct: 560 IEKKAFEI-AEQEFNLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDYPLP 618

Query: 274 IQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
             +   R   ++      + L + +N       T      + TGR S      QN+P  +
Sbjct: 619 KLLLEYR-GLAKLKSTYTDKLPKMVNPATGRVHTSYHQAVTATGRLSSSDPNLQNIPVRN 677

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A  G K++  D + IE R++A ++
Sbjct: 678 EEGRR-------------------------IRQAFVAQSGYKILAVDYSQIELRIMAHLS 712

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           G++  L AF  G+D++  T A   ++   +V+ +QR   K +                  
Sbjct: 713 GDKALLDAFRHGKDIHAATAAEILSLDIEEVSSEQRRRAKAINF--------------GL 758

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     + ++
Sbjct: 759 IYGMSAFGLAKQLDM------------------------------GRNEAQNYMNVYFER 788

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V E       A                                +    GR L   D+
Sbjct: 789 YPGVLEYMESTRNAA--------------------------SEQGYVETLFGRRLYLPDI 822

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT-------KAGYDIVL 626
            +         +   R            +Q  + DI+   M+          +    +++
Sbjct: 823 KSRNGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDGWVQQQPEGNVRLLM 873

Query: 627 TVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            VHDE+V E  ++      + +  LM    +    +PL A+      +
Sbjct: 874 QVHDELVFEVKESALEAVTASVKALMEQAAT--LDVPLIADTGYGDNW 919


>gi|110644203|ref|YP_671933.1| DNA polymerase I [Escherichia coli 536]
 gi|191173870|ref|ZP_03035390.1| DNA polymerase I [Escherichia coli F11]
 gi|300985836|ref|ZP_07177621.1| DNA-directed DNA polymerase [Escherichia coli MS 200-1]
 gi|110345795|gb|ABG72032.1| DNA polymerase I [Escherichia coli 536]
 gi|190905828|gb|EDV65447.1| DNA polymerase I [Escherichia coli F11]
 gi|300306506|gb|EFJ61026.1| DNA-directed DNA polymerase [Escherichia coli MS 200-1]
 gi|324006871|gb|EGB76090.1| DNA-directed DNA polymerase [Escherichia coli MS 57-2]
 gi|324012590|gb|EGB81809.1| DNA-directed DNA polymerase [Escherichia coli MS 60-1]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|281180926|dbj|BAI57256.1| DNA polymerase I [Escherichia coli SE15]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|110807452|ref|YP_690972.1| DNA polymerase I [Shigella flexneri 5 str. 8401]
 gi|110617000|gb|ABF05667.1| DNA polymerase I [Shigella flexneri 5 str. 8401]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------LGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|30064847|ref|NP_839018.1| DNA polymerase I [Shigella flexneri 2a str. 2457T]
 gi|30043107|gb|AAP18829.1| DNA polymerase I [Shigella flexneri 2a str. 2457T]
 gi|281603252|gb|ADA76236.1| DNA polymerase I, 3--> 5 polymerase, 5--> 3 and 3--> 5 exonuclease
           [Shigella flexneri 2002017]
 gi|332751499|gb|EGJ81900.1| DNA polymerase I [Shigella flexneri K-671]
 gi|332753203|gb|EGJ83586.1| DNA polymerase I [Shigella flexneri 2747-71]
 gi|333013930|gb|EGK33292.1| DNA polymerase I [Shigella flexneri K-304]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------LGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|170683498|ref|YP_001746191.1| DNA polymerase I [Escherichia coli SMS-3-5]
 gi|170521216|gb|ACB19394.1| DNA polymerase I [Escherichia coli SMS-3-5]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 103/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LEN     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLENEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|332084081|gb|EGI89286.1| DNA polymerase I [Shigella boydii 5216-82]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|260846368|ref|YP_003224146.1| DNA polymerase I [Escherichia coli O103:H2 str. 12009]
 gi|257761515|dbj|BAI33012.1| DNA polymerase I [Escherichia coli O103:H2 str. 12009]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|331660412|ref|ZP_08361346.1| DNA polymerase I (POL I) [Escherichia coli TA206]
 gi|315300272|gb|EFU59508.1| DNA-directed DNA polymerase [Escherichia coli MS 16-3]
 gi|331052361|gb|EGI24398.1| DNA polymerase I (POL I) [Escherichia coli TA206]
          Length = 928

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|265983303|ref|ZP_06096038.1| DNA polymerase I [Brucella sp. 83/13]
 gi|264661895|gb|EEZ32156.1| DNA polymerase I [Brucella sp. 83/13]
          Length = 994

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 406 VLAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 455

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                       LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 456 ENQIPLDAALAALKHVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 512

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 513 AGTGSHGMNPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 560

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 561 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 620

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 621 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 679

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 680 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 739

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 740 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 774

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 775 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 824

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 825 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 850

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 851 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 884

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 885 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 935

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++ H+M +   P+ +  +PL+ +   +  +
Sbjct: 936 ARMLLQVHDELIFEVPENEVEKTIPVVRHVMENAAMPAVSLAVPLRVDARAAHNW 990


>gi|215489197|ref|YP_002331628.1| DNA polymerase I [Escherichia coli O127:H6 str. E2348/69]
 gi|312969394|ref|ZP_07783596.1| DNA polymerase I [Escherichia coli 2362-75]
 gi|215267269|emb|CAS11718.1| fused DNA polymerase I 5'->3' exonuclease/3'->5'polymerase/3'->5'
           exonuclease [Escherichia coli O127:H6 str. E2348/69]
 gi|312285941|gb|EFR13859.1| DNA polymerase I [Escherichia coli 2362-75]
          Length = 928

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V           ++                             +    GR L   D+ ++
Sbjct: 798 VLGYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|323954361|gb|EGB50146.1| DNA polymerase I [Escherichia coli H263]
          Length = 928

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|218550897|ref|YP_002384688.1| DNA polymerase I [Escherichia fergusonii ATCC 35469]
 gi|218358438|emb|CAQ91085.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia fergusonii ATCC 35469]
          Length = 928

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|16131704|ref|NP_418300.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Escherichia coli str. K-12 substr. MG1655]
 gi|74314369|ref|YP_312788.1| DNA polymerase I [Shigella sonnei Ss046]
 gi|89110164|ref|AP_003944.1| fused DNA polymerase I 5'->3' exonuclease, 3'->5' polymerase and
           3'->5' exonuclease [Escherichia coli str. K-12 substr.
           W3110]
 gi|157158243|ref|YP_001465344.1| DNA polymerase I [Escherichia coli E24377A]
 gi|170022122|ref|YP_001727076.1| DNA polymerase I [Escherichia coli ATCC 8739]
 gi|170083336|ref|YP_001732656.1| DNA polymerase I [Escherichia coli str. K-12 substr. DH10B]
 gi|187733745|ref|YP_001882560.1| DNA polymerase I [Shigella boydii CDC 3083-94]
 gi|188493758|ref|ZP_03001028.1| DNA polymerase I [Escherichia coli 53638]
 gi|191169441|ref|ZP_03031178.1| DNA polymerase I [Escherichia coli B7A]
 gi|193063893|ref|ZP_03044979.1| DNA polymerase I [Escherichia coli E22]
 gi|193068096|ref|ZP_03049061.1| DNA polymerase I [Escherichia coli E110019]
 gi|194430447|ref|ZP_03062929.1| DNA polymerase I [Escherichia coli B171]
 gi|194440160|ref|ZP_03072207.1| DNA polymerase I [Escherichia coli 101-1]
 gi|209921336|ref|YP_002295420.1| DNA polymerase I [Escherichia coli SE11]
 gi|218556422|ref|YP_002389336.1| DNA polymerase I [Escherichia coli IAI1]
 gi|218697577|ref|YP_002405244.1| DNA polymerase I [Escherichia coli 55989]
 gi|238902931|ref|YP_002928727.1| DNA polymerase I [Escherichia coli BW2952]
 gi|253775502|ref|YP_003038333.1| DNA polymerase I [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163815|ref|YP_003046923.1| DNA polymerase I [Escherichia coli B str. REL606]
 gi|256021501|ref|ZP_05435366.1| DNA polymerase I [Shigella sp. D9]
 gi|256026104|ref|ZP_05439969.1| DNA polymerase I [Escherichia sp. 4_1_40B]
 gi|293470175|ref|ZP_06664586.1| DNA polymerase I [Escherichia coli B088]
 gi|300819242|ref|ZP_07099442.1| DNA-directed DNA polymerase [Escherichia coli MS 107-1]
 gi|300823683|ref|ZP_07103809.1| DNA-directed DNA polymerase [Escherichia coli MS 119-7]
 gi|300919043|ref|ZP_07135589.1| DNA-directed DNA polymerase [Escherichia coli MS 115-1]
 gi|300948178|ref|ZP_07162305.1| DNA-directed DNA polymerase [Escherichia coli MS 116-1]
 gi|300958283|ref|ZP_07170427.1| DNA-directed DNA polymerase [Escherichia coli MS 175-1]
 gi|301027901|ref|ZP_07191194.1| DNA-directed DNA polymerase [Escherichia coli MS 196-1]
 gi|301648434|ref|ZP_07248167.1| DNA-directed DNA polymerase [Escherichia coli MS 146-1]
 gi|307140557|ref|ZP_07499913.1| DNA polymerase I [Escherichia coli H736]
 gi|309797831|ref|ZP_07692214.1| DNA-directed DNA polymerase [Escherichia coli MS 145-7]
 gi|331644592|ref|ZP_08345711.1| DNA polymerase I (POL I) [Escherichia coli H736]
 gi|331655544|ref|ZP_08356536.1| DNA polymerase I (POL I) [Escherichia coli M718]
 gi|331670705|ref|ZP_08371541.1| DNA polymerase I (POL I) [Escherichia coli TA271]
 gi|331675321|ref|ZP_08376071.1| DNA polymerase I (POL I) [Escherichia coli TA280]
 gi|331679970|ref|ZP_08380632.1| DNA polymerase I (POL I) [Escherichia coli H591]
 gi|332282738|ref|ZP_08395151.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Shigella sp. D9]
 gi|118825|sp|P00582|DPO1_ECOLI RecName: Full=DNA polymerase I; Short=POL I
 gi|42461|emb|CAA23607.1| unnamed protein product [Escherichia coli]
 gi|147312|gb|AAA24402.1| DNA polymerase I [Escherichia coli]
 gi|304969|gb|AAB02998.1| DNA polymerase I [Escherichia coli str. K-12 substr. MG1655]
 gi|1790294|gb|AAC76861.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Escherichia coli str. K-12 substr. MG1655]
 gi|73857846|gb|AAZ90553.1| DNA polymerase I [Shigella sonnei Ss046]
 gi|85676195|dbj|BAE77445.1| fused DNA polymerase I 5'->3' exonuclease, 3'->5' polymerase and
           3'->5' exonuclease [Escherichia coli str. K12 substr.
           W3110]
 gi|157080273|gb|ABV19981.1| DNA polymerase I [Escherichia coli E24377A]
 gi|169757050|gb|ACA79749.1| DNA polymerase I [Escherichia coli ATCC 8739]
 gi|169891171|gb|ACB04878.1| DNA polymerase I [Escherichia coli str. K-12 substr. DH10B]
 gi|187430737|gb|ACD10011.1| DNA polymerase I [Shigella boydii CDC 3083-94]
 gi|188488957|gb|EDU64060.1| DNA polymerase I [Escherichia coli 53638]
 gi|190900509|gb|EDV60321.1| DNA polymerase I [Escherichia coli B7A]
 gi|192929358|gb|EDV82966.1| DNA polymerase I [Escherichia coli E22]
 gi|192958716|gb|EDV89154.1| DNA polymerase I [Escherichia coli E110019]
 gi|194411506|gb|EDX27846.1| DNA polymerase I [Escherichia coli B171]
 gi|194420903|gb|EDX36943.1| DNA polymerase I [Escherichia coli 101-1]
 gi|209914595|dbj|BAG79669.1| DNA polymerase I [Escherichia coli SE11]
 gi|218354309|emb|CAV01020.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli 55989]
 gi|218363191|emb|CAR00833.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli IAI1]
 gi|238860827|gb|ACR62825.1| DNA polymerase I [Escherichia coli BW2952]
 gi|242379401|emb|CAQ34215.1| DNA polymerase I, 5'--> 3' polymerase, 5'--> 3' and 3'--> 5'
           exonuclease [Escherichia coli BL21(DE3)]
 gi|253326546|gb|ACT31148.1| DNA polymerase I [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975716|gb|ACT41387.1| DNA polymerase I [Escherichia coli B str. REL606]
 gi|253979872|gb|ACT45542.1| DNA polymerase I [Escherichia coli BL21(DE3)]
 gi|260451301|gb|ACX41723.1| DNA polymerase I [Escherichia coli DH1]
 gi|291321385|gb|EFE60824.1| DNA polymerase I [Escherichia coli B088]
 gi|299879003|gb|EFI87214.1| DNA-directed DNA polymerase [Escherichia coli MS 196-1]
 gi|300315036|gb|EFJ64820.1| DNA-directed DNA polymerase [Escherichia coli MS 175-1]
 gi|300413850|gb|EFJ97160.1| DNA-directed DNA polymerase [Escherichia coli MS 115-1]
 gi|300452272|gb|EFK15892.1| DNA-directed DNA polymerase [Escherichia coli MS 116-1]
 gi|300523745|gb|EFK44814.1| DNA-directed DNA polymerase [Escherichia coli MS 119-7]
 gi|300528128|gb|EFK49190.1| DNA-directed DNA polymerase [Escherichia coli MS 107-1]
 gi|301073504|gb|EFK88310.1| DNA-directed DNA polymerase [Escherichia coli MS 146-1]
 gi|308118587|gb|EFO55849.1| DNA-directed DNA polymerase [Escherichia coli MS 145-7]
 gi|315138432|dbj|BAJ45591.1| DNA polymerase I [Escherichia coli DH1]
 gi|320174864|gb|EFW49985.1| DNA polymerase I [Shigella dysenteriae CDC 74-1112]
 gi|323161077|gb|EFZ46995.1| DNA polymerase I [Escherichia coli E128010]
 gi|323174273|gb|EFZ59900.1| DNA polymerase I [Escherichia coli LT-68]
 gi|323189713|gb|EFZ74992.1| DNA polymerase I [Escherichia coli RN587/1]
 gi|323939084|gb|EGB35300.1| DNA polymerase I [Escherichia coli E482]
 gi|323959369|gb|EGB55030.1| DNA polymerase I [Escherichia coli H489]
 gi|323969730|gb|EGB65013.1| DNA polymerase I [Escherichia coli TA007]
 gi|324019768|gb|EGB88987.1| DNA-directed DNA polymerase [Escherichia coli MS 117-3]
 gi|331036054|gb|EGI08290.1| DNA polymerase I (POL I) [Escherichia coli H736]
 gi|331046645|gb|EGI18730.1| DNA polymerase I (POL I) [Escherichia coli M718]
 gi|331061960|gb|EGI33883.1| DNA polymerase I (POL I) [Escherichia coli TA271]
 gi|331067381|gb|EGI38786.1| DNA polymerase I (POL I) [Escherichia coli TA280]
 gi|331072296|gb|EGI43629.1| DNA polymerase I (POL I) [Escherichia coli H591]
 gi|332105090|gb|EGJ08436.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Shigella sp. D9]
          Length = 928

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|323974266|gb|EGB69395.1| DNA polymerase I [Escherichia coli TW10509]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|332998506|gb|EGK18104.1| DNA polymerase I [Shigella flexneri K-272]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------TAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|332751661|gb|EGJ82060.1| DNA polymerase I [Shigella flexneri 4343-70]
 gi|332998620|gb|EGK18217.1| DNA polymerase I [Shigella flexneri K-218]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------LGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|77456284|ref|YP_345789.1| DNA polymerase I [Pseudomonas fluorescens Pf0-1]
 gi|77380287|gb|ABA71800.1| DNA polymerase I [Pseudomonas fluorescens Pf0-1]
          Length = 935

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 104/712 (14%), Positives = 200/712 (28%), Gaps = 168/712 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DP 51
                D ET              A+   ++  +F    +        H            
Sbjct: 348 KLFAFDTETT----------GIDAQQAQLVGLSFAVQANEAAYIPLTHSYIGVPEQLDRD 397

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACF-------NLDIPIHRWICTLVLARSNG 104
            + + LK  LE+ +   V  ++ F+  +L  C         + +       T++ +    
Sbjct: 398 TVLRALKPILEDPNKLKVGQHAKFDMNILANCAIGGDQNEGITVRGIA-FDTMLESYVLN 456

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGD 164
             +         +     + + K L       +       +     + A    G Y   D
Sbjct: 457 STAT--------RHDMDSLAQ-KYLDHTTVSFQDIAGKGAKQLTFDQIALEQAGPYAAED 507

Query: 165 VTVTREIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDV 213
             VT  + + L                 E  L  +   I  +G  VD  L    +  +  
Sbjct: 508 ADVTLRLHQTLFDKLSAIPSLASVLTDIEIPLVPVLARIERQGAFVDAELLGIQSIELGN 567

Query: 214 ERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKL 269
           +   L++E   +      +    ++L   L+ + GL +   T     +T + VL+   + 
Sbjct: 568 KMIALEREAFEIAG-EEFNLGSPKQLGVILYEKLGLPVLKKTAKGQPSTAEEVLAKLAED 626

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQN 328
             +  +V       S+      + L E +N   GR+  +     A  TGR S      QN
Sbjct: 627 DHRLPKVLMEHRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-STGRLSSSDPNLQN 685

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
           +P  +                              +R   +A +G KL+ AD + IE R+
Sbjct: 686 IPVRTAEGRR-------------------------IRQAFVAPKGYKLLAADYSQIELRI 720

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           +A ++ ++  + AF    D++  T A  F V   +VT DQR   K +             
Sbjct: 721 MAHLSRDEGLMNAFRNNLDVHTATAAEVFKVELNEVTSDQRRGAKAINF----------- 769

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                  G+                                 +   +        +    
Sbjct: 770 ---GLIYGMG------------------------------AQKLGKDIGVDTKTAKAYID 796

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            +  ++  V E  +                                 +   +    GR L
Sbjct: 797 TYFARYPGVREYMDRTRAQA--------------------------ADQGFVETIFGRRL 830

Query: 569 VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGY 622
              D+ +N+           R            +Q  + DI+ + M+             
Sbjct: 831 YLPDINSNKP---QERAAAERTAINAP------MQGTAADIIKKAMVAVDNWLCASGLDA 881

Query: 623 DIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            ++L VHDE+V E  +         +   M+        +PL  E      +
Sbjct: 882 KVILQVHDELVLEVREDLVDQVREEIRVHMSEAAK--LDVPLLVEVGVGNNW 931


>gi|293413298|ref|ZP_06655959.1| DNA polymerase I [Escherichia coli B354]
 gi|291468046|gb|EFF10544.1| DNA polymerase I [Escherichia coli B354]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|238892277|ref|YP_002917011.1| DNA polymerase I [Klebsiella pneumoniae NTUH-K2044]
 gi|238544593|dbj|BAH60944.1| DNA polymerase I [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 930

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 355 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  V  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 405 TLLKPLLEDEKVLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 457 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 513

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 514 MWPKLQQHEGPLNIFQHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 574 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 633 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 727 TAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 772 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 803 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+         K    +++ VHDE+V
Sbjct: 837 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRSEKPRVRMIMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 888 FEVHKDELDAVSKKIHELMENSTTLA--VPLLVEVGSGENW 926


>gi|91213409|ref|YP_543395.1| DNA polymerase I [Escherichia coli UTI89]
 gi|117626137|ref|YP_859460.1| DNA polymerase I [Escherichia coli APEC O1]
 gi|218560939|ref|YP_002393852.1| DNA polymerase I [Escherichia coli S88]
 gi|237702893|ref|ZP_04533374.1| DNA polymerase I [Escherichia sp. 3_2_53FAA]
 gi|91074983|gb|ABE09864.1| DNA polymerase I [Escherichia coli UTI89]
 gi|115515261|gb|ABJ03336.1| DNA polymerase I [Escherichia coli APEC O1]
 gi|218367708|emb|CAR05497.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli S88]
 gi|226902830|gb|EEH89089.1| DNA polymerase I [Escherichia sp. 3_2_53FAA]
 gi|294492133|gb|ADE90889.1| DNA polymerase I [Escherichia coli IHE3034]
 gi|307628940|gb|ADN73244.1| DNA polymerase I [Escherichia coli UM146]
 gi|315289553|gb|EFU48946.1| DNA-directed DNA polymerase [Escherichia coli MS 110-3]
 gi|323949358|gb|EGB45247.1| DNA polymerase I [Escherichia coli H252]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|194433216|ref|ZP_03065497.1| DNA polymerase I [Shigella dysenteriae 1012]
 gi|194418500|gb|EDX34588.1| DNA polymerase I [Shigella dysenteriae 1012]
          Length = 928

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 103/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   KL++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAKLEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|329999655|ref|ZP_08303472.1| DNA-directed DNA polymerase [Klebsiella sp. MS 92-3]
 gi|328538267|gb|EGF64411.1| DNA-directed DNA polymerase [Klebsiella sp. MS 92-3]
          Length = 930

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 355 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  V  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 405 TLLKPLLEDEKVLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 457 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 513

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 514 MWPKLQQHEGPLNIFQHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 574 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 633 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 727 TAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 772 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 803 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+         K    +++ VHDE+V
Sbjct: 837 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRSEKPRVRMIMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 888 FEVHKDELDAVSKKIHELMENSTTLA--VPLLVEVGSGENW 926


>gi|218692150|ref|YP_002400362.1| DNA polymerase I [Escherichia coli ED1a]
 gi|218429714|emb|CAV18034.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli ED1a]
          Length = 928

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|222035576|emb|CAP78321.1| DNA polymerase I [Escherichia coli LF82]
 gi|312948433|gb|ADR29260.1| DNA polymerase I [Escherichia coli O83:H1 str. NRG 857C]
          Length = 928

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|323964211|gb|EGB59694.1| DNA polymerase I [Escherichia coli M863]
          Length = 928

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D       ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|307943370|ref|ZP_07658714.1| DNA polymerase I [Roseibium sp. TrichSKD4]
 gi|307773000|gb|EFO32217.1| DNA polymerase I [Roseibium sp. TrichSKD4]
          Length = 793

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 109/716 (15%), Positives = 197/716 (27%), Gaps = 175/716 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH------------- 49
            +  D ET S            A    ++  +              H             
Sbjct: 204 YVAFDTETTSLN----------AMQAELVGISLSTSTGKACYIPLAHIDGEGDLLGGGAL 253

Query: 50  ------DPVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSN 103
                       +LK  LE+  V  +A N  ++  V+       + +  +  T++L+ + 
Sbjct: 254 IEGQIPLKDALAILKPMLEDPAVLKIAQNLKYDWLVMTHY---GVNVTSYDDTMLLSYTV 310

Query: 104 GLPSA---LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEY 160
                   +  + E           G + I      +             +        Y
Sbjct: 311 DAGKGGNGMDELSERW--------LGHKPIPF----KEVCGSGKSMITFDKVPLDKATAY 358

Query: 161 CKGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQI 210
              D  VT  +++ L+P            + E+ +  +   +  RG  VD  +   L+  
Sbjct: 359 AAEDADVTLRLWQVLKPRLASDRMATVYETLERPMVPVLARMEQRGIAVDRQMLSRLSGD 418

Query: 211 VDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSN 266
                  L+ E+  L      +    ++L   LF + GL     T+    +T   VL   
Sbjct: 419 FAQGMAGLEAEIHELAG-ESFNIGSPKQLGDILFGKMGLPGGKKTKTGAWSTSASVLEDL 477

Query: 267 KKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPP 326
                          + S+      + L   ++ D +   T   L A+ TGR S      
Sbjct: 478 AAEGHTLPSKIVEWRQLSKLKSTYSDALPGYIHPDTKRVHTSYALAATTTGRLSSSEPNL 537

Query: 327 QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
           QN+P  + +  +                         +R   +A +G KL+ AD + IE 
Sbjct: 538 QNIPVRTAAGRK-------------------------IRQAFVAEKGMKLISADYSQIEL 572

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           RVLA MA      KAFE G D++  T +  F      +    R   K +           
Sbjct: 573 RVLAHMADIPQLKKAFEEGLDIHAMTASEMFGTPIEGMDPMVRRQAKAINFG-------- 624

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
                    G++    A                                           
Sbjct: 625 ------IIYGISAFGLAAQ------------------------------LGISRGEASDY 648

Query: 507 KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
            K + ++   + E      +    T                            +    GR
Sbjct: 649 IKTYFERFPGIKEYMEATKKQVHAT--------------------------GYVTTIFGR 682

Query: 567 SLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KA 620
              Y DV      +        R            +Q  + DIL   M+         K 
Sbjct: 683 KAHYPDVNTKNPNMRNF---YERAAINAP------IQGSAADILRRAMVRMEDRLLSSKL 733

Query: 621 GYDIVLTVHDEIVCETPDTDEFN-ASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
              ++L VHDE++ E P+        ++  +M +   P     +PL+ +   +  +
Sbjct: 734 DAQMLLQVHDELIFEVPEVQVDATIPLIKDVMENACDPVLKLSVPLQVDARAADNW 789


>gi|152972672|ref|YP_001337818.1| DNA polymerase I [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150957521|gb|ABR79551.1| DNA polymerase I [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 930

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 355 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  V  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 405 ALLKPLLEDEKVLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 457 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 513

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 514 MWPKLQQHEGPLNIFQHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 574 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 633 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 727 TAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 772 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 803 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+         K    +++ VHDE+V
Sbjct: 837 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRSEKPRVRMIMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 888 FEVHKDELNAVSKKIHELMENSTTLA--VPLLVEVGSGENW 926


>gi|15804448|ref|NP_290488.1| DNA polymerase I [Escherichia coli O157:H7 EDL933]
 gi|15834040|ref|NP_312813.1| DNA polymerase I [Escherichia coli O157:H7 str. Sakai]
 gi|168755528|ref|ZP_02780535.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4401]
 gi|168768145|ref|ZP_02793152.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4486]
 gi|168780763|ref|ZP_02805770.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4076]
 gi|208808881|ref|ZP_03251218.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4206]
 gi|208812650|ref|ZP_03253979.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4045]
 gi|208818813|ref|ZP_03259133.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4042]
 gi|209400301|ref|YP_002273378.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4115]
 gi|217325868|ref|ZP_03441952.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14588]
 gi|254039074|ref|ZP_04873124.1| DNA polymerase I [Escherichia sp. 1_1_43]
 gi|254795854|ref|YP_003080691.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14359]
 gi|261223490|ref|ZP_05937771.1| DNA polymerase I [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257253|ref|ZP_05949786.1| DNA polymerase I [Escherichia coli O157:H7 str. FRIK966]
 gi|12518742|gb|AAG59052.1|AE005617_1 DNA polymerase I [Escherichia coli O157:H7 str. EDL933]
 gi|13364262|dbj|BAB38209.1| DNA polymerase I [Escherichia coli O157:H7 str. Sakai]
 gi|189001592|gb|EDU70578.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4076]
 gi|189357227|gb|EDU75646.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4401]
 gi|189362585|gb|EDU81004.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4486]
 gi|208728682|gb|EDZ78283.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4206]
 gi|208733927|gb|EDZ82614.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4045]
 gi|208738936|gb|EDZ86618.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4042]
 gi|209161701|gb|ACI39134.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4115]
 gi|209752838|gb|ACI74726.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752840|gb|ACI74727.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752842|gb|ACI74728.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752844|gb|ACI74729.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752846|gb|ACI74730.1| essential GTPase for cell cycle [Escherichia coli]
 gi|217322089|gb|EEC30513.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14588]
 gi|226838510|gb|EEH70539.1| DNA polymerase I [Escherichia sp. 1_1_43]
 gi|254595254|gb|ACT74615.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14359]
 gi|309704289|emb|CBJ03638.1| DNA polymerase I [Escherichia coli ETEC H10407]
 gi|320191047|gb|EFW65697.1| DNA polymerase I [Escherichia coli O157:H7 str. EC1212]
 gi|320644589|gb|EFX13643.1| DNA polymerase I [Escherichia coli O157:H- str. 493-89]
 gi|320655220|gb|EFX23166.1| DNA polymerase I [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660846|gb|EFX28292.1| DNA polymerase I [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666006|gb|EFX33025.1| DNA polymerase I [Escherichia coli O157:H7 str. LSU-61]
 gi|323934350|gb|EGB30763.1| DNA polymerase I [Escherichia coli E1520]
 gi|326338135|gb|EGD61965.1| DNA polymerase I [Escherichia coli O157:H7 str. 1044]
 gi|326342571|gb|EGD66344.1| DNA polymerase I [Escherichia coli O157:H7 str. 1125]
 gi|332345852|gb|AEE59186.1| DNA polymerase I PolA [Escherichia coli UMNK88]
          Length = 928

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|324111949|gb|EGC05929.1| DNA polymerase I [Escherichia fergusonii B253]
          Length = 928

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D       ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|120553478|ref|YP_957829.1| DNA polymerase I [Marinobacter aquaeolei VT8]
 gi|120323327|gb|ABM17642.1| DNA polymerase I [Marinobacter aquaeolei VT8]
          Length = 908

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 108/706 (15%), Positives = 210/706 (29%), Gaps = 170/706 (24%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S          +Y  D  ++  +F  +          HD            + 
Sbjct: 332 AFDTETTSL---------RYM-DAEIVGVSFAVEPGKAAYVPLGHDYMGAPEQLDRDSVL 381

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRW-ICTLVLARSNGL---PSALK 110
           + LK  LE+     V  N  +++ VL      DI +      T+V +           + 
Sbjct: 382 EQLKPLLEDPKHKKVGQNLKYDKNVLANH---DIQLEGIAEDTMVESYVLNSVGTRHDMD 438

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
           ++                L       E+      +    ++      G Y   D  +T  
Sbjct: 439 SLARTY------------LDEETITYESIAGKGAKQLTFNQIDLESAGPYAAEDADITLR 486

Query: 171 IFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           + + L P               +  L  +   +  RG  +  +     +Q +     +L+
Sbjct: 487 LHQTLAPRLKDTGKLESVYREIDLPLVPVLSRMEQRGTLISASTLRQHSQELAERMAELE 546

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQ 275
           +E   +      +    ++L+  L+ + GL +   T     +T + VL            
Sbjct: 547 KEAHEVAG-EAFNLGSTKQLQAILYDKLGLRVIKKTPKGAPSTAEPVLQELAHEHELPRL 605

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           +  +R   S+      +TL E ++       T      + TGR S      QN+P  ++ 
Sbjct: 606 IVEHR-SLSKLKSTYTDTLPELIHHRTGRVHTSYHQAVTATGRLSSSEPNLQNIPIRTQE 664

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   IA +G KL+ AD + IE R++A ++G+
Sbjct: 665 GRR-------------------------IRQAFIAPKGYKLLAADYSQIELRIMAHLSGD 699

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  L AFE GED++  T A  F V   +VT DQR   K +   L                
Sbjct: 700 RGLLTAFEHGEDIHKATAAEVFGVTVDEVTGDQRRSAKAINFGLI--------------Y 745

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++    +  ++ +                                  +     + +++ 
Sbjct: 746 GMSAFGLSRQLEVD------------------------------RKTAQEYIDRYFERYP 775

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V +  + + +                              +  +    GR L   ++  
Sbjct: 776 GVLKYMDNIRKQAHD--------------------------DGYVETLYGRRLYLPEINA 809

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA-------TKAGYDIVLTV 628
                    +   R            +Q  + DI+   M+           +   + + V
Sbjct: 810 RN---KQLQQAAERTAINAP------MQGTAADIIKRAMIEVDNWLRSEHASDACMTMQV 860

Query: 629 HDEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE++ E  +         L   M++  S    +PL  E      +
Sbjct: 861 HDELIIEVREEAVDKVKDGLVKRMSAAAS--LDVPLLVEAGVGDNW 904


>gi|265994070|ref|ZP_06106627.1| DNA polymerase I [Brucella melitensis bv. 3 str. Ether]
 gi|262765051|gb|EEZ10972.1| DNA polymerase I [Brucella melitensis bv. 3 str. Ether]
          Length = 688

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 100 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 149

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 150 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 206

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 207 AGTGSHGMDPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 254

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 255 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 314

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 315 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 373

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 374 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 433

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 434 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 468

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 469 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 518

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 519 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 544

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 545 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 578

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 579 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 629

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 630 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 684


>gi|307314016|ref|ZP_07593630.1| DNA polymerase I [Escherichia coli W]
 gi|306906333|gb|EFN36849.1| DNA polymerase I [Escherichia coli W]
 gi|315063149|gb|ADT77476.1| DNA polymerase I [Escherichia coli W]
 gi|323380787|gb|ADX53055.1| DNA polymerase I [Escherichia coli KO11]
          Length = 928

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++      G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQITLEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|254718343|ref|ZP_05180154.1| DNA polymerase I [Brucella sp. 83/13]
 gi|306839566|ref|ZP_07472372.1| DNA polymerase I [Brucella sp. NF 2653]
 gi|306405352|gb|EFM61625.1| DNA polymerase I [Brucella sp. NF 2653]
          Length = 978

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/715 (14%), Positives = 205/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 VLAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                       LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDAALAALKHVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMNPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                  +   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 AHYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++ H+M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRHVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|110835520|ref|YP_694379.1| DNA polymerase I [Alcanivorax borkumensis SK2]
 gi|110648631|emb|CAL18107.1| DNA polymerase I [Alcanivorax borkumensis SK2]
          Length = 956

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 99/703 (14%), Positives = 198/703 (28%), Gaps = 161/703 (22%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPV 52
               D ET S   +          +  ++ FA    D         H            +
Sbjct: 379 EFAFDTETTSLNYM----------NAELVGFAVAVSD-KAAYIPFGHNYPGAPDQIDKQL 427

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
           +    K  LE+  +  +  N  ++ +VL     + +       T++ +        L +V
Sbjct: 428 VIDKFKPLLEDDSLKKIGQNLKYDMSVLAEDAGITLRGVA-FDTMLESYV------LDSV 480

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
                + S  +   K L  +            +    ++        Y   D  VT  + 
Sbjct: 481 ATRHDMDSLAL---KYLGRKTISFTDIAGKGAKQLTFNQIGLHEASPYAAEDADVTLRLH 537

Query: 173 KRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           + L P               E  L  +   I   G  VD  L    +Q +     +L ++
Sbjct: 538 QTLWPKLEAEDRLPEVFRDIELPLVTVLSRIERNGTYVDATLLKHQSQFLAKRMAELQEK 597

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVF 277
              +      +    ++L   L+ +  + +   T     +T + VL       P    + 
Sbjct: 598 AFDIAGQ-EFNLASPKQLGEILYEKLEIPVIKKTPKGAPSTAEAVLQELAHDYPLPQVIM 656

Query: 278 NNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE 337
           + R   ++      + L E +N       T      + TGR S      QN+P  S    
Sbjct: 657 DYR-GVAKLKNTYTDKLPELINQRTGRVHTSYHQAVTATGRLSSSDPNLQNIPVRSEEGR 715

Query: 338 ELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
           +                         +R   +A +GKK+V  D + IE R++A ++G++ 
Sbjct: 716 K-------------------------IRQAFLAPKGKKIVACDYSQIELRIMAHLSGDKG 750

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
              AFE G D++  T A  +     +V+ + R   K +                    G+
Sbjct: 751 LTDAFEQGLDIHRATAAEVWGKTLDEVSDNDRRNAKAINF--------------GLIYGM 796

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
           +                                  A +        +     + +++  V
Sbjct: 797 S------------------------------AFGLAKQLGLPRKEAQEYIDLYFERYPGV 826

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR 577
            +   +                                    +    GR L   ++ +  
Sbjct: 827 KKYMEDTRALAID--------------------------KGYVETVYGRRLYLPEIHSKN 860

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDE 631
                  +   R            +Q  + DI+ + M+              +++ VHDE
Sbjct: 861 ---GQRRQGAERAAINAP------MQGTAADIIKKAMIKVHDWLETTHFDAKMIMQVHDE 911

Query: 632 IVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           +V E  D    +    +   M S       +PL  +    + +
Sbjct: 912 LVFEVADDQVDDLVKEVKARMESAAE--LKVPLIVDAGAGENW 952


>gi|293417324|ref|ZP_06659948.1| DNA polymerase I [Escherichia coli B185]
 gi|291430844|gb|EFF03840.1| DNA polymerase I [Escherichia coli B185]
          Length = 928

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIESGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALDEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|320649913|gb|EFX18421.1| DNA polymerase I [Escherichia coli O157:H- str. H 2687]
          Length = 928

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|325499168|gb|EGC97027.1| DNA polymerase I [Escherichia fergusonii ECD227]
          Length = 928

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D       ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|260857738|ref|YP_003231629.1| DNA polymerase I [Escherichia coli O26:H11 str. 11368]
 gi|257756387|dbj|BAI27889.1| DNA polymerase I [Escherichia coli O26:H11 str. 11368]
 gi|323155157|gb|EFZ41344.1| DNA polymerase I [Escherichia coli EPECa14]
          Length = 928

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 206/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F++    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFSLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|291285274|ref|YP_003502092.1| DNA polymerase I [Escherichia coli O55:H7 str. CB9615]
 gi|290765147|gb|ADD59108.1| DNA polymerase I [Escherichia coli O55:H7 str. CB9615]
          Length = 928

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QSYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|153871900|ref|ZP_02000951.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
 gi|152071634|gb|EDN69049.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
          Length = 914

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 103/703 (14%), Positives = 191/703 (27%), Gaps = 166/703 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   L             ++  +F             HD            + 
Sbjct: 340 AFDTETTSLDYL----------QAQIVGVSFAVQVGEAAYVPLAHDYLGAPQQLSCDNVL 389

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SALKAV 112
            VLK  LEN     +  N  ++  VL     + +       T++ +          + ++
Sbjct: 390 AVLKPLLENPKKRKIGQNLKYDAHVLANH-GIHLQGMA-FDTMLESYVLNSTTKHDMDSL 447

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
            +              L       E       +    ++        Y   D  +T ++ 
Sbjct: 448 AQIY------------LQKTTITFEDVAGKGKKQLSFNQIPLEHATPYACEDADITLQLH 495

Query: 173 KRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           + L                    L  +   +   G  +D  L H  +  +     +L+Q 
Sbjct: 496 QNLWEQLQNRPKLERIFDDLEMPLIPVLIRMERHGVKIDATLLHQQSAELATRLQQLEQA 555

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQVF 277
                     +    ++L+T LF +  L           +T   VL       P    + 
Sbjct: 556 AYEEAGT-EFNLNSPKQLQTILFDKLSLPVLKKTPKKDPSTAVEVLEELAIDYPLPQLIL 614

Query: 278 NNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE 337
             R   S+      +TL + +N       T      + TGR S      QN+P  S    
Sbjct: 615 IYR-SLSKLKSTYTDTLPQQINPKTGRVHTSYHQAVTTTGRLSSTNPNLQNIPIRSAEGR 673

Query: 338 ELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
                                     +R   IA +G  L+ AD + IE R++A ++ ++ 
Sbjct: 674 R-------------------------IRQAFIAPKGYCLLAADYSQIELRIMAHLSEDEK 708

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
            L A   GED++    A  F++A  +VT +QR   K +                    G+
Sbjct: 709 LLSALTAGEDIHKAVAAEVFDLAMDEVTTEQRRQAKAVN--------------FGLMYGM 754

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                              A +        +    A+  ++  V
Sbjct: 755 ------------------------------QAFGLAKQLGIERHQAQIYMDAYFARYPGV 784

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR 577
               +++    +Q                             +    GR L   ++    
Sbjct: 785 KAYMDDMRVLAKQ--------------------------QGYVETVFGRRLYIPEIKTRH 818

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDE 631
                      R            +Q  + D++   M+              +++ VHDE
Sbjct: 819 IGRRQA---AERTAINAP------MQGTAADLIKRAMLTVDDWIEKSGLDVKMLMQVHDE 869

Query: 632 IVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           +V E  +T    A + +   MT        +PL  +    K +
Sbjct: 870 LVFEIAETVIEEAKVAIIEAMTQVAE--LKVPLIVDIGIGKNW 910


>gi|156936143|ref|YP_001440059.1| DNA polymerase I [Cronobacter sakazakii ATCC BAA-894]
 gi|156534397|gb|ABU79223.1| hypothetical protein ESA_04040 [Cronobacter sakazakii ATCC BAA-894]
          Length = 927

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 104/706 (14%), Positives = 212/706 (30%), Gaps = 167/706 (23%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PV 52
            + +D ET S  +LT            ++  +F  +          HD            
Sbjct: 350 VVAVDTETDSLDNLT----------ANLVGISFATEPGLAAYIPVAHDYLDAPDQLSRDR 399

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSAL 109
           + ++LK  LE+  +  V  N  F+R +L+    +++       T++ +           +
Sbjct: 400 VLELLKPLLEDESLVKVGQNLKFDRGILQNY-GIELRGIA-FDTMLESYILDSVSGRHDM 457

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++                L       E            ++      G Y   D  VT 
Sbjct: 458 DSLSSR------------WLKHTTITFEQIAGKGKNQLTFNQIDLEQAGRYAAEDADVTL 505

Query: 170 EIFKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++  ++ P   +              L  +   I   G  +D A+ H  +Q + ++ T+L
Sbjct: 506 QLHLKMWPKLQQHKGPLNIFEHIEMPLVPVLSRIERNGVKIDPAVLHAHSQEIALKLTEL 565

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAI 274
           +Q+   +      +    ++L+T LF + G+     T     +T + VL       P   
Sbjct: 566 EQKAHEIAG-EPFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPK 624

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
            +   R   ++      + L + +N       T      + TGR S      QN+P  + 
Sbjct: 625 VILQYR-GLAKLKSTYTDKLPQMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRND 683

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA E   +V AD + IE R++A ++ 
Sbjct: 684 EGRR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSR 718

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++  L AF  G+D++  T A  F +    V+ +QR   K +                   
Sbjct: 719 DKGLLSAFAEGKDIHRATAAEVFGLPLESVSNEQRRSAKAINF--------------GLI 764

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  + +        ++    + +++
Sbjct: 765 YGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFERY 794

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V E      +  ++                             +    GR L   D+ 
Sbjct: 795 PGVLEYMERTRKQAKE--------------------------QGYVETLDGRRLYLPDIN 828

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTV 628
            + +       +               +Q  + DI+   M+         +    +++ V
Sbjct: 829 ASNAARRAGAER---------AAINAPMQGTAADIIKRAMIAVDGWLQKEQPRVKMIMQV 879

Query: 629 HDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E    D       ++ LM ++      +PL  E      +
Sbjct: 880 HDELVFEVHKDDVEAVSQKIHELMENSMQ--LDVPLLVEVGSGVNW 923


>gi|320639201|gb|EFX08828.1| DNA polymerase I [Escherichia coli O157:H7 str. G5101]
          Length = 916

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 341 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 390

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 391 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 448

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 449 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 496

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 497 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 556

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 557 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 615

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 616 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 674

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 675 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 709

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 710 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 755

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 756 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 785

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 786 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 819

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 820 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 870

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 871 ELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 912


>gi|254694920|ref|ZP_05156748.1| DNA polymerase I [Brucella abortus bv. 3 str. Tulya]
 gi|261215255|ref|ZP_05929536.1| DNA polymerase I [Brucella abortus bv. 3 str. Tulya]
 gi|260916862|gb|EEX83723.1| DNA polymerase I [Brucella abortus bv. 3 str. Tulya]
          Length = 978

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 101/715 (14%), Positives = 206/715 (28%), Gaps = 174/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            L  D ET S   +             ++ F+              H             
Sbjct: 390 ILAFDTETTSLDPM----------QAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMV 439

Query: 51  ------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNG 104
                  +    LK  LE+  +  +A N  ++  V++      I    +  T++++    
Sbjct: 440 ENQIPLDMALAALKRVLEDASILKIAQNMKYDWLVMRRH---GINAVSFDDTMLISYVLD 496

Query: 105 L---PSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
                  +  + E           G   IA     +                      Y 
Sbjct: 497 AGTGSHGMAPLSERW--------LGHTPIAY----KDVAGSGKSAVTFDMVDIDRATAYA 544

Query: 162 KGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
             D  VT  +++ L+P              E+ L  +   + +RG  VD  +   L+  +
Sbjct: 545 AEDADVTLRLWQVLKPRLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDL 604

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNK 267
                  + E+ +L      +    ++L   LF + GL     T+    +T  +VL    
Sbjct: 605 AQAAAAYEDEIYALAG-EKFTIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLA 663

Query: 268 KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQ 327
                 ++   +  + ++      + L   +N   +   T   + ++ TGR S      Q
Sbjct: 664 AEGHPLLRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQ 723

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           N+P  +    +                         +R+  IA  G KL+ AD + IE R
Sbjct: 724 NIPVRTAEGRK-------------------------IRTAFIAEPGNKLISADYSQIELR 758

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA +A      +AF  G D++  T +  F V    +  + R   K +            
Sbjct: 759 VLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINF---------- 808

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
                   G++    A+ +                                      +  
Sbjct: 809 ----GIIYGISAFGLANQLSI------------------------------PREEAGQYI 834

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           + + ++   + +          +                          +  +    GR 
Sbjct: 835 RTYFERFPGIKDYMEATKAFARE--------------------------HGYVETIFGRR 868

Query: 568 LVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------G 621
             Y D+  +            R            +Q  + DI+   M+    A       
Sbjct: 869 THYPDIRASNP---QVRAFNERAAINAP------IQGAAADIIRRAMIRMEDALAKENLA 919

Query: 622 YDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E P+ +      ++  +M +   P+ +  +PL+ +   +  +
Sbjct: 920 ARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNW 974


>gi|82546208|ref|YP_410155.1| DNA polymerase I [Shigella boydii Sb227]
 gi|81247619|gb|ABB68327.1| DNA polymerase I [Shigella boydii Sb227]
          Length = 928

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNPLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|330444881|ref|ZP_08308536.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489191|dbj|GAA03033.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 923

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 97/708 (13%), Positives = 197/708 (27%), Gaps = 168/708 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
                D ET     +T            V+  +F  ++         HD           
Sbjct: 344 KAFAFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRD 393

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSA 108
            +   LK  LE+ +   +  N  F+ +++     +++       T++ +           
Sbjct: 394 WVLAQLKPLLEDPNQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHD 451

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVT 168
           + ++                L  +    E       +    ++      G Y   D  +T
Sbjct: 452 MDSLALRY------------LEHKNISFEEIAGKGKKQLTFNQIDLAQAGPYAAEDADIT 499

Query: 169 REIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK 217
             +   L P               E  L  +   +   G  VD  L    +  +     +
Sbjct: 500 LRLHNALYPKVEADEKLKHVFETIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAARLDE 559

Query: 218 LDQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQA 273
           L+++   +      +    ++L+  LF + GL         T +T + VL       P  
Sbjct: 560 LEKKAFEIADQ-EFNLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDYPLP 618

Query: 274 IQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
             +   R   ++      + L + +N       T      + TGR S      QN+P  +
Sbjct: 619 KLILEYR-GLAKLKSTYTDKLPKMVNPATGRVHTSYHQAVTATGRLSSSDPNLQNIPVRN 677

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                                         +R   +A  G K++  D + IE R++A ++
Sbjct: 678 EEGRR-------------------------IRQAFVAQSGYKILAVDYSQIELRIMAHLS 712

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           G++  L AF  G+D++  T A    +   QV+ +QR   K +                  
Sbjct: 713 GDKALLDAFRHGKDIHAATAAEILGLDIEQVSSEQRRRAKAINF--------------GL 758

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     + ++
Sbjct: 759 IYGMSAFGLAKQLDM------------------------------GRNEAQDYMNVYFER 788

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V E                                        +    GR L   D+
Sbjct: 789 YPGVLEYMESTRNTA--------------------------SEKGYVETLFGRRLYLPDI 822

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVL 626
            +         +   R            +Q  + DI+   M+               +++
Sbjct: 823 KSRNGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDNWVQQQPQDEVRLLM 873

Query: 627 TVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            VHDE+V E  ++   +  + +  LM    +    +PL A+      +
Sbjct: 874 QVHDELVFEVKESALESVTAEVKALMEQAAT--LDVPLIADAGFGDNW 919


>gi|330831571|ref|YP_004394523.1| DNA polymerase I [Aeromonas veronii B565]
 gi|328806707|gb|AEB51906.1| DNA polymerase I [Aeromonas veronii B565]
          Length = 921

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 112/706 (15%), Positives = 211/706 (29%), Gaps = 170/706 (24%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDP----------VMP 54
             D ET S           Y E   ++  +F  +          HD           V+ 
Sbjct: 345 AFDTETTSLD---------YME-ARIVGVSFAVEAGKAAYVPFGHDYLGAPVQLSEAVVL 394

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA---LKA 111
             LK  LE+     V  N  ++R VL    ++D+    +  T++ +      ++   + +
Sbjct: 395 GKLKPLLEDPTCLKVGQNLKYDRNVLLNH-DIDLQGIAY-DTMLESYVLNSTASRHDMDS 452

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + +              L       E       +    ++        Y   D  +T  +
Sbjct: 453 LAKRY------------LGVETTSFEDIAGKGVKQLTFNQIELEQAAPYAAEDADITLRL 500

Query: 172 FKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L                 E  L  +   +   G  +D  L H  +Q +++   +L++
Sbjct: 501 HQTLWGQLEAVPGLAKVFSEIELPLLPVLARMELLGTTIDPKLLHQQSQEIELRLAELEK 560

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   L      +    ++L   LF + GL +   T     +T + VL+   +       +
Sbjct: 561 QAHELAGQ-EFNLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYELPQ-L 618

Query: 277 FNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
                  ++      + L   +    GR+  +     A+ TGR S      QN+P  +  
Sbjct: 619 LMEHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVAA-TGRLSSSDPNLQNIPVRNEQ 677

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   I S G KLV AD + IE R++A ++G+
Sbjct: 678 GRR-------------------------IRQAFIPSAGYKLVAADYSQIELRIMAHLSGD 712

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  L AF  G+D++  T A  F VA   VT D R   K +                    
Sbjct: 713 KGLLTAFAEGKDIHKATAAEVFGVAIDAVTTDMRRSAKAINF--------------GLIY 758

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        ++    + +++ 
Sbjct: 759 GMS------------------------------AFGLAKQLGIGRAEAQKYMDLYFERYP 788

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V E      Q  E                              +    GR L   D+ +
Sbjct: 789 GVLEYMERTRQQAE--------------------------AQGYVETLFGRRLYLPDIKS 822

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN-------ATKAGYDIVLTV 628
             + L    +   R            +Q  + DI+   M+N              +++ V
Sbjct: 823 RNAGLR---KAAERAAINAP------MQGTAADIIKRAMINVDSWIRGIEDESIRMLMQV 873

Query: 629 HDEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E  +       +++   M++       +PL  E      +
Sbjct: 874 HDELVFEIREEKLEEYIAIIKEKMSAAAE--LDVPLVVEAGTGDNW 917


>gi|320185486|gb|EFW60254.1| DNA polymerase I [Shigella flexneri CDC 796-83]
          Length = 928

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNPLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|300931708|ref|ZP_07147013.1| DNA-directed DNA polymerase [Escherichia coli MS 187-1]
 gi|300460499|gb|EFK23992.1| DNA-directed DNA polymerase [Escherichia coli MS 187-1]
          Length = 928

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYATEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|320198938|gb|EFW73536.1| DNA polymerase I [Escherichia coli EC4100B]
          Length = 928

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDANVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|206576415|ref|YP_002241257.1| DNA polymerase I [Klebsiella pneumoniae 342]
 gi|288937896|ref|YP_003441955.1| DNA polymerase I [Klebsiella variicola At-22]
 gi|206565473|gb|ACI07249.1| DNA polymerase I [Klebsiella pneumoniae 342]
 gi|288892605|gb|ADC60923.1| DNA polymerase I [Klebsiella variicola At-22]
          Length = 930

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 104/701 (14%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 355 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  +  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 405 ALLKPLLEDEKLLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 457 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 513

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 514 MWPKLQQHEGPLNIFKHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 574 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 633 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 727 TAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 772 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 803 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+   +          +++ VHDE+V
Sbjct: 837 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRKEQPRVRMIMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 888 FEVHKDELDAVSKKIHELMENSTTLA--VPLLVEVGSGENW 926


>gi|119475294|ref|ZP_01615647.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
 gi|119451497|gb|EAW32730.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
          Length = 920

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 209/707 (29%), Gaps = 169/707 (23%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PV 52
               D ET S           Y E   V+  +F  +          HD            
Sbjct: 343 YFAFDTETTSLN---------YME-ARVVGVSFAVEAGSAAYVPFGHDYVGVEQQLSEDW 392

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SAL 109
           +   LK  LE++    V  N  ++R VL     +++   +   T++ +           +
Sbjct: 393 VLAQLKPLLEDSSRAKVGQNLKYDRNVLANH-GIELNGIQ-FDTMLESYVLNSTATRHDM 450

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
            ++              K L     K E       +    ++   +  G Y   D  +T 
Sbjct: 451 DSLAR------------KYLDVGTIKFEDIAGKGAKQLTFNQIQLQQAGPYAAEDADITL 498

Query: 170 EIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L P             + E  L  +   I   G  V   L +  +  +     +L
Sbjct: 499 QLHEVLWPKLAAIDSLMSVFQTIELSLVPVLSRIERNGALVSRDLLNKQSAELGTRLQQL 558

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAI 274
           ++E   L      +    ++L   LF +  L +   T     +T + VL+      P   
Sbjct: 559 EKEAHELAG-EAFNLSSPKQLGHILFDKLELPVIKKTPKGAASTAEEVLAELALDYPLP- 616

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           ++       S+      + L + ++   GR+  +      + TGR S      QN+P  +
Sbjct: 617 RILMEYRGLSKLKSTYTDKLPQMISEVTGRIHTSYHQAV-TATGRLSSSDPNLQNIPIRT 675

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
               +                         VR   +A +G K+V AD + IE R++A ++
Sbjct: 676 EEGRK-------------------------VRQAFVARDGYKIVAADYSQIELRIMAHLS 710

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
            +   LKAF  G+D++  T A  F +   QV+ +QR   K +                  
Sbjct: 711 QDNGLLKAFAEGKDIHQATAAEVFGLELEQVSTEQRRRAKAINF--------------GL 756

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             G++    A  +                                     +     +  +
Sbjct: 757 IYGMSAFGLAKQID------------------------------VGRHEAQEYIDTYFSR 786

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
           +  V +  +       +                             +    GR L   ++
Sbjct: 787 YPGVRDYMDNTRADAAE--------------------------RGYVETLYGRRLYLPEI 820

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLT 627
             +            R            +Q  + DI+ + M++  +          +++ 
Sbjct: 821 NASNGMRRQA---AERTAINAP------MQGTAADIIKKAMVDVDRWLLESDVDGQMIMQ 871

Query: 628 VHDEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           VHDE+V E  +       S +  LM+        +PL  +      +
Sbjct: 872 VHDELVFEVAEPSLDYLVSSVNDLMSGAV--VLDVPLIVDVGIGSNW 916


>gi|320196914|gb|EFW71536.1| DNA polymerase I [Escherichia coli WV_060327]
          Length = 884

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 309 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 358

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 359 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 416

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 417 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 464

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 465 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 524

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 525 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 583

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 584 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 642

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 643 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 677

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 678 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 723

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 724 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 753

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 754 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 787

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 788 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 838

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 839 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 880


>gi|227824019|ref|YP_002827992.1| DNA polymerase I [Sinorhizobium fredii NGR234]
 gi|227343021|gb|ACP27239.1| DNA polymerase I [Sinorhizobium fredii NGR234]
          Length = 1040

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 106/721 (14%), Positives = 208/721 (28%), Gaps = 183/721 (25%)

Query: 6    IDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHP---------VELWDCVHDP----- 51
             D ET S   +             +   +    D+                +H       
Sbjct: 446  FDTETTSLDPMR----------ADLCGVSLAIADYSNDPMGGTIRAAYVPLIHKNGVGDL 495

Query: 52   -------------VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLV 98
                              LK  LE+  V  VA N  ++  V+K      I +  +  T++
Sbjct: 496  LGGGLVENQVPMREALSRLKNLLEDPSVLKVAQNLKYDYLVMKRH---GIAMQSFDDTML 552

Query: 99   LARSNGLP---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWR 155
            ++           + ++ E           G   I      +        +         
Sbjct: 553  MSYVVDAGNGMHGMDSLSERW--------LGHTPIPY----KDIAGTGKASVSFDFVDID 600

Query: 156  LFGEYCKGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAH 205
                Y   D  VT  ++  L+P              E+ L  +   + +RG  VD  +  
Sbjct: 601  KATTYAAEDADVTLRLWHVLKPRLAAKGLTRVYERLERPLIAVLAHMEERGITVDRQILS 660

Query: 206  TLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQR 261
             L+  +      L+ E+  L      +    ++L   LF + GL     T+    +T   
Sbjct: 661  RLSGELAQGAAALEDEIYRLAG-ETFTIGSPKQLGDILFGKMGLPGGSKTKTGQWSTSAS 719

Query: 262  VLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSG 321
            VL     +  +  +   +  + ++      + L   ++ + +   T   L A+ TGR S 
Sbjct: 720  VLEDLAAVGHELPRKIVDWRQLTKLKSTYTDALPGYVHPETKRVHTGYALAATTTGRLSS 779

Query: 322  CVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADL 381
                 QN+P  +                              +R+  IA+ G KLV AD 
Sbjct: 780  SEPNLQNIPVRTAEGRR-------------------------IRTAFIATPGHKLVSADY 814

Query: 382  AGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
            + IE RVLA +A      +AF  G D++  T +  F V    +  + R   K +   +  
Sbjct: 815  SQIELRVLAHVADIPQLRQAFADGVDIHAMTASEMFGVPVEGMPSEIRRRAKAINFGII- 873

Query: 442  QGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGT 501
                          G++    A+ +                                  +
Sbjct: 874  -------------YGISAFGLANQLSIE------------------------------RS 890

Query: 502  ACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILM 561
                  K + ++   + +          +                          +  + 
Sbjct: 891  EAGDYIKRYFERFPGIRDYMENTKAFARE--------------------------HGYVE 924

Query: 562  LPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT--- 618
               GR   Y D+ ++   +        R            +Q  + DI+   M+      
Sbjct: 925  TIFGRRAHYPDIRSSNPSMR---AFNERASINAP------IQGSAADIIRRAMVKMEPAL 975

Query: 619  ---KAGYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWAKG--LPLKAEGYESKR 672
               K    ++L VHDE++ E  + +      ++  +M +    A    +PLK +   ++ 
Sbjct: 976  DEAKLAARMLLQVHDELIFEVEEGEIERTLPVIVSVMENAAMPALDMRVPLKVDARAAQN 1035

Query: 673  Y 673
            +
Sbjct: 1036 W 1036


>gi|332764614|gb|EGJ94846.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Shigella flexneri 2930-71]
          Length = 884

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 309 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 358

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 359 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 416

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 417 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 464

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 465 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 524

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 525 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 583

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 584 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 642

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 643 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 677

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 678 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 723

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 724 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 753

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 754 VLEYMERTRAQAKE--------------------------LGYVETLDGRRLYLPDIKSS 787

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 788 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 838

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 839 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 880


>gi|194290334|ref|YP_002006241.1| DNA polymerase I [Cupriavidus taiwanensis LMG 19424]
 gi|193224169|emb|CAQ70178.1| DNA polymerase A; 5'->3' exonuclease ; 3'->5' polymerase ; 3'->5'
           exonuclease [Cupriavidus taiwanensis LMG 19424]
          Length = 939

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/709 (14%), Positives = 191/709 (26%), Gaps = 171/709 (24%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------- 50
           + ID ET S   +             ++  +              H              
Sbjct: 359 VAIDTETTSLDPM----------QAQLVGISLSAAPGEACYIPVAHRGPDVAGLPEHGQL 408

Query: 51  --PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP-- 106
               + + ++  LE+     +  N  ++  V      + +       T++ +        
Sbjct: 409 SREFVLERMRAWLEDASRPKLGQNLKYDIHVFANH-GIKLRGVA-HDTMLQSYVLASHRN 466

Query: 107 SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVT 166
             + ++ E L            L  +    E             +       EY   D  
Sbjct: 467 HGMDSLAERL------------LSLKTITYEEVCGKGASQIGFDQIDLARATEYAAEDAD 514

Query: 167 VTREIFKRLEP-----------LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVER 215
           VT  + +R+ P               E  +  + Q +   G  +D       +  +    
Sbjct: 515 VTLRLHRRMFPQVEAAAGLRRVYEEIEMPVSVVLQKVERNGVLIDAERLAAQSAELGQRM 574

Query: 216 TKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTP 271
             L+Q           +    +++   LF +  L +   T     +T + VL    +  P
Sbjct: 575 LALEQSAYEAAGQP-FNLGSPKQIGEILFNQMKLPVVKKTASGAPSTDEEVLQKLAEDYP 633

Query: 272 QAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR 331
               + + R   S+      + L + +N       T      + TGR +      QN+P 
Sbjct: 634 LPKLLLDYR-GLSKLKSTYTDKLPKMVNPRTGRVHTSYGQATAVTGRLASTEPNLQNIPV 692

Query: 332 PSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAW 391
            +                              +R   IA  G  +V AD + IE R++A 
Sbjct: 693 RTDEGRR-------------------------IREAFIAEPGSVIVSADYSQIELRIMAH 727

Query: 392 MAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKM 451
           ++G++  L+AF  GED++  T A  F V    V+ +QR   KV+                
Sbjct: 728 ISGDENLLRAFANGEDIHRATAAEIFGVERDAVSSEQRRYAKVIN--------------F 773

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
               G++                                  A        A       + 
Sbjct: 774 GLIYGMS------------------------------AFGLASNLGIERDAARHYIDRYF 803

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
            ++  V+    E  Q   +                             +    GR L   
Sbjct: 804 MRYPGVAHYMEETRQTARE--------------------------QGYVETVFGRRLWLP 837

Query: 572 DVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIV 625
           D+               R            +Q  + D++   M+               +
Sbjct: 838 DINGGSGPRRQA---AERAAINAP------MQGTAADLIKLSMIAVQDWLERDGLQTRQI 888

Query: 626 LTVHDEIVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           + VHDE+V E P+ +       L  LM +       +PL AE      +
Sbjct: 889 MQVHDELVLEVPEHELELVKARLPELMCTVAE--LRVPLVAEVGSGANW 935


>gi|70733594|ref|YP_257234.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
 gi|68347893|gb|AAY95499.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
          Length = 929

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 104/712 (14%), Positives = 197/712 (27%), Gaps = 168/712 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DP 51
             +  D ET              A+   ++  +F             H            
Sbjct: 342 KLIAFDTETT----------GIDAQQAQLVGLSFSVKAGEAAYVPLTHSYMGAPAQLDRD 391

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACF-------NLDIPIHRWICTLVLARSNG 104
            +   LK  LE+  +  V  ++ F+  +L  C         + +       T++ +    
Sbjct: 392 SVLLALKPLLEDPKLLKVGQHAKFDMNILANCAIGGDQANGITVRGVA-FDTMLESYVLN 450

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGD 164
             +         +     + + K L       +       +     +      G Y   D
Sbjct: 451 STAT--------RHDMDSLAQ-KYLDHSTVSFQDIAGKGAKQLTFDQIPLEQAGPYAAED 501

Query: 165 VTVTREIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDV 213
             VT  + + L                 E  L  +   I  +G  VD  L    +  +  
Sbjct: 502 ADVTLRLHQVLFDKLSAIPSLASVLTDIEMPLVPVLARIERQGALVDDKLLGVQSIELGD 561

Query: 214 ERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKL 269
           +   L++E   +      +    ++L + L+ + GL +   T     +T + VL+   + 
Sbjct: 562 KMVALEREAFEIAG-EEFNLGSPKQLGSILYDKLGLPVLKKTAKGQPSTAEEVLAKLAED 620

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQN 328
                +V       S+      + L E +N   GR+  +     A  TGR S      QN
Sbjct: 621 DYPLPRVLMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-STGRLSSSDPNLQN 679

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
           +P  +                              +R   IA  G KL+ AD + IE R+
Sbjct: 680 IPVRTAEGRR-------------------------IRQAFIAPPGYKLLAADYSQIELRI 714

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           +A ++ ++  L AF    D++  T A  F V    VT DQR   K +             
Sbjct: 715 MAHLSRDEGLLNAFRNNLDVHTATAAEVFKVELKDVTSDQRRSAKAIN------------ 762

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                  G+                                 +   +        +    
Sbjct: 763 --FGLIYGMG------------------------------AQKLGKDIGVDTKQAKAYID 790

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            +  ++  V E  +                                 +   +    GR L
Sbjct: 791 TYFARYPGVREYMDRTRAQA--------------------------ADQGYVETIFGRRL 824

Query: 569 VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGY 622
              ++ +N+           R            +Q  + DI+ + M+             
Sbjct: 825 YLPEINSNKP---QERAGAERTAINAP------MQGTAADIIKKAMVAVDNWLASSGLDA 875

Query: 623 DIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            ++L VHDE+V E  +         +   M+   +    +PL  E      +
Sbjct: 876 RVILQVHDELVLEVREDLVDQVREEIRGHMSGAAT--LDVPLLVEVGVGNNW 925


>gi|290513119|ref|ZP_06552482.1| DNA polymerase I [Klebsiella sp. 1_1_55]
 gi|289774501|gb|EFD82506.1| DNA polymerase I [Klebsiella sp. 1_1_55]
          Length = 930

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 104/701 (14%), Positives = 210/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD            + 
Sbjct: 355 AFDTETDSLDNIS----------ANMVGLSFAVEPGVAAYVPVAHDYLDAPDQIPRERVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
            +LK  LE+  +  V  N  ++R +L    ++++       T++ +        L +V  
Sbjct: 405 ALLKPLLEDEKLLKVGQNLKYDRGILANY-DIELRGIA-FDTMLESYI------LDSVAG 456

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
              + S      K    +    E            ++ A    G Y   D  VT ++  +
Sbjct: 457 RHDMDSLSDRWLK---HKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLK 513

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   +              L  +   +   G  +D A+ H  +Q +     +L+Q   
Sbjct: 514 MWPKLQQHEGPLNIFKHIEMPLVPVLSRVERNGVKIDPAVLHAHSQEIAQRLVELEQRAH 573

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 574 EIAG-EAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 632

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 633 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 690

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 691 ------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLL 726

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 727 TAFSEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINF--------------GLIYGMS- 771

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            A +        ++    + +++  V E
Sbjct: 772 -----------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGVLE 802

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++   
Sbjct: 803 YMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSSNGA 836

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+   +          +++ VHDE+V
Sbjct: 837 RRAGAER---------AAINAPMQGTAADIIKRAMIAVDEWLRKEQPRVRMIMQVHDELV 887

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E    +       ++ LM ++ + A  +PL  E    + +
Sbjct: 888 FEVHKDELDAVSKKIHELMENSTTLA--VPLLVEVGSGENW 926


>gi|237807112|ref|YP_002891552.1| DNA polymerase I [Tolumonas auensis DSM 9187]
 gi|237499373|gb|ACQ91966.1| DNA polymerase I [Tolumonas auensis DSM 9187]
          Length = 910

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 107/705 (15%), Positives = 193/705 (27%), Gaps = 168/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   +             V+  +F             HD              
Sbjct: 334 SFDTETNSLDYI----------QAQVVGLSFAVAPGDAAYLPLAHDYLGAPEQLDREQTL 383

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
             LK  LE+     V  +  F+R VL+    + +       T++ +           +  
Sbjct: 384 AKLKPLLEDPTRLKVGQHLKFDRNVLRNH-GIHLQGIA-FDTMLESYVLNSTASRHNMDD 441

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + +            K L       E       +    ++        Y   D  +T  +
Sbjct: 442 LAK------------KYLNYTTQTFEDVAGKGVKQLTFNQVELEKAAFYAAEDADITLRL 489

Query: 172 FKRLEPL-----------SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               E  L  +   +   G  +D  L    +Q ++V   +L+ 
Sbjct: 490 HQTLWPQVEKEPALKSLLLEMELPLAEVLSDMERTGALIDPFLLQNQSQQIEVRLAELES 549

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +  G   +    ++L   LF +  L +   T     +T + VL       P    +
Sbjct: 550 QAHEIAGGP-FNLGSPKQLGEVLFEKLQLPVIKKTPKGAPSTAEEVLQELAYDYPLPKLL 608

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             +R   S+      + L   +        T      + TGR S      QN+P  +   
Sbjct: 609 LEHR-SLSKLKSTYTDKLPLMIAPSTGRVHTSYHQAVTATGRLSSSDPNLQNIPVRTEEG 667

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   +A  G K+V AD + IE R++A ++ + 
Sbjct: 668 RR-------------------------IRQAFVADHGYKIVAADYSQIELRIMAHLSEDD 702

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L+AF  G+D++  T A   N+ P  VT +QR   K +                    G
Sbjct: 703 GLLQAFAHGQDIHRATAAEIMNITPEAVTSEQRRNAKAINF--------------GLIYG 748

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        +R    + +++  
Sbjct: 749 MS------------------------------AFGLAKQLGIPRGEAQRYMDRYFERYPG 778

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V        +  EQ                             +    GR L   D+   
Sbjct: 779 VLTYMERTREQAEQA--------------------------GYVETLFGRRLYLPDIKAK 812

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA-------TKAGYDIVLTVH 629
              L    +   R            +Q  + DI+   M+               +V+ VH
Sbjct: 813 NMGLR---KAAERAAINAP------MQGTAADIIKRAMIKLADWIKTCDNGTIRMVMQVH 863

Query: 630 DEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +        ++   M    S    +PL         +
Sbjct: 864 DELVFEVREDKLDAYVPVIRQYMMDAAS--LKVPLDVGIGVGDNW 906


>gi|323943759|gb|EGB39856.1| DNA polymerase A [Escherichia coli H120]
          Length = 810

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 235 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 284

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 285 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 342

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 343 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDSDVTLQL 390

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 391 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 450

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 451 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 509

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 510 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 568

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 569 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 603

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 604 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 649

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 650 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 679

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 680 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 713

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 714 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 764

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 765 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 806


>gi|261856277|ref|YP_003263560.1| DNA polymerase I [Halothiobacillus neapolitanus c2]
 gi|261836746|gb|ACX96513.1| DNA polymerase I [Halothiobacillus neapolitanus c2]
          Length = 940

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 111/705 (15%), Positives = 203/705 (28%), Gaps = 162/705 (22%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------D 50
           M  +  D ET S  DL             ++  +F  +D+        H           
Sbjct: 362 MDWVAFDTETDSL-DLFA---------GRIVGVSFSIEDNRAAYVPLAHNYPGAPAQLDR 411

Query: 51  PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALK 110
             +   LK  LE+   T V  N+ F+  +L     + +       T++ +      +   
Sbjct: 412 DTVLADLKPWLEDASRTKVMQNAKFDSHMLANH-GITLR-GVLFDTMLESYVLDSTAT-- 467

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
                 +     +   K L       E       +            G Y   D  VT +
Sbjct: 468 ------RHDMDSLAA-KYLGRSTITFEDIAGKGAKALSFPEIHLEQAGPYAAEDADVTGQ 520

Query: 171 IFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           + + L P             + EQ L  +   +   G  VD        + +      ++
Sbjct: 521 LQQCLWPKLSVEPDLRSVYETIEQPLIEVLVAMERAGVRVDRGELAIQGKAIGERIAAVE 580

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQ 275
           Q           +    ++LK  LF E  L +   T     +T +  L       P    
Sbjct: 581 QAAFKEAG-REFNLGSTKQLKELLFDELKLPVGKKTPKGEPSTDEEALGELVGSHPLPAL 639

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           + + R   S+     ++ L E +++  GR+         + TGR S      QN+P  S 
Sbjct: 640 ILDYR-GLSKLKSTYIDRLPEDIHTHTGRVHSAFHQAV-TATGRLSSSNPNLQNIPIRSE 697

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   +A  G KL+ AD + IE R++A ++ 
Sbjct: 698 EGRR-------------------------IRQAFVADPGCKLISADYSQIELRIMAHLSE 732

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++    AF  GED++  T A  F V   +V+ +QR   K +                   
Sbjct: 733 DERLCAAFAAGEDIHRATAAEVFGVKEVEVSDNQRRAAKAINF--------------GLI 778

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++    A  +                                     +     +  ++
Sbjct: 779 YGMSAFGLAKQLD------------------------------VPRGEAQAYIDLYFARY 808

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V++    + Q   Q                             +    GR L   ++ 
Sbjct: 809 PGVAKYMERMRQQARQ--------------------------MGYVETVFGRRLYLPEIH 842

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA-----GYDIVLTVH 629
           +             R            +Q  + DI+   M+   K         ++L VH
Sbjct: 843 SRNGQRRQY---AERTAINAP------MQGTAADIIKIAMIALHKLLVVPGRARMILQVH 893

Query: 630 DEIVCETPDTDEFNASMLYH-LMTSNPSWAKGLPLKAEGYESKRY 673
           DE++ E P++D      +    MT        +PL+      + +
Sbjct: 894 DELIFEVPESDVAEIEPIIRAQMTGAAK--LNVPLEVGIGIGRSW 936


>gi|326793522|ref|YP_004311342.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
 gi|326544286|gb|ADZ89506.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
          Length = 919

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 99/702 (14%), Positives = 206/702 (29%), Gaps = 162/702 (23%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPV----------M 53
           +  D ET S   +             ++  +   +          HD            +
Sbjct: 344 VAFDTETTSLNYM----------QAELVGVSVAIEAGKAAYIPVAHDYEDAPEQLDRDWV 393

Query: 54  PQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            + LK  LE+     V  +  ++  VL    ++ +   +   T++ +             
Sbjct: 394 LEQLKPWLEDEGKAKVGQHLKYDANVLNNY-DITLRGIK-FDTMLESYVFNSTGT----- 446

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
              +     +   K L     K E       + K  ++        Y   D  +T  + +
Sbjct: 447 ---RHDMDSLSS-KFLGHSTVKFEDIAGKGAKQKTFNQIDLEQAAFYAAEDADITLRLHQ 502

Query: 174 RLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
            + P               E  L  +   +   G  +D    H  +  +     +++ + 
Sbjct: 503 AILPKLEKTPELVSVFSDIELPLVPVLAKMEQTGALIDPDRLHAQSAEIASRLQEVEIKA 562

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFN 278
                    +    ++L+  LF + GL +   T     +T + +L    +       +  
Sbjct: 563 HEEAGQ-EFNLSSPKQLQEILFEKQGLPVIKKTPKGQPSTAEPILQELAENYELPRLIME 621

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
           +R   ++      + L E +   GR+  +      + TGR S      QN+P  ++    
Sbjct: 622 HR-SLAKLKSTYTDKLPEMIQHTGRIHTSYHQAV-TATGRLSSTDPNLQNIPIRTQEGRR 679

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    +R   +A EG KLV AD + IE R++A ++ ++  
Sbjct: 680 -------------------------IRQAFVAPEGHKLVAADYSQIELRIMAHLSQDKGL 714

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L AF   ED++  T A  F VA   VT +QR   K +                    G++
Sbjct: 715 LDAFAHDEDVHKATAAEVFEVAVDDVTAEQRRRAKAIN--------------FGLIYGMS 760

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A +        ++  + + +++  V 
Sbjct: 761 ------------------------------AFGLAKQLGISRPEAQKYVQRYFERYPGVR 790

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
                  +  ++                             +    GR L   ++    +
Sbjct: 791 TYMETTRENAKE--------------------------KGYVETIFGRRLYLPEIKARNA 824

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEI 632
            +        R            +Q  + DI+   M+           G  +++ VHDE+
Sbjct: 825 MMRQA---AERTAINAP------MQGSAADIIKRAMIKMHNWLADTDLGVKMIMQVHDEL 875

Query: 633 VCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           + E  + D   A + +  +M ++      +PL  E      +
Sbjct: 876 IFEVAEKDLEAAQAKIIDIMQNSTE--IDVPLLVEAGVGDNW 915


>gi|320182134|gb|EFW57037.1| DNA polymerase I [Shigella boydii ATCC 9905]
          Length = 884

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 309 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 358

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 359 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 416

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 417 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 464

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 465 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 524

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 525 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 583

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 584 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 642

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 643 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 677

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 678 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 723

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 724 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 753

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 754 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 787

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 788 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 838

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 839 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 880


>gi|331685599|ref|ZP_08386182.1| DNA polymerase I (POL I) [Escherichia coli H299]
 gi|331077070|gb|EGI48285.1| DNA polymerase I (POL I) [Escherichia coli H299]
          Length = 928

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF +  +     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQSIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|71898927|ref|ZP_00681094.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731339|gb|EAO33403.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 275/726 (37%), Positives = 367/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+   D PV++WDC     MP+ L  AL 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           N  V +  HNS+F+RTVL     ++IP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGINIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F +Y + DV   R++ KRL   +
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLPSHN 187

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               EL  W+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   +
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L  E G+ L D+ + T +R L  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCL-DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +          D
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  VTK QR IGKV 
Sbjct: 427 HSGEAITHGALRGAPITLQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   ++A     W + NH      
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMAAQAAL--PPLLLQEATELLEWTKANHRPTFGL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + ++  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETA-----HTCCGITVQYSR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+E
Sbjct: 660 LAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFE 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 THRYRK 725


>gi|324115642|gb|EGC09580.1| DNA polymerase I [Escherichia coli E1167]
          Length = 928

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIELGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|159045449|ref|YP_001534243.1| DNA polymerase I [Dinoroseobacter shibae DFL 12]
 gi|157913209|gb|ABV94642.1| DNA polymerase I [Dinoroseobacter shibae DFL 12]
          Length = 932

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 99/718 (13%), Positives = 197/718 (27%), Gaps = 180/718 (25%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            + +D ET    ++             ++  +   D          H             
Sbjct: 344 VVAVDTETTGLNEMR----------ADLVGVSLCVDPGRAAYLPLAHKDGGGADDLFGGE 393

Query: 51  ----------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLA 100
                          +LK  LE+  V  +  N  ++  +L       I +     T++L+
Sbjct: 394 AKLAEGQLDFETALGMLKPVLEDPAVLKIGQNMKYDAKILARN---GITVAPIDDTMLLS 450

Query: 101 RSNGLP---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLF 157
            +         + A+ E            K L+                           
Sbjct: 451 YALHAGLHGHGMDALSERY--LDHTPIPIKTLL----------GTGKSAITFDFVPIEEA 498

Query: 158 GEYCKGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTL 207
            +Y   D  +T  +++RL+P              E+ +  +   +  RG  VD      +
Sbjct: 499 TKYAAEDAEITLRLWQRLKPRLHLAQVTRVYEWMERPMVPVLAEMEMRGIKVDRDTLSRM 558

Query: 208 NQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVL 263
           +     +   L+ E+  L      +     +L   LF + G       ++    T   VL
Sbjct: 559 SNAFAQKMAGLEAEIHELAG-ESFNVGSPAQLGEILFEKMGFEGGKTGKSGKYSTPADVL 617

Query: 264 SSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGC 322
                      +V + R   S+      + L + +N + GR+  +    GA+ TGR +  
Sbjct: 618 EDLATEHDLPRRVLDWRQ-LSKLKSTYTDALQDHINPETGRVHTSYSIAGAN-TGRLAST 675

Query: 323 VFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLA 382
               QN+P  S                              +R   +A  G  LV  D +
Sbjct: 676 DPNLQNIPVRSEEGRR-------------------------IREAFVAEPGHVLVSLDYS 710

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQ 442
            IE R+LA +AG      AF  G D++  T +  F+V   ++T + R   K +       
Sbjct: 711 QIELRILAHIAGIDALKTAFRDGLDIHAMTASEMFDVPLDEMTPEVRRQAKAINF----- 765

Query: 443 GGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTA 502
                        G++                                  A         
Sbjct: 766 ---------GVIYGIS------------------------------GFGLARNLRIPRAE 786

Query: 503 CERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILML 562
            +     + ++   +    ++     ++                             +  
Sbjct: 787 AQAFIDTYFERFPGIRAYMDDTVAFAKEHK--------------------------YVQT 820

Query: 563 PSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN----AT 618
             GR +   ++G              R            +Q  + DI+   M+       
Sbjct: 821 LFGRKIHTPEIGAK----GPQAGFAKRAAINAP------IQGTAADIIRRAMVRMPAAIA 870

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMT--SNPSWAKGLPLKAEGYESKRY 673
                ++L VHDE++ E  +         +  +M   + P     +PL  +  + + +
Sbjct: 871 DLPARMLLQVHDELIFEVEEDAVDRVIPAVRQVMEGAAAPVVHLDVPLTVDAGQGRSW 928


>gi|300113291|ref|YP_003759866.1| DNA polymerase I [Nitrosococcus watsonii C-113]
 gi|299539228|gb|ADJ27545.1| DNA polymerase I [Nitrosococcus watsonii C-113]
          Length = 901

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 110/704 (15%), Positives = 203/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S           Y E   ++  +F    H        H+            + 
Sbjct: 326 AFDLETNSLD---------YME-AEIVGLSFAIQPHEAMYIPLGHEDATAPPQLPREQVL 375

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
             LK  LE+     V  N  F+R VL     +++       +++ +           + +
Sbjct: 376 ARLKPLLEDPRHGKVGQNLKFDRNVLANY-GIELQGIH-HDSMLESYVLDSTATRHNMDS 433

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +              K L       E       +  P ++        Y   D  ++ ++
Sbjct: 434 LAL------------KYLQRTTITYEMVAGKGSKQLPFNQVTIEKAAPYAAEDADISLQL 481

Query: 172 FKRLEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            +   P   +E+            L  +   +   G  VD     T +  +     KL+Q
Sbjct: 482 HRYFWPRIQQEESLRRLYQELEIPLIPVLSRMERNGVQVDTTQLKTQSDELAARLKKLEQ 541

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           E   L      +    ++++  L+ +  L +   T     +T + VL       P   ++
Sbjct: 542 EAFDLAG-ESFNLASPKQIQAILYEKLKLPVTRKTPTGQPSTAETVLQELALDYPLPQRL 600

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   S+      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 601 LQYR-TLSKLKSTYTDRLPLQVNPHTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRTAEG 659

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA  G +LV AD + IE R++A ++ ++
Sbjct: 660 RR-------------------------IRQTFIAPPGYRLVAADYSQIELRIMAHLSEDE 694

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AFE  ED++  T    F     +VT +QR   K +                    G
Sbjct: 695 GLLAAFEAEEDIHQRTATEVFRTPLEEVTPEQRRSAKAINF--------------GLIYG 740

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                    +     TA +   + + Q++  
Sbjct: 741 MS------------------------------AHGLGRQLGINRTAAQHYIERYFQRYPG 770

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V    + + Q   Q                             +    GR L   D+ + 
Sbjct: 771 VKAYMDNICQQARQ--------------------------KGYVETLFGRRLYLPDIHSR 804

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN----ATKA--GYDIVLTVHD 630
           ++       Q  R            +Q  + DI+   M++      K      +++ VHD
Sbjct: 805 QT---QRRNQAERTAINAP------MQGSAADIIKRAMIHTDGWLQKNSDNARMIMQVHD 855

Query: 631 EIVCETPDTDEF-NASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E  +         +   MT+       +PL  E      +
Sbjct: 856 ELVFEVAEDKLEITMRAIRENMTAAAQ--LKIPLIVEIGSGANW 897


>gi|218707489|ref|YP_002415008.1| DNA polymerase I [Escherichia coli UMN026]
 gi|293407483|ref|ZP_06651402.1| DNA polymerase I [Escherichia coli FVEC1412]
 gi|298383226|ref|ZP_06992819.1| DNA polymerase I [Escherichia coli FVEC1302]
 gi|300896902|ref|ZP_07115390.1| DNA-directed DNA polymerase [Escherichia coli MS 198-1]
 gi|218434586|emb|CAR15515.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli UMN026]
 gi|291425400|gb|EFE98439.1| DNA polymerase I [Escherichia coli FVEC1412]
 gi|298276260|gb|EFI17780.1| DNA polymerase I [Escherichia coli FVEC1302]
 gi|300359277|gb|EFJ75147.1| DNA-directed DNA polymerase [Escherichia coli MS 198-1]
          Length = 928

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LEN     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLENEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   I  E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIGPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|301169575|emb|CBW29176.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Haemophilus influenzae 10810]
          Length = 935

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 102/705 (14%), Positives = 213/705 (30%), Gaps = 165/705 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDC----------VHDP 51
             + +D ET S   ++            ++  +F  ++                  +   
Sbjct: 359 KLIAVDTETDSLDYMS----------ANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 408

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SAL 109
                +K  LEN ++  +  N  F+ ++      +++       T++L+ +        +
Sbjct: 409 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVE-FDTMLLSYTLNSTGRHNM 466

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
             + +           G E IA     E+           ++       EY   D  VT 
Sbjct: 467 DDLAKRY--------LGHETIAF----ESLAGKGKSQLTFNQIPLEQATEYAAEDADVTM 514

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L                 E  L ++   +   G  +D       +  +    T L
Sbjct: 515 KLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRLTAL 574

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAI 274
           +++  +L      +    ++L+  LF + GL           +T + VL           
Sbjct: 575 EKQAYALAGQP-FNLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHELP- 632

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           ++       S+      + L + +NS      T      + TGR S      QN+P  + 
Sbjct: 633 KILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNE 692

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA EG  +V AD + IE R++A ++G
Sbjct: 693 EGRR-------------------------IRQAFIAREGYSIVAADYSQIELRIMAHLSG 727

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           +Q  + AF  G+D++ +T A  F V+  +VT +QR   K +                   
Sbjct: 728 DQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------GLI 773

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  + +        ++    + Q++
Sbjct: 774 YGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQRY 803

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V +   ++ +  +                              +    GR L   D+ 
Sbjct: 804 PSVQQFMTDIREKAKT--------------------------QGYVETLFGRRLYLPDIN 837

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA-----GYDIVLTVH 629
           ++ +      +   R            +Q  + DI+   M+   +        ++++ VH
Sbjct: 838 SSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIHHDPNIEMIMQVH 888

Query: 630 DEIVCETP-DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E   +   F    +   M S       +PL  E    + +
Sbjct: 889 DELVFEVRSEKVAFFREQIKQHMESAAELV--VPLIVEVGVGQNW 931


>gi|104779389|ref|YP_605887.1| DNA polymerase I [Pseudomonas entomophila L48]
 gi|95108376|emb|CAK13070.1| DNA polymerase I, 3'--> 5' polymerase, 5'--> 3' and 3'--> 5'
           exonuclease [Pseudomonas entomophila L48]
          Length = 922

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 105/701 (14%), Positives = 193/701 (27%), Gaps = 158/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET              A+   ++  +F  + +        HD            + 
Sbjct: 344 AFDTETTGLD----------AQQASIVGLSFAVEPNEAAYVPLAHDYEGAPAQLDREAVL 393

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
             LK  LE+     +  N+ ++  +L       +       T++ +      +       
Sbjct: 394 LALKPLLEDPAKGKIGQNAKYDINILANGSPAILMRGVAYDTMLESYVLDSTAT------ 447

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + + K L       E       +    ++      G Y   D  VT  +   
Sbjct: 448 --RHDMDSLAQ-KYLDHTTIGFEDIAGKGAKQLTFNQIPLEKAGPYAAEDADVTLRLHHA 504

Query: 175 LEPLSSKEQELWYLDQTINDR-----------GYCVDVALAHTLNQIVDVERTKLDQELE 223
           L+   +    +  +   I              G  VD AL    +  +  +  +L++E  
Sbjct: 505 LQARLANTPSVLPVLMDIEMPLVPVLAKIERQGALVDAALLGVQSGELGAKLVELEREAY 564

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFNN 279
           +L      +    ++L   L+ + G+ +   T     +T + VL    +      +V   
Sbjct: 565 ALAG-EEFNLGSPKQLGAILYDKLGMPVLSKTAKGQPSTAEAVLDDLAEQGYPLPKVLMQ 623

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
               S+      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 624 YRSLSKLKSTYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPVRTAEGRR- 682

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   +AS G KL+ AD + IE R++A +A ++  L
Sbjct: 683 ------------------------IRQAFVASPGYKLLAADYSQIELRIMAHLAKDEGLL 718

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            AF    D++  T A  F VA A VT DQR   K +                    G++ 
Sbjct: 719 HAFRNDLDVHRATAAEVFGVALADVTTDQRRSAKAIN--------------FGLIYGMSA 764

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
              A  +                                     +     +  ++  V  
Sbjct: 765 FGLAKQI------------------------------GVDRKQSQDYIDRYFARYPGVLA 794

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                     +                             +    GR L   D+      
Sbjct: 795 YMERTRAQAAE--------------------------QGFVETLFGRRLYLPDINAKNPA 828

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGYDIVLTVHDEIV 633
           L    +   R            +Q  + DI+   M+         K    ++L VHDE+V
Sbjct: 829 LR---KGAERTAINAP------MQGTAADIIKRAMVAVDNWLTDSKLDARVILQVHDELV 879

Query: 634 CETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E  +         +   M+        +PL  E      +
Sbjct: 880 LEVREDLVEQVKDEIRGYMSGAAE--LDVPLLVEVGVGSNW 918


>gi|53728836|ref|ZP_00134878.2| COG0749: DNA polymerase I - 3'-5' exonuclease and polymerase
           domains [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126207957|ref|YP_001053182.1| DNA polymerase I [Actinobacillus pleuropneumoniae L20]
 gi|126096749|gb|ABN73577.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 957

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 108/731 (14%), Positives = 217/731 (29%), Gaps = 192/731 (26%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVM-------- 53
             + +D ET +   ++            ++  +FG  +         H   +        
Sbjct: 356 KLVAVDTETDNLDSMS----------ANLVGVSFGLANGDACYIPLTHKEQVTLEPQQSD 405

Query: 54  --------------------------PQVLKEALENTDVTIVAHNSYFERTVLKACFNLD 87
                                        LK  LEN DV  +  N  ++ T+        
Sbjct: 406 LFAEQAEAETTTSFELAKKQLNLTACLTELKPLLENADVKKIGQNIKYDLTIFANH---G 462

Query: 88  IPIHRW-ICTLVLARSNGLP--SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD 144
           + +      T++ + +        +  + +           G + I      E       
Sbjct: 463 VQVAGVAFDTMLESYTLNSTGRHNMDELADRY--------LGHKTIEF----EEIAGKGK 510

Query: 145 RNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS-----------SKEQELWYLDQTIN 193
                 + A  +  +Y   D  VT ++ + L P               E  L  +   I 
Sbjct: 511 NQLTFDKIAIDVASKYAAEDADVTMKLHQVLVPELDKTPTLVKLFNEIEMPLVEVLSRIE 570

Query: 194 DRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED 253
             G  +D       +  ++    +L+Q + S     V +    ++L+  LF + GL +  
Sbjct: 571 RNGVLIDPEKLLAQSAEIEQRLAELEQLVHSEAG-EVFNLASTKQLQEILFTKLGLPVLK 629

Query: 254 LTE----TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMN-SDGRLRGTL 308
            T     +T + VL           ++       S+      + L   +N   GR+  + 
Sbjct: 630 KTPKGAPSTNEEVLDELAGQGHLVPKLLMEHRGLSKLKSTYTDKLPLMINQKTGRVHTSY 689

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
                + TGR S      QN+P  +                              +R   
Sbjct: 690 HQAV-TATGRLSSSDPNLQNIPIRNEEGRR-------------------------IRQAF 723

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           IA +G K+V AD + IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +Q
Sbjct: 724 IARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHCATAAEIFGLALDQVTSEQ 783

Query: 429 RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQEN 488
           R   K +   L                G++    ++                        
Sbjct: 784 RRSAKAINFGLI--------------YGMSEFGLSNQ----------------------- 806

Query: 489 HPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL 548
                          ++  + + Q++  V +   ++ ++                     
Sbjct: 807 -------LGISRADAKKYMERYFQRYPAVQQFMTDIRESA-------------------- 839

Query: 549 VYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRD 608
                      +    GR L   ++ ++ +      +   R            +Q  + D
Sbjct: 840 ------SEKGYVETLFGRRLYLPEIKSSNAMRR---KAAERVAINAP------MQGTAAD 884

Query: 609 ILAEGMMNATKA-----GYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWAKGLP 662
           I+   M++  KA        +++ VHDE+V E  +      + ++   M         +P
Sbjct: 885 IIKVAMIDIDKAIRGDDNIKMIMQVHDELVFEVKEELIEHYSQLIKAEMEKAIQ--LKVP 942

Query: 663 LKAEGYESKRY 673
           L AE      +
Sbjct: 943 LIAEVGVGDNW 953


>gi|303250265|ref|ZP_07336465.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307252030|ref|ZP_07533930.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650881|gb|EFL81037.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306860499|gb|EFM92512.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 957

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 107/730 (14%), Positives = 214/730 (29%), Gaps = 190/730 (26%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVM-------- 53
             + +D ET +   ++            ++  +FG  +         H   +        
Sbjct: 356 KLVAVDTETDNLDSMS----------ANLVGISFGLANGDACYIPLTHKEQVTLEPQQSD 405

Query: 54  --------------------------PQVLKEALENTDVTIVAHNSYFERTVLKACFNLD 87
                                        LK  LEN DV  +  N  ++ T+        
Sbjct: 406 LFAEQAEAETTTSFELAKKQLNLTACLTELKPLLENADVKKIGQNIKYDLTIFANH---G 462

Query: 88  IPIHRW-ICTLVLARSNGLP--SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD 144
           + +      T++ + +        +  + +           G + I      E       
Sbjct: 463 VQVAGVAFDTMLESYTLNSTGRHNMDELADRY--------LGHKTIEF----EEIAGKGK 510

Query: 145 RNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS-----------KEQELWYLDQTIN 193
                 + A  +  +Y   D  VT ++ + L P               E  L  +   I 
Sbjct: 511 NQLTFDKIAIDIASQYAAEDADVTMKLHQVLSPELEKAPTLVKLFNEIEMPLVEVLSRIE 570

Query: 194 DRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED 253
             G  +D       +  ++    +L+Q + S     V +    ++L+  LF + GL +  
Sbjct: 571 RNGVLIDPEKLLAQSAEIEQRLAELEQLVHSEAG-EVFNLASTKQLQEILFTKLGLPVLK 629

Query: 254 LTE----TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQ 309
            T     +T + VL           ++       S+      + L   +N       T  
Sbjct: 630 KTPKGAPSTNEEVLDELAGQGHLVPKLLMEHRGLSKLKSTYTDKLPLMINPKTGRVHTSY 689

Query: 310 FLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVI 369
               + TGR S      QN+P  +                              +R   I
Sbjct: 690 HQAVTATGRLSSSDPNLQNIPIRNEEGRR-------------------------IRQAFI 724

Query: 370 ASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQR 429
           A++G K+V AD + IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR
Sbjct: 725 ANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQR 784

Query: 430 AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH 489
              K +   L                G++    ++                         
Sbjct: 785 RSAKAINFGLI--------------YGMSEFGLSNQ------------------------ 806

Query: 490 PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLV 549
                         ++  + + Q++  V +   ++ ++                      
Sbjct: 807 ------LGISRADAKKYMERYFQRYPAVQQFMTDIRESA--------------------- 839

Query: 550 YMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDI 609
                     +    GR L   ++ ++ +      +   R            +Q  + DI
Sbjct: 840 -----SKKGYVETLFGRRLYLPEIKSSNAMRR---KAAERVAINAP------MQGTAADI 885

Query: 610 LAEGMMNATKA-----GYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWAKGLPL 663
           +   M+   KA        +++ VHDE+V E  +      + ++   M         +PL
Sbjct: 886 IKVAMIGIDKAIRGDENIKMIMQVHDELVFEVKEELIEHYSQLIKAEMEKAIQ--LKVPL 943

Query: 664 KAEGYESKRY 673
            AE      +
Sbjct: 944 IAEVGVGDNW 953


>gi|300925951|ref|ZP_07141783.1| DNA-directed DNA polymerase [Escherichia coli MS 182-1]
 gi|300417979|gb|EFK01290.1| DNA-directed DNA polymerase [Escherichia coli MS 182-1]
          Length = 928

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGPAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|307823067|ref|ZP_07653297.1| DNA polymerase I [Methylobacter tundripaludum SV96]
 gi|307735842|gb|EFO06689.1| DNA polymerase I [Methylobacter tundripaludum SV96]
          Length = 930

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 106/705 (15%), Positives = 205/705 (29%), Gaps = 169/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S           Y++   ++  +F             HD            + 
Sbjct: 355 AFDTETTSLD---------YSK-AQIVGVSFAVTPGKAAYVPLAHDYPGVPDQLDRSEIL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
           + L+  LEN     +  N  ++  VL     + +       T++ +           +  
Sbjct: 405 EKLRPLLENPRKAKLGQNLKYDTHVLANH-GIALRGIA-HDTMLESYVLNSTATKHNMDD 462

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + +           G E I      E       +       +      Y   D  +T ++
Sbjct: 463 LAKEY--------LGVETIHY----EDVAGKGAKQIGFQEVSIDQAAPYAAEDADITLQL 510

Query: 172 FKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L                 E  L  +   I + G  +D A+    +  +  +   L+Q
Sbjct: 511 HQVLNAKLAQHPRLLELYSDMEVPLISVLARIENNGVLIDAAMLAQQSLELSSQIISLEQ 570

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQV 276
               L      +    ++++  L+ +  L           +T + VL       P    +
Sbjct: 571 HAHDLAGQT-FNLGSPKQIQDILYDQQKLPVLKKTPKGQPSTEESVLQELALDYPLPKLI 629

Query: 277 FNNRMRASRSAVLKLNTLVEAMN-SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
              R   S+      + L + ++   GR+  +     A+ TGR S      QN+P  S  
Sbjct: 630 LEYR-SLSKLKSTYTDKLPQQIDGQTGRIHTSYHQAIAA-TGRLSSSDPNLQNIPIRSEE 687

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
             +                         +R   IA EGKK+V AD + IE R++A ++ +
Sbjct: 688 GRK-------------------------IRQAFIAPEGKKIVAADYSQIELRIMAHLSAD 722

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  LKAF   +D++  T A  F VAP QVT D R   K +                    
Sbjct: 723 EGLLKAFSEEQDVHRATAAEVFGVAPEQVTTDLRRSAKAINF--------------GLIY 768

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++    A                                     +  +     +  ++ 
Sbjct: 769 GMSSFGLAQQ------------------------------LGLSRSQAQSYIDLYFARYP 798

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V    + + +   +                             +    GR L   ++ +
Sbjct: 799 GVKNYMDRIREQARE--------------------------QGYIETLFGRRLYLPEINS 832

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN----ATKA--GYDIVLTVH 629
             +          R            +Q  + DI+   M+       K      +++ VH
Sbjct: 833 RNAARRQY---AERTAINAP------MQGTAADIIKRAMIAADQWLYKEQPDAKMIMQVH 883

Query: 630 DEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +    + A+ +  +M +       +PL  +      +
Sbjct: 884 DELVFEIAEEHVDDCAAKIRSIMCAAAD--LDVPLIVDIGIGNNW 926


>gi|117618452|ref|YP_854729.1| DNA polymerase I [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559859|gb|ABK36807.1| DNA polymerase I [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 917

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 111/706 (15%), Positives = 208/706 (29%), Gaps = 170/706 (24%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDP----------VMP 54
             D ET S           Y E   V+  +F  +          HD           V+ 
Sbjct: 341 AFDTETTSLD---------YME-ARVVGVSFAIEPGKAAYVPFGHDYLGAPVQLTEAVVL 390

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA---LKA 111
             LK  LE+     V  N  ++R VL     +++    +  T++ +      ++   + +
Sbjct: 391 GKLKPLLEDPARLKVGQNLKYDRNVLLNH-GIELQGIAY-DTMLESYVLNSTASRHDMDS 448

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +                L A     E       +    ++        Y   D  +T  +
Sbjct: 449 LARRY------------LNAETISFEEIAGKGVKQLTFNQIELEQAAPYAAEDADITLRL 496

Query: 172 FKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L                 E  L  +   +   G  ++  L H  +Q ++V   +L++
Sbjct: 497 HQALWGKLSAEPGLAKVFSEIELPLLPVLARMERLGTTIEPKLLHQQSQEIEVRLAELEK 556

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   L      +    ++L   LF + GL +   T     +T + VL+   +       +
Sbjct: 557 QAHELAGQ-EFNLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYELPQ-L 614

Query: 277 FNNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
                  ++      + L   +    GR+  +     A+ TGR S      QN+P  +  
Sbjct: 615 LMEHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVAA-TGRLSSTDPNLQNIPVRNEQ 673

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   I   G KLV AD + IE R++A ++G+
Sbjct: 674 GRR-------------------------IRQAFIPCAGYKLVAADYSQIELRIMAHLSGD 708

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  L AF  G+D++  T A  F VA   VT D R   K +                    
Sbjct: 709 KGLLTAFAEGKDIHKATAAEVFGVALEAVTSDMRRSAKAINF--------------GLIY 754

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        ++    + +++ 
Sbjct: 755 GMS------------------------------AFGLAKQLGIGRAEAQKYMDLYFERYP 784

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V E      Q                                 +    GR L   D+ +
Sbjct: 785 GVLEYMERTRQQA--------------------------DAQGYVETLFGRRLYLPDIKS 818

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN-------ATKAGYDIVLTV 628
             + L    +   R            +Q  + DI+   M+N              +++ V
Sbjct: 819 RNAGLR---KAAERAAINAP------MQGTAADIIKRAMINVDGWIRGIEDQSIRMLMQV 869

Query: 629 HDEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E  +       +++   M++       +PL  E      +
Sbjct: 870 HDELVFEIREEKLEEYIAIIKEKMSAAAE--LDVPLVVEAGTGDNW 913


>gi|84685270|ref|ZP_01013168.1| DNA polymerase I [Maritimibacter alkaliphilus HTCC2654]
 gi|84666427|gb|EAQ12899.1| DNA polymerase I [Rhodobacterales bacterium HTCC2654]
          Length = 932

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 99/715 (13%), Positives = 200/715 (27%), Gaps = 176/715 (24%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD------------ 50
            + +D ET S  ++                                H             
Sbjct: 346 YVAVDTETTSLNEM----------QAEFAGICLAVVPGEACYIPVGHKVGDGEGLFADDK 395

Query: 51  --------PVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARS 102
                     +   LK  LE+  +  +  N+ ++  +        + +     T++++ +
Sbjct: 396 LAEGQLSLDDVLAALKPVLEDPAILKIFQNAKYDTKIFSRH---GLNVAPIDDTMLMSYA 452

Query: 103 NGLP---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGE 159
                    +  + E           G   I+     +T            +       +
Sbjct: 453 MFSGLHNHGMDTLSEHY--------LGHTPISI----KTLLGTGKSAITFDKVKIEDAVK 500

Query: 160 YCKGDVTVTREIFKRLEPLSSKE----------QELWYLDQTINDRGYCVDVALAHTLNQ 209
           Y   D  VT  +++  +P   +E          + L  +   +   G  VD      ++ 
Sbjct: 501 YAAEDADVTLRLWQLFKPRLHREKVTTVYETLERPLVPVLAQMEMHGVQVDRDTLSRMSN 560

Query: 210 IVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSS 265
               +   L+ E+  L      +    ++L   LF + GL      +T    T   VL  
Sbjct: 561 AFAQKMAGLEAEIHELAGQS-FNVGSPKQLGEILFDKLGLEGGKKGKTGAYATGADVLED 619

Query: 266 NKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFP 325
                    +V + R   S+      + L   ++ D     T      + TGR +     
Sbjct: 620 LAAQHDLPARVLDWRQ-LSKLKSTYTDALQTHIDPDTGRVHTSYLQTGASTGRLASTDPN 678

Query: 326 PQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIE 385
            QN+P  +                              +R   +A EGK LV  D + IE
Sbjct: 679 LQNIPIRTEEGRR-------------------------IREAFVAPEGKVLVSLDYSQIE 713

Query: 386 ARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGA 445
            R+LA +AG +   +AF  GED++  T +  F+V   ++T D R   K +          
Sbjct: 714 LRILAHVAGIESMKQAFRDGEDIHAATASEMFDVPLDEMTPDVRRQAKAINF-------- 765

Query: 446 KAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACER 505
                     G++                                  A          + 
Sbjct: 766 ------GVIYGIS------------------------------GFGLARNLRIARGEAQG 789

Query: 506 VKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSG 565
               + +K+  + E  ++     ++                          +  +    G
Sbjct: 790 FIDRYFEKYPGIKEYMDDTVAFAKE--------------------------HGHVATLFG 823

Query: 566 RSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY--- 622
           R +   ++               R            +Q  + DI+   M+    A     
Sbjct: 824 RKIHTPEINAK----GPHAGFARRAAINAP------IQGSAADIIRRAMIRMPDAISGLP 873

Query: 623 -DIVLTVHDEIVCETPD-TDEFNASMLYHLMTSN--PSWAKGLPLKAEGYESKRY 673
             ++L VHDE++ E  +   +   S++  +M     P+    +PL  +  +   +
Sbjct: 874 VKMLLQVHDELIFEVEEGGVDKAVSVIRDVMEGAADPAVKLDIPLVVDAGQGANW 928


>gi|273810426|ref|YP_003344897.1| DNA polymerase A [Xylella phage Xfas53]
 gi|257097801|gb|ACV41107.1| DNA polymerase A [Xylella phage Xfas53]
          Length = 726

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 275/726 (37%), Positives = 365/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+     PV++WDC     MP+ L  AL 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGGGPVQVWDCTATATMPEELSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           N  V +  HNS+F+RTVL     + IP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F EY + DVT  R++ KRL   +
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHN 187

Query: 180 SKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   +
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L    G+ L D+ + T +R L  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLHHLSTAHGVALPDMQQHTVERCL-DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +          D
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGTW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  VTK QR IGKV 
Sbjct: 427 HSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   ++A     W + NH      
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMAAQAAL--PPLLLQEATELLEWTKANHRPTFGL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + ++  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETA-----HTCCGITVQYSR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+E
Sbjct: 660 LAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFE 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 THRYRK 725


>gi|149378378|ref|ZP_01896080.1| DNA polymerase I [Marinobacter algicola DG893]
 gi|149357343|gb|EDM45863.1| DNA polymerase I [Marinobacter algicola DG893]
          Length = 911

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 107/705 (15%), Positives = 210/705 (29%), Gaps = 168/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S          +Y  D  V+  +F  +          HD            + 
Sbjct: 335 AFDTETTSL---------RYM-DADVVGVSFAIEPGEAAYVPFGHDYMGAPEQLDRDTVL 384

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA---LKA 111
             LK  LE+     +  N  +++ VL     +++       T++ +       +   + +
Sbjct: 385 SQLKPLLEDPKKAKLGQNLKYDKNVLANH-GINLNGIA-EDTMLESYVLNSVGSRHDMDS 442

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +             G++ I      E+      +    ++      G Y   D  +T  +
Sbjct: 443 LAMQY--------LGEQTITF----ESIAGKGAKQLTFNQIELEQAGPYAAEDADITLRL 490

Query: 172 FKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P               +  L  +   +  RG  +  +     +Q +     +L++
Sbjct: 491 HQALRPQLEKTGRLQEVYEKIDLPLVPVLSRMEQRGAMISASTLRKHSQELAERMAELEK 550

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           E          +    ++L+   + + GL +   T     +T + VL            +
Sbjct: 551 EAHEEAG-ESFNLGSPKQLQAIFYDKMGLPVVKKTPKGAPSTAEPVLQELAHEHTLPRLI 609

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             +R   S+      +TL E ++       T      + TGR S      QN+P  S   
Sbjct: 610 LEHR-SLSKLKSTYTDTLPELIHHRTGRIHTSYHQAVTATGRLSSSEPNLQNIPIRSEQG 668

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   +A EG KLV AD + IE R++A ++G++
Sbjct: 669 RR-------------------------IRQAFVAPEGYKLVAADYSQIELRIMAHLSGDK 703

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AFE GED++  T A  F VA   V+ DQR   K +                    G
Sbjct: 704 GLLTAFEKGEDIHRATAAEVFGVAVDDVSGDQRRSAKAINF--------------GLIYG 749

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++    +  +                                     +     + +++  
Sbjct: 750 MSAFGLSRQLD------------------------------VGRHQAQEYIDRYFERYPA 779

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V +  + + +                              +  +    GR L   ++   
Sbjct: 780 VLKYMDNIRKQAHD--------------------------DGYVETFYGRRLYLPEINAR 813

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA-------TKAGYDIVLTVH 629
              +        R            +Q  + DI+   M++         +    ++L VH
Sbjct: 814 NKQMQQA---AERTAINAP------MQGTAADIIKRAMVSVEDWLQEHHQDDARMILQVH 864

Query: 630 DEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE++ E  ++        L   M++  S    +PL  E      +
Sbjct: 865 DELILEVRESAVDTIREGLEKRMSAAAS--LDVPLLVEAGVGNNW 907


>gi|89092190|ref|ZP_01165144.1| DNA polymerase I [Oceanospirillum sp. MED92]
 gi|89083278|gb|EAR62496.1| DNA polymerase I [Oceanospirillum sp. MED92]
          Length = 922

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 104/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S           Y E   ++  +F  +          HD            + 
Sbjct: 347 AFDTETTSLN---------YME-AELVGVSFAIEPGKAAYVPVAHDYMGAPEQITRETLL 396

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
           + +K  LE++D   V  +  ++  VL     +++       T++ +           + +
Sbjct: 397 EKMKPLLESSDHKKVGQHLKYDMNVLARY-GIELTGIE-FDTMLESYVLNSTATRHDMDS 454

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + +              L  +  K E       +    ++        Y   D  +T  +
Sbjct: 455 LADRY------------LGLKTIKFEDIAGKGKKQLTFNQIELEQAAPYAAEDADITLRL 502

Query: 172 FKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + +                 E+ L  +   I   G  VD ++    +  +     +L++
Sbjct: 503 HQAINAQLSKDETLTSVFNDIERPLIPVLSHIERNGALVDASMLGEQSIELAERMVELER 562

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+  LF E  + +   T     +T + VL       P    +
Sbjct: 563 QAYDIAG-KEFNLASPKQLQQILFEELSIPVIKKTPKGAPSTAEEVLQELALDYPLPKLI 621

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             +R   S+      + L   +N       T      + TGR S      QN+P  ++  
Sbjct: 622 LEHR-SLSKLKSTYTDKLPLMINPGTGRIHTSYHQAVTATGRLSSTDPNLQNIPVRTQEG 680

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA EG K+V AD + IE R++A ++ +Q
Sbjct: 681 RR-------------------------IRHAFIAPEGYKVVAADYSQIELRIMAHLSQDQ 715

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G D++  T A  F V   QV+ DQR   K +                    G
Sbjct: 716 GLLDAFSKGADIHRATAAEVFKVELDQVSDDQRRSAKAINF--------------GLIYG 761

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +         +  + + + +  
Sbjct: 762 MS------------------------------AFGLAKQLGIARKDAAQYIEHYFETYPG 791

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V    +++    ++                             +    GR L   ++   
Sbjct: 792 VQHYMDDIRAKAQE--------------------------QGYVETLFGRRLYLPEIKAR 825

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY------DIVLTVHD 630
            +          R            +Q  + DI+   M+   K          +++ VHD
Sbjct: 826 NAMRRQA---AERTAINAP------MQGTAADIIKRAMVTVDKWLAESDFDVRMIMQVHD 876

Query: 631 EIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E  DT   +    +   M +       +PL  E    + +
Sbjct: 877 ELVFEVRDTQVDSFVEAVKDKMATAAD--LDVPLLVEAGVGENW 918


>gi|224823577|ref|ZP_03696686.1| DNA polymerase I [Lutiella nitroferrum 2002]
 gi|224604032|gb|EEG10206.1| DNA polymerase I [Lutiella nitroferrum 2002]
          Length = 887

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 104/705 (14%), Positives = 201/705 (28%), Gaps = 166/705 (23%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH-----DPVM---- 53
            + +D ET S   +          +  ++  +F   +         H        +    
Sbjct: 311 VVSLDTETTSLDQM----------EARLVGISFSVTEGEAAYLPLAHHYAGVPEQLDLAA 360

Query: 54  -PQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SALK 110
               LK  LEN     +  N  ++R VL     + +       TL+ +          + 
Sbjct: 361 TLARLKPWLENPARKKLGQNLKYDRHVLANH-GIALAGVA-DDTLLASYVIESHLTHNMD 418

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
            +             G+  ++     E       +          +   Y   D  +T  
Sbjct: 419 DLARRH--------LGESTVSY----EEICGKGAKQIGFAEVDIAVASNYAAEDADITLR 466

Query: 171 IFKRLEPLSS---------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           + + L               E  +  +   +   G  +D       +  +  +  +L+QE
Sbjct: 467 LNRALAGKLEGRLASVYRDIELPVAEVLFAMERNGVLIDRQRLAEQSHQLGSQMLQLEQE 526

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLE--DLTET----TCQRVLSSNKKLTPQAIQ 275
                     +    ++L+  LF + G+  +    T +    T + VL       P    
Sbjct: 527 AYQQAGQP-FNLNSPKQLQEILFGKLGIDTKGVKKTPSGGFSTDESVLEQLALDHPLPKL 585

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           +   R   ++      + L   +  D     T      + TGR S      QN+P  +  
Sbjct: 586 ILQYR-GLAKLKSTYTDKLPSLIRPDTGRVHTNYAQAVAITGRLSSSDPNLQNIPVRTAE 644

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       VR   IA  G ++V AD + IE R++A ++ +
Sbjct: 645 GRR-------------------------VREAFIAPPGHRIVSADYSQIELRIMAHLSDD 679

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
              L AF +GED++ TT A  F V   QVT +QR   K +   L                
Sbjct: 680 ANMLAAFASGEDIHKTTAAEVFGVTREQVTSEQRRAAKAINFGLI--------------Y 725

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++    A  +                                   A ++    +  +  
Sbjct: 726 GMSAFGLAAQLDIE------------------------------RNAAQQYIDRYFMRFP 755

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V++      +   +                             +    GR L   ++  
Sbjct: 756 GVADYMQRTREMARE--------------------------QGYVETVFGRRLYLPEIRA 789

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVH 629
           +     +      R            +Q  + D++   M+   +       G  +++ VH
Sbjct: 790 SNPGRRS---GAERAAINAP------MQGTAADLIKLAMIAVQRWLVAEGLGSKLIMQVH 840

Query: 630 DEIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E P+ +       L  +M         +PL AE    + +
Sbjct: 841 DELVLEVPEAELARVKERLPQIMAGVAE--LKVPLLAEVGAGESW 883


>gi|89074464|ref|ZP_01160941.1| DNA polymerase I [Photobacterium sp. SKA34]
 gi|89049752|gb|EAR55302.1| DNA polymerase I [Photobacterium sp. SKA34]
          Length = 923

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 97/705 (13%), Positives = 198/705 (28%), Gaps = 168/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET     +T            V+  +F  ++         HD            + 
Sbjct: 347 AFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPLAHDYLDAPAQLDRDWVL 396

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           + LK  LE+     +  N  F+ +++     +++       T++ +           + +
Sbjct: 397 EQLKPLLEDPKQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHDMDS 454

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +                L  +    E       +    ++      G Y   D  +T  +
Sbjct: 455 LALRY------------LEHKNISFEEVAGKGKKQLTFNQIDLEQAGPYAAEDADITLRL 502

Query: 172 FKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
              L P               E  L  +   +   G  VD  L    +  + V   ++++
Sbjct: 503 HNTLYPKVEADDKLKHVFENIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAVRLDEIEK 562

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+  LF + GL         T +T + VL       P    +
Sbjct: 563 KAFEI-AEQEFNLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDYPLPKLL 621

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L + +N       T      + TGR S      QN+P  +   
Sbjct: 622 LEYR-GLAKLKSTYTDKLPKMVNPATGRVHTSYHQAVTATGRLSSSDPNLQNIPVRNEEG 680

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   +A  G K++  D + IE R++A ++G++
Sbjct: 681 RR-------------------------IRQAFVAQSGYKILAVDYSQIELRIMAHLSGDK 715

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A   ++    V+ +QR   K +                    G
Sbjct: 716 ALLDAFRHGKDIHAATAAEILSLDIENVSSEQRRRAKAINF--------------GLIYG 761

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++    A  +                                     +     + +++  
Sbjct: 762 MSAFGLAKQLDM------------------------------GRNEAQNYMNVYFERYPG 791

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E       A                                +    GR L   D+ + 
Sbjct: 792 VLEYMESTRNAA--------------------------SEQGYVETLFGRRLYLPDIKSR 825

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT-------KAGYDIVLTVH 629
                   +   R            +Q  + DI+   M+          +    +++ VH
Sbjct: 826 NGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDDWVQQQPEGDVRLLMQVH 876

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  ++      + +  LM         +PL A+      +
Sbjct: 877 DELVFEVKESALEAVTASVKALMEQAA--MLDVPLIADTGYGDNW 919


>gi|319792363|ref|YP_004154003.1| DNA polymerase i [Variovorax paradoxus EPS]
 gi|315594826|gb|ADU35892.1| DNA polymerase I [Variovorax paradoxus EPS]
          Length = 937

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 110/704 (15%), Positives = 208/704 (29%), Gaps = 167/704 (23%)

Query: 6   IDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMPQ 55
           ID ET S  ++             ++  +F  +          H+            +  
Sbjct: 365 IDTETTSLDEMV----------AQIVGVSFSVEPGEAAYIPLTHNYPDAPAQLPIDEVLA 414

Query: 56  VLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL--PSALKAVG 113
            LK  LEN +   +  +  ++R V      +++  +    T++ +    +  P  L ++ 
Sbjct: 415 KLKPWLENPEKKKLGQHIKYDRHVFANH-GIEVEGYA-HDTMLQSYVLEVHKPHGLASLA 472

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
           E              L       E             +       EY   D   T ++ +
Sbjct: 473 ERH------------LGRSGISYEDLCGKGAHQISFSQVDIAKAAEYSCEDSDQTLDVHR 520

Query: 174 RLEPLSSKEQELWYLDQ----------TINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            L P     ++L ++ Q           +   G  +D A     +  +      L+QE  
Sbjct: 521 TLWPQLEANEKLRFVYQLEMDSSEALYRVERNGVMIDSATLAAQSHELGTRIMALEQEAY 580

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKKLTPQAIQVFNN 279
            +      +    +++    F + GL +   T +    T + VL    +  P   ++  +
Sbjct: 581 EIAGQP-FNLGSPKQIGEIFFTKLGLPVVKKTPSGAPSTDEEVLEKLAEDYPLPAKILEH 639

Query: 280 RMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
           R   S+      + L +  N   GR+        A  TGR S      QN+P  +     
Sbjct: 640 R-GLSKLKGTYTDKLGQLANPRTGRVHTHYAQAVA-VTGRLSSNDPNLQNIPIRTPEGRR 697

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    VR   +A  G  +  AD + IE R++A ++G++  
Sbjct: 698 -------------------------VREAFVAPAGSVIASADYSQIELRIMAHISGDESL 732

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AF  G D++  T A  F   P QV+ +QR   KV+                    G++
Sbjct: 733 LRAFTEGIDVHRATAAEVFGSTPDQVSSEQRRYAKVIN--------------FGLIYGMS 778

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A        A     + +  ++  V 
Sbjct: 779 SFGL------------------------------AKNLGIETKAAASYIERYFARYPGVK 808

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
              +E     ++                             +    GR L   ++ +   
Sbjct: 809 AYMDETKALAKE--------------------------QGYVETVFGRRLYLPEINSPNG 842

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA------TKAGYDIVLTVHDEI 632
                     R            +Q  + D++   M+         K    +++ VHDE+
Sbjct: 843 PRRG---GAERAAINAP------MQGTAADLIKLSMVKVQNVLDEEKRATKMIMQVHDEL 893

Query: 633 VCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +     + +  LM      A  +PL AE      + K
Sbjct: 894 VFEVPEAEVEWVRAEIPRLMAGVA--ALKVPLLAEIGIGPNWDK 935


>gi|24115152|ref|NP_709662.1| DNA polymerase I [Shigella flexneri 2a str. 301]
 gi|24054427|gb|AAN45369.1| DNA polymerase I, 3 --> 5 polymerase, 5 --> 3 and 3 --> 5
           exonuclease [Shigella flexneri 2a str. 301]
          Length = 928

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y      VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEHADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------LGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|256823707|ref|YP_003147670.1| DNA polymerase I [Kangiella koreensis DSM 16069]
 gi|256797246|gb|ACV27902.1| DNA polymerase I [Kangiella koreensis DSM 16069]
          Length = 915

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 110/702 (15%), Positives = 209/702 (29%), Gaps = 164/702 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVMP 54
             D ET S   +          +  ++  +F  D+         H             + 
Sbjct: 341 AFDTETTSLNYI----------EAELVGMSFALDNGEAAYLPVAHSYMGAPEQLERDEVL 390

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRW-ICTLVLARSNGLPSALKAVG 113
           + LK  LE+     V  N  ++ +VL      DI +      T++ +      ++     
Sbjct: 391 KQLKPLLESEKHKKVGQNLKYDMSVLANY---DIELAGIEFDTMLESYCLNSVAS----- 442

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
              +     +     L     K E             +        Y   D  +T  + +
Sbjct: 443 ---RHDMDTLAL-HHLNHVNIKFEEIAGKGKNQLTFDQIEVEQAAPYASEDADITMRLHQ 498

Query: 174 RLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           +L P   +              L  +   +   G  VD  L    + + +    +L++E 
Sbjct: 499 KLWPELKQNEGPTQIFQHIEMPLLRILSKVERNGVLVDGKLLLEKSHLFEKRLKELEKEA 558

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQVFN 278
             +      +    ++L+   + E GL           +T + VL       P    +  
Sbjct: 559 YEIAG-KEFNLGSPKQLQVIFYEELGLPILKKTPKGQPSTAEEVLQELALDYPLPKLILE 617

Query: 279 NRMRASRSAVLKLNTLVEAM-NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE 337
           +R   S+      + L   + +  GR+  +     A+ TGR S      QN+P  +    
Sbjct: 618 HR-GLSKLKSTYTDKLPRMISDKTGRVHTSYHQAIAA-TGRLSSTEPNLQNIPIKTEEGR 675

Query: 338 ELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
                                     +R+  IA +G K++ AD + IE R++A ++ ++ 
Sbjct: 676 -------------------------SIRTAFIAPKGSKILAADYSQIELRIMAHLSQDEG 710

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
            LKAFE G D++  T A  F+V   +VT +QR   K +   L Y              G+
Sbjct: 711 LLKAFEEGLDVHSATAAEVFDVPLDEVTSNQRRNAKAINFGLIY--------------GM 756

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
           +    A  + T+                                  +     +  ++  V
Sbjct: 757 SAFGLAKQIDTD------------------------------RNTAQDYINTYFARYPGV 786

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR 577
                   +                             +   +    GR L   ++ +  
Sbjct: 787 ETYMESTKEKA--------------------------ADLGYVETLYGRRLYLPEIHSKN 820

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-----AGYDIVLTVHDEI 632
                  +   R            +Q  + DI+   M+   K      G  +++ VHDE+
Sbjct: 821 GMRR---KAAERTAINAP------MQGSAADIIKLAMLEVDKWLKDVKGIKMIMQVHDEL 871

Query: 633 VCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  +     A   +  LM S       +PL A+      +
Sbjct: 872 VFEVEEDKLELAQKEIPKLMQSVAE--LSVPLIADVGVGDNW 911


>gi|251793585|ref|YP_003008314.1| DNA polymerase I [Aggregatibacter aphrophilus NJ8700]
 gi|247534981|gb|ACS98227.1| DNA polymerase I (POL I) [Aggregatibacter aphrophilus NJ8700]
          Length = 985

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 98/705 (13%), Positives = 203/705 (28%), Gaps = 165/705 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCV----------HDP 51
             + +D ET     ++            ++  +F  ++                      
Sbjct: 409 KLIAVDTETDGLDYMS----------ANLVGVSFALENGEAAYLPLHLDYLGAPKTLEKS 458

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SAL 109
                LK  LEN ++  V  N  F+ T+      +++       T++L+ +        +
Sbjct: 459 TALAALKPILENPNIGKVGQNLKFDMTIFARN-GIELRGIE-FDTMLLSYTLDSTGRHNM 516

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
             + +           G + I      E            ++      GEY   D  VT 
Sbjct: 517 DDLAKRY--------LGHQTIGF----EDIAGKGKNQLTFNQIPLEQAGEYAAEDADVTM 564

Query: 170 EIFKRLEPLSSKEQELWYLDQ-----------TINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L      +  L  L Q            +   G  +D       +  +    T L
Sbjct: 565 KLQQVLWEKLKSQPSLVELYQSIELPLLGVLSRMERCGVLIDSDALFLQSNEITERLTAL 624

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAI 274
           + +   L      +    ++L+  LF + GL           +T + VL           
Sbjct: 625 EMQAHELAGQP-FNLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELAYSHELPK 683

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
            +  +R   S+      + L + +N       T      + TGR S      QN+P  + 
Sbjct: 684 VLVEHR-GLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNE 742

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA +G K++ AD + IE R++A ++ 
Sbjct: 743 EGRR-------------------------IRQAFIARDGYKIIAADYSQIELRIMAHLSN 777

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           +   + AF  G+D++ +T A  F +   QVT +QR   K +                   
Sbjct: 778 DAGLINAFAQGKDIHRSTAAELFGLPLEQVTSEQRRNAKAINF--------------GLI 823

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++    +                                        +R    + Q++
Sbjct: 824 YGMSSFGLSRQ------------------------------LGISRADAQRYMDLYFQRY 853

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V    +++ +  +                              +    GR L   ++ 
Sbjct: 854 PGVQTFMHDIREKAK--------------------------AQGYVETLFGRRLYLPEIN 887

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA-----GYDIVLTVH 629
           ++ +      +   R            +Q  + DI+   M+   +         +++ VH
Sbjct: 888 SSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEITRDDPDIHMIMQVH 938

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E           ++   M +       +PL  +    + +
Sbjct: 939 DELVFEVRSEKIAFFSDLIKQHMEAAAELV--VPLIVDVGVGENW 981


>gi|71905805|ref|YP_283392.1| DNA polymerase A [Dechloromonas aromatica RCB]
 gi|71845426|gb|AAZ44922.1| DNA polymerase A [Dechloromonas aromatica RCB]
          Length = 906

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 110/704 (15%), Positives = 199/704 (28%), Gaps = 168/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH----------DPVMP 54
            +D ET S                 ++  +              H             + 
Sbjct: 332 ALDTETTSLDSFA----------ARIVGISLSVTPGEACYIPLAHTAPGVADQLPREEVL 381

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSN--GLPSALKAV 112
             LK  LE+     V  N+ +++ V      + +       T++ +          L  +
Sbjct: 382 ARLKSWLESAAHKKVLQNAKYDQHVFANH-GIALSGIA-HDTMLQSYVIESDKGHDLGQL 439

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
                        G   IA     E       +     +        Y   D  VT  + 
Sbjct: 440 CTRH--------LGLATIAY----EDLCGKGAKQITFDQVDIERAATYAAEDSDVTLRVH 487

Query: 173 KRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
             L P               E     +   I   G  +D  +    +  +  +   L+ +
Sbjct: 488 NVLHPQFASEPGLSRIYHEIEMPARQVIWQIERNGILIDSDVLSRQSHEMGQKIMALEAQ 547

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKKLTPQAIQVF 277
              L      +    ++L   LF + GL ++  T +    T + VLS      P    + 
Sbjct: 548 AYELAGQP-FNLASPKQLADILFEKQGLPVKKKTPSGGPSTDEEVLSELALDYPLPKLLL 606

Query: 278 NNRMRASRSAVLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
            +R   S+      + L   +N   GR+        A  TGR +      QN+P  S   
Sbjct: 607 EHR-SLSKLKGTYTDKLPRMVNPQTGRVHTHFSQA-AVVTGRLASSDPNLQNIPVRSEEG 664

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
            +                         +R+  IA  G  +V AD + IE R++A ++G++
Sbjct: 665 RK-------------------------IRTAFIAPAGSSIVSADYSQIELRIMAHLSGDE 699

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  GED++  T    F V P +V  DQR + K +                    G
Sbjct: 700 RLLDAFAHGEDVHKATAGEIFGVTPLEVGPDQRRVAKSINF--------------GLIYG 745

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +     +A +     +  ++  
Sbjct: 746 MS------------------------------AFGLARQLGLERSAAQTYIDRYFARYPG 775

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V+    E  ++  Q                          +  +    GR L + D+ ++
Sbjct: 776 VARYMEEARESARQ--------------------------HGYVETAFGRRLWFPDIRSS 809

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHD 630
                       R            +Q  + D++   M+              ++L VHD
Sbjct: 810 NGNRRQ---GAERAAINAP------MQGTAADLIKLAMIAVQNWLEKSALKSRLILQVHD 860

Query: 631 EIVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E++ E PD +  +    L  LM         +PL  E      +
Sbjct: 861 ELLLEVPDGELMDVRTHLPRLMGQVAE--LKVPLVVEVGVGPNW 902


>gi|284923965|emb|CBG37064.1| DNA polymerase I [Escherichia coli 042]
          Length = 928

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 101/704 (14%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDNIS----------ANLVGLSFAIEPSVAAYIPVAHDYLDAPDQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 460

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 461 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 508

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 509 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 568

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 569 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 627

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 628 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 686

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   I  E   +V AD + IE R++A ++ ++
Sbjct: 687 RR-------------------------IRQAFIGPEDYVIVSADYSQIELRIMAHLSRDK 721

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 722 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 767

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 768 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 797

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 798 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 831

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 832 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 882

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 883 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|311281673|ref|YP_003943904.1| DNA polymerase I [Enterobacter cloacae SCF1]
 gi|308750868|gb|ADO50620.1| DNA polymerase I [Enterobacter cloacae SCF1]
          Length = 928

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 102/701 (14%), Positives = 205/701 (29%), Gaps = 161/701 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +              ++  +F  +          HD              
Sbjct: 353 AFDTETDSLDN----------HSANMVGLSFACEPGVAAYVPVAHDYIGAPEQISRERAL 402

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
           ++LK  LE+     V  N  ++R +L     +++    W  T++ + +    +       
Sbjct: 403 ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAW-DTMLESYTLDSVAG------ 454

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKR 174
             +     + E + L  +    E            ++      G Y   D  VT ++  +
Sbjct: 455 --RHDMDSLSE-RWLKHKTITFEEIAGKGKNQLTFNQIDLEQAGRYAAEDADVTLQLHLK 511

Query: 175 LEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           + P   K              L  +   I   G  +D  +    ++ + +   +L+Q+  
Sbjct: 512 MWPKLQKREGPLNVFRNIEMPLVPVLSRIERNGVKIDPQVLQKHSEEITLRLAELEQKAH 571

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNN 279
            +      +    ++L+T LF + G+     T     +T + VL       P    +   
Sbjct: 572 DIAG-EPFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEY 630

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R   ++      + L   +N       T      + TGR S      QN+P  +      
Sbjct: 631 R-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRR- 688

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                                   +R   IA E   +V AD + IE R++A ++ ++  L
Sbjct: 689 ------------------------IRQAFIAPEDYLIVSADYSQIELRIMAHLSRDKGLL 724

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           KAF  G+D++  T A  F +    V+ +QR   K +                    G++ 
Sbjct: 725 KAFAEGKDIHRATAAEVFGLPLESVSAEQRRSAKAINF--------------GLIYGMS- 769

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                            + +        ++    + +++  V E
Sbjct: 770 -----------------------------AFGLSRQLNIPRKESQKYMDLYFERYPGVLE 800

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSY 579
                    ++                             +    GR L   D+ ++ + 
Sbjct: 801 YMERTRAQAKE--------------------------QGYVETLEGRRLYLPDIKSSNAA 834

Query: 580 LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHDEIV 633
                 +               +Q  + DI+   M+              +++ VHDE+V
Sbjct: 835 RRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQEEQPRVRMIMQVHDELV 885

Query: 634 CETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
            E            ++ LM S+   A  +PL  E      +
Sbjct: 886 FEVHKDALDAVSKKIHELMESSM--ALDVPLLVEVGSGDNW 924


>gi|68249450|ref|YP_248562.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
 gi|68057649|gb|AAX87902.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
          Length = 930

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 102/705 (14%), Positives = 209/705 (29%), Gaps = 165/705 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDC----------VHDP 51
             + +D ET S   ++            ++  +F  ++                  +   
Sbjct: 354 KLIAVDTETDSLDYMS----------ANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 403

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SAL 109
                +K  LEN D+  +  N  F+ ++      +++       T++L+ +        +
Sbjct: 404 TALAAIKPILENPDIHKIGQNIKFDESIFARH-GIELQGVE-FDTMLLSYTLNSTGRHNM 461

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
             + +           G E IA     E+           ++       EY   D  VT 
Sbjct: 462 DDLAKRY--------LGHETIAF----ESIAGKGKNQLTFNQIPLEQATEYAAEDADVTM 509

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L                 E  L ++   +   G  +D       +  +    T L
Sbjct: 510 KLQQALWLKLQQEPTLVELYKTMELPLLHVLSRMERTGVLIDSNALFMQSNEIATRLTAL 569

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAI 274
           +++   L      +    ++L+  LF + GL           +T + VL           
Sbjct: 570 EEQAYELAGQP-FNLASTKQLQEILFDKLGLPILQKTPKGAPSTNEEVLEELAYSHELP- 627

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           ++       S+      + L + +NS      T      + TGR S      QN+P  + 
Sbjct: 628 KILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNE 687

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA EG  +V AD + IE R++A ++G
Sbjct: 688 EGRR-------------------------IRQAFIAREGYSIVAADYSQIELRIMAHLSG 722

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           +Q  + AF  G+D++ +T A  F V+  +VT +QR   K +                   
Sbjct: 723 DQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------GLI 768

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++    +  +                                     ++    + Q++
Sbjct: 769 YGMSAFGLSRQLDI------------------------------SRPDAKKYMDLYFQRY 798

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V +   ++ +  +                              +    GR L   D+ 
Sbjct: 799 PSVQQFMTDIREKAK--------------------------AQGYVETLFGRRLYLPDIN 832

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD-----IVLTVH 629
           ++ +      +   R            +Q  + DI+   M+   +  Y      +++ VH
Sbjct: 833 SSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIYHDPDIEMIMQVH 883

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E            +   M         +PL  E    + +
Sbjct: 884 DELVFEVRSEKVEFFREQIKQQMEDASELV--VPLIVEVGVGQNW 926


>gi|28199026|ref|NP_779340.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28199602|ref|NP_779916.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681748|ref|YP_001829908.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182682343|ref|YP_001830503.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057124|gb|AAO28989.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28057717|gb|AAO29565.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631858|gb|ACB92634.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182632453|gb|ACB93229.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578624|gb|ADN62593.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
 gi|307580177|gb|ADN64146.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 726

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 275/726 (37%), Positives = 366/726 (50%), Gaps = 63/726 (8%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALE 62
            L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     MP+ L  AL 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGEGPVQVWDCTATATMPEELSAALH 68

Query: 63  NTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ- 121
           N  V +  HNS+F+RTVL     + IP+ RW  ++  A ++ LP AL  + E L++  + 
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 122 -KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            K ++GK L+A FCK     C   R  +  H   W  F EY + DVT  R++ KRL   +
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHN 187

Query: 180 SKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
               E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   +
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   L    G+ L D+ + T +R L  +  L     ++ + R +AS ++  K   L+  
Sbjct: 248 ALLHHLSTAHGVALPDMQQHTVERCL-DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +          D
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDD 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL------- 408
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF   +         
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGTW 426

Query: 409 ---------------------------------YVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                            Y   YA SF +AP  VTK QR IGKV 
Sbjct: 427 HSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           ELALGY GG  AF   A+   ++L   A        P   ++A     W + NH      
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMAAQAAL--PPLLLQEATELLEWTKANHRPTFGL 544

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                 AC+  K+AWR  H  ++  W  L  A    I + +            + ++  +
Sbjct: 545 SDRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETA-----HTCCGITVQYSR 599

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNTT--TRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 600 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDV 659

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+E
Sbjct: 660 LAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFE 719

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 720 THRYRK 725


>gi|92112681|ref|YP_572609.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
 gi|91795771|gb|ABE57910.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
          Length = 928

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 103/705 (14%), Positives = 198/705 (28%), Gaps = 163/705 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDP---------- 51
                D ET S           Y E   ++      D          H            
Sbjct: 350 DIFCFDLETTSLN---------YME-ADIVGIGLSLDAGEAAYIPVAHRYLDAPEQLDRA 399

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSA-LK 110
            +   LK   E+     +  N  ++ +VL    ++++   R   T++ +      +    
Sbjct: 400 SVLAALKPLWEDPAKAKIGQNLKYDISVLARY-DIEVA-GRLEDTMLASYVLNATATRHD 457

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
               ALK   +K    +E                +     + A      Y   DV +T  
Sbjct: 458 MDSLALKYLGEKTISFEE----------IAGKGAKQLTFDQIALEQAAPYACEDVDITLR 507

Query: 171 IFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           + + L P               E  L  +   +   G  +D    H  ++ ++    +L+
Sbjct: 508 LHRELRPRVDGEGRLAAVLDDIELPLVPVLSRMERNGVALDAERLHAQSRELEKRLRELE 567

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQ 275
                L      +    ++L   LF E  + +   T     +T + VL       P    
Sbjct: 568 TRAYELAG-REFNLGSPKQLGEILFDELKIPVIKKTPKGAPSTAEAVLEELALDYPLPKV 626

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           +  +R   ++      + L + +N+  R   T      + TGR S      QN+P  +  
Sbjct: 627 IIEHR-GFAKLKSTYTDKLPQLVNATTRRLHTSYHQAVTATGRLSSSDPNLQNIPIRTEE 685

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
             +                         +R   +A  G ++V AD + IE R++A ++G+
Sbjct: 686 GRK-------------------------IRQAFVARPGYRIVAADYSQIELRIMAHLSGD 720

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  L AF  G D++  T A  F VA   V+ +QR   K +                    
Sbjct: 721 KGLLDAFAEGRDIHTATAAEVFGVALDAVSGEQRRSAKAINF--------------GLIY 766

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                    +        +     +  ++ 
Sbjct: 767 GMS------------------------------AWGLGRQLHIERNQAQTYIDRYFDRYP 796

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V+     +                               ++  +    GR L   ++  
Sbjct: 797 GVARFMERIRAQA--------------------------ADDGYVETVFGRRLYLPEINA 830

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVH 629
                 T  +   R            +Q  + DI+   M++  +          +V+ VH
Sbjct: 831 QN---RTRRQAAERTAINAP------MQGTAADIIKLAMIDVDRWLREGDFDAWMVMQVH 881

Query: 630 DEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +         +   M         +PL  E      +
Sbjct: 882 DELVFEVKEAQVDAFTDAVRQRMEGAAK--LDVPLTVEANAGDNW 924


>gi|323499675|ref|ZP_08104643.1| DNA polymerase I [Vibrio sinaloensis DSM 21326]
 gi|323315276|gb|EGA68319.1| DNA polymerase I [Vibrio sinaloensis DSM 21326]
          Length = 929

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 102/706 (14%), Positives = 201/706 (28%), Gaps = 164/706 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
                D ET S   +             ++  +F  ++         HD           
Sbjct: 350 DVFAFDTETDSLDYMV----------ANLVGLSFATEEGVAAYVPVAHDYLDAPAQLDRD 399

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL-PSALK 110
            + + LK  LE+     V  N  ++ +VL     +++   +   T++ +           
Sbjct: 400 WVLEQLKPILEDDAQAKVGQNLKYDASVLARY-GIEMKGIK-HDTMLASYVYNSVGGKHD 457

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
               AL+                   E       +    ++        Y   D  VT  
Sbjct: 458 MDSLALRFLQHS----------CISFEQIAGKGKKQLTFNQIELDEASPYAAEDADVTLR 507

Query: 171 IFKRLEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           +  RL     +++            L  +   I   G  +D       +Q +     +L+
Sbjct: 508 LHNRLMENIDQDEKLKAIYQEIEVPLVPVLSRIERTGVLIDDMKLSAQSQEIAQRLDELE 567

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQ 275
           Q+   +      +    ++L+  LF + GL         T +T + VL       P    
Sbjct: 568 QKAYEI-AEQEFNMNSPKQLQAILFEKMGLPVIKKTPSGTPSTNEEVLQELALDYPLPKL 626

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           +   R   ++      + L + +N +     T      + TGR S      QN+P  +  
Sbjct: 627 ILEYR-GLAKLKSTYTDKLPKMINPETGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNDE 685

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   IA  G K++  D + IE R++A ++G+
Sbjct: 686 GRR-------------------------IRQAFIAPHGYKIMAVDYSQIELRIMAHLSGD 720

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           Q  L AF+ G+D++  T A        QV+ +QR   K +                    
Sbjct: 721 QALLDAFQQGKDIHAATAAEIMGTTIDQVSSEQRRRAKAVNF--------------GLIY 766

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        +     + +++ 
Sbjct: 767 GMS------------------------------AFGLAKQLGIPRGEAQDYMNKYFERYP 796

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V +   +   A                            +   +    GR L   ++ +
Sbjct: 797 GVMQYMEDTRSAA--------------------------ADQGYVETIFGRRLHLPEIKS 830

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTV 628
                    +   R            +Q  + DI+ + M+   +           +++ V
Sbjct: 831 RNGMRR---KAAERAAINAP------MQGTAADIIKKAMLLVDEWIQAEGQGRVKLLMQV 881

Query: 629 HDEIVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E  ++        +  LM S       +PL AE      +
Sbjct: 882 HDELVFEVEESSLAEIESKVQQLMESAAD--LDVPLVAEAGHGDNW 925


>gi|148545397|ref|YP_001265499.1| DNA polymerase I [Pseudomonas putida F1]
 gi|148509455|gb|ABQ76315.1| DNA polymerase I [Pseudomonas putida F1]
          Length = 915

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 105/702 (14%), Positives = 193/702 (27%), Gaps = 160/702 (22%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET              A+   ++  +F  + H        HD            + 
Sbjct: 337 AFDTETTGLD----------AQQAQLVGLSFAVEPHEAAYVPLAHDYEGAPVQLDREAVL 386

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFN-LDIPIHRWICTLVLARSNGLPSALKAVG 113
             LK  LE+     V  N+ ++  +L      +++    +  T++ +      +      
Sbjct: 387 LALKPLLEDPAKAKVGQNAKYDINILANGSPPIEMRGVAY-DTMLESYVLNSTAT----- 440

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
              +     + + K L       E       +    ++      G Y   D  +T  +  
Sbjct: 441 ---RHDMDSLAQ-KYLDHTTIAFEDIAGKGAKQLTFNQITLDKAGPYAAEDADITLRLHH 496

Query: 174 RLEPLSSKEQELWYLDQTINDR-----------GYCVDVALAHTLNQIVDVERTKLDQEL 222
            L+   ++   +  +   I              G  VD  L    +  + V+  +L+   
Sbjct: 497 ALQARLAQTPSVQPVLMDIEMPLVPVLARIERQGALVDAELLKVQSGELGVKMAELELRA 556

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFN 278
             L      +    ++L T L+ + G+ +   T     +T + VL    +      +V  
Sbjct: 557 YELAG-ETFNLGSPKQLGTILYDKLGMPVLSKTAKGQPSTAEAVLDELAEQGYPLPEVLM 615

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
                S+      + L   +N       T      + TGR S      QN+P  +     
Sbjct: 616 QYRSLSKLKSTYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRR 675

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    +R   IAS G KL+ AD + IE R++A +A ++  
Sbjct: 676 -------------------------IRQAFIASPGYKLLAADYSQIELRIMAHLAKDEGL 710

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L AF    D++  T A  F VA   VT DQR   K +                    G++
Sbjct: 711 LHAFRNDLDVHRATAAEVFGVALEDVTTDQRRSAKAIN--------------FGLIYGMS 756

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
               A  +                                     +     +  ++  V 
Sbjct: 757 AFGLAKQI------------------------------GVDRKQSQDYIDRYFARYPGVL 786

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
                      +                             +    GR L   D+     
Sbjct: 787 AYMERTRAQAAE--------------------------QGFVETLFGRRLYLPDINAKNP 820

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK------AGYDIVLTVHDEI 632
            L    +   R            +Q  + DI+   M+              ++L VHDE+
Sbjct: 821 ALR---KGAERTAINAP------MQGTAADIIKRAMVKVDNWLSESGLDARVILQVHDEL 871

Query: 633 VCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           V E  +         +   M+        +PL  E      +
Sbjct: 872 VLEVREDLVEQVKDEIRQHMSQAAQ--LDVPLLVEAGVGANW 911


>gi|239814549|ref|YP_002943459.1| DNA polymerase I [Variovorax paradoxus S110]
 gi|239801126|gb|ACS18193.1| DNA polymerase I [Variovorax paradoxus S110]
          Length = 940

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 110/704 (15%), Positives = 204/704 (28%), Gaps = 167/704 (23%)

Query: 6   IDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMPQ 55
           ID ET S  ++             ++  +F  +          H+            +  
Sbjct: 368 IDTETTSLDEMV----------ARIVGVSFSIEPGAAAYVPLAHNYPDAPAQLPFDEVLA 417

Query: 56  VLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL--PSALKAVG 113
            LK  LEN     +  +  ++R V      +++  +    T++ +       P  L ++ 
Sbjct: 418 RLKPWLENPAKKKLGQHIKYDRHVFANH-GIEVQGYA-HDTMLQSYVLEAHRPHGLASLA 475

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
           E              L       E          P  +       EY   D   T ++  
Sbjct: 476 ERH------------LGRSGISYEDLCGKGAHQIPFSQVDIAKAAEYSCEDSDQTLDVHL 523

Query: 174 RLEPLSSKEQELWYLDQ----------TINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            L P   ++++L ++ Q           +   G  +D       +  +      L+QE  
Sbjct: 524 ALWPQIERDEKLRFIYQLEMDSSEALYRVERNGVLIDAPTLAAQSHELGTRIMALEQEAY 583

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTET----TCQRVLSSNKKLTPQAIQVFNN 279
            +      +    +++    F + GL +   T +    T + VL    +  P   ++  +
Sbjct: 584 EIAGQP-FNLGSPKQIGEIFFTKLGLPVVKKTPSGAPSTDEEVLEKLAEDYPLPAKILEH 642

Query: 280 RMRASRSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
           R   S+      + L +  N   GR+        A  TGR S      QN+P  +     
Sbjct: 643 R-GLSKLKGTYTDKLGQLANPRTGRVHTHYAQAVA-VTGRLSSNDPNLQNIPIRTPEGRR 700

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    VR   IA  G  +  AD + IE R++A ++G++  
Sbjct: 701 -------------------------VREAFIAPPGSVIASADYSQIELRIMAHISGDESL 735

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AF  G D++  T A  F   P QV+ +QR   KV+                    G++
Sbjct: 736 LRAFREGIDVHRATAAEVFGATPDQVSSEQRRYAKVIN--------------FGLIYGMS 781

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A        A       +  ++  V 
Sbjct: 782 SFGL------------------------------ARNLGIETKAAASYIDRYFARYPGVK 811

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
              +E     ++                             +    GR L   ++ +   
Sbjct: 812 AYMDETKALAKE--------------------------KGYVETVFGRRLYLPEINSPNG 845

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA------TKAGYDIVLTVHDEI 632
                     R            +Q  + D++   M+         K    +++ VHDE+
Sbjct: 846 PRRG---GAERAAINAP------MQGTAADLIKLSMIKVQNVLDEEKRATRMIMQVHDEL 896

Query: 633 VCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+ +       +  LM         +PL AE      + K
Sbjct: 897 VFEVPEAEIEWVRTEIPRLMAGVAE--LKVPLLAEIGIGPNWDK 938


>gi|308051440|ref|YP_003915006.1| DNA polymerase I [Ferrimonas balearica DSM 9799]
 gi|307633630|gb|ADN77932.1| DNA polymerase I [Ferrimonas balearica DSM 9799]
          Length = 922

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 106/705 (15%), Positives = 200/705 (28%), Gaps = 169/705 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
            ID ET S   +             ++  +F  +          HD            + 
Sbjct: 347 AIDTETTSIDYMA----------AELVGLSFAVEAGKGAYLPVAHDYEGAPVQLDRDTVL 396

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP---SALKA 111
             LK  LE+T    V  N  ++ +VL     + +       T++ +           +  
Sbjct: 397 AKLKPLLEDTAPRKVGQNLKYDMSVLAKY-GIALNGIA-FDTMLESYCFNSTAGRHNMDD 454

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           +             G + I      E       + K  ++        Y   D  +T  +
Sbjct: 455 MALKY--------LGHKTIHF----EDIAGKGAKQKTFNQIPLEEAAPYAAEDADITLRL 502

Query: 172 FKRLEPLSSK-----------EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            + L P   +           E+ L  +   +   G  +D    H  +  +      L+Q
Sbjct: 503 HQHLWPRLQELAGPTRVFEQLERPLVPIMSAMERHGVLIDTDQLHQQSSEIATTLDSLEQ 562

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +    V +    ++L+   F + G  +   T     +T + VL       P    +
Sbjct: 563 QAHEIAG-EVFNLGSTKQLQAIFFDKLGYPVLKKTPKGAPSTAEEVLQELALDYPLPKII 621

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
             +R   ++      + L + +   GR+  +      + TGR S      QN+P  +   
Sbjct: 622 LEHR-SLAKLKNTYTDKLPQLVKPSGRVHTSYHQAV-TATGRLSSSDPNLQNIPIRTAEG 679

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA EG KL+  D + IE R++A ++ ++
Sbjct: 680 RR-------------------------IRQAFIAPEGYKLLAIDYSQIELRIMAHLSQDK 714

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L+AF  G+D++  T A  F V    VT +QR   K +                    G
Sbjct: 715 GLLEAFAAGKDIHKATAAEVFGVDFDSVTTEQRRRAKAVNF--------------GLIYG 760

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++    A  +                                     +     +  ++  
Sbjct: 761 MSAFGLAKQLDI------------------------------GRAEAQEYIDRYFHRYPG 790

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E  +                                     +    GR L   ++   
Sbjct: 791 VLEYMDRTRAQAHD--------------------------KEYVETLMGRRLHLPEINAR 824

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA-------TKAGYDIVLTVH 629
                       R            +Q  + DI+ + M+          +    +++ VH
Sbjct: 825 NKMRQQA---AERTAINAP------MQGTAADIIKKAMLLVADYLSQQAEDEIHLIMQVH 875

Query: 630 DEIVCETPDTDEFN-ASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E  +         L  LM+        +PL AEG     +
Sbjct: 876 DELVFEVREGVAEQHKDALCELMSQAAE--LDVPLLAEGGLGDNW 918


>gi|312882610|ref|ZP_07742349.1| DNA polymerase I [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369695|gb|EFP97208.1| DNA polymerase I [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 927

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 105/706 (14%), Positives = 206/706 (29%), Gaps = 164/706 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------P 51
             +  D ET S           Y E   ++  +F  ++         HD           
Sbjct: 348 DVIAFDTETDSLD---------YME-ANLVGVSFAIEEGVAAYVPVAHDYMDAPKQLERD 397

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL-PSALK 110
            + + LK  LE+     V  N  ++ +VL     +D+   +   T++ +           
Sbjct: 398 WVLEQLKPILEDGSRAKVGQNLKYDASVLARY-GIDMRGIK-FDTMLASYVYNSVAGKHD 455

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTRE 170
               AL+                   E       +    ++        Y   D  VT  
Sbjct: 456 MDSLALRFLQHS----------CISFEQVAGKGKKQLTFNQIDLEQAAPYAAEDADVTFR 505

Query: 171 IFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           + +RL+                E  L  +   I   G  +D       +Q + +    L+
Sbjct: 506 LHQRLQKSLDASDKLASIYRDIEMPLVPVLSRIERTGVLIDDMKLSAQSQEIALRLDALE 565

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQ 275
           Q+   +      +    ++L+  LF + GL         T +T + VL       P   +
Sbjct: 566 QQAFDIAGQ-EFNMNSPKQLQAILFEKMGLPVVKKTPSGTPSTNEEVLQELALDYPLPEK 624

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           +   R   ++      + L + +N       T      + TGR S      QN+P  +  
Sbjct: 625 ILEYR-GLAKLKSTYTDKLPKMINPTTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEE 683

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                                       +R   +A  G K++  D + IE R++A ++G+
Sbjct: 684 GRR-------------------------IRQAFVAPHGYKIMAIDYSQIELRIMAHLSGD 718

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +  L+AF+ G+D++  T A    V  +QVT +QR   K +                    
Sbjct: 719 RALLEAFQQGKDIHAATAAEILGVDISQVTAEQRRRAKAVNF--------------GLIY 764

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           G++                                  A +        ++    + +++ 
Sbjct: 765 GMS------------------------------AFGLAKQLGIPRGEAQQYMDTYFERYP 794

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGN 575
            V +   +      +                             +    GR L   ++ +
Sbjct: 795 GVMQYMEDTRSIAAE--------------------------QGYVETIFGRRLHLPEIQS 828

Query: 576 NRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTV 628
                    +   R            +Q  + DI+ + M+               +++ V
Sbjct: 829 RNGMRR---KAAERAAINAP------MQGTAADIIKKAMLLVDDWIQTEGQGRVKLLMQV 879

Query: 629 HDEIVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           HDE+V E  +T        + +LM         +PL AE    + +
Sbjct: 880 HDELVFEVEETSLPEIESKIRNLMEQAAQ--LKVPLVAEAGHGENW 923


>gi|303252143|ref|ZP_07338311.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247479|ref|ZP_07529524.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648926|gb|EFL79114.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855982|gb|EFM88140.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 957

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 107/730 (14%), Positives = 215/730 (29%), Gaps = 190/730 (26%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVM-------- 53
             + +D ET +   ++            ++  +FG  +         H   +        
Sbjct: 356 KLVAVDTETDNLDSMS----------ANLVGVSFGLANGDACYIPLTHKEQVTLEPQQSD 405

Query: 54  --------------------------PQVLKEALENTDVTIVAHNSYFERTVLKACFNLD 87
                                        LK  LEN DV  +  N  ++ T+        
Sbjct: 406 LFAEQAEAETTTSFELAKKQLNLTACLTELKPLLENADVKKIGQNIKYDLTIFANH---G 462

Query: 88  IPIHRW-ICTLVLARSNGLP--SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD 144
           + +      T++ + +        +  + +           G + I      E       
Sbjct: 463 VQVAGVAFDTMLESYTLNSTGRHNMDELADRY--------LGHKTIEF----EEIAGKGK 510

Query: 145 RNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS-----------KEQELWYLDQTIN 193
                 + A  +  +Y   D  VT ++ + L P               E  L  +   I 
Sbjct: 511 NQLTFDKIAIDVASQYAAEDADVTMKLHQVLAPELEKAPTLVKLFNEIEMPLVEVLSRIE 570

Query: 194 DRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED 253
             G  +D       +  ++   ++L+Q + S     V +    ++L+  LF + GL +  
Sbjct: 571 RNGVLIDPEKLLAQSAEIEQRLSELEQLVHSEAG-EVFNLASTKQLQEILFTKLGLPVLK 629

Query: 254 LTE----TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQ 309
            T     +T + VL           ++       S+      + L   +N       T  
Sbjct: 630 KTPKGAPSTNEEVLDELAGQGHLVPKLLMEHRGLSKLKSTYTDKLPLMINPKTGRVHTSY 689

Query: 310 FLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVI 369
               + TGR S      QN+P  +                              +R   I
Sbjct: 690 HQAVTATGRLSSSDPNLQNIPIRNEEGRR-------------------------IRQAFI 724

Query: 370 ASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQR 429
           A++G K+V AD + IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR
Sbjct: 725 ANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQR 784

Query: 430 AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH 489
              K +   L                G++    ++                         
Sbjct: 785 RSAKAINFGLI--------------YGMSEFGLSNQ------------------------ 806

Query: 490 PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLV 549
                         ++  + + Q++  V +   ++ ++                      
Sbjct: 807 ------LGISRADAKKYMERYFQRYPAVQQFMTDIRESA--------------------- 839

Query: 550 YMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDI 609
                     +    GR L   ++ ++ +      +   R            +Q  + DI
Sbjct: 840 -----SKKGYVETLFGRRLYLPEIKSSNAMRR---KAAERVAINAP------MQGTAADI 885

Query: 610 LAEGMMNATKA-----GYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWAKGLPL 663
           +   M+   KA        +++ VHDE+V E  +      + ++   M         +PL
Sbjct: 886 IKVAMIGIDKAIRGDENIKMIMQVHDELVFEVKEELVEHYSQLIKAEMEKAIQ--LKVPL 943

Query: 664 KAEGYESKRY 673
            AE      +
Sbjct: 944 IAEVGVGDNW 953


>gi|145636579|ref|ZP_01792246.1| DNA polymerase I [Haemophilus influenzae PittHH]
 gi|145270105|gb|EDK10041.1| DNA polymerase I [Haemophilus influenzae PittHH]
          Length = 930

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 101/705 (14%), Positives = 213/705 (30%), Gaps = 165/705 (23%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDC----------VHDP 51
             + +D ET S   ++            ++  +F  ++                  +   
Sbjct: 354 KLIAVDTETDSLDYIS----------ANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 403

Query: 52  VMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLP--SAL 109
                +K  LEN ++  +  N  F+ ++      +++       T++L+ +        +
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVE-FDTMLLSYTLNSTGRHNM 461

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTR 169
             + +           G E IA     E+           ++       EY   D  VT 
Sbjct: 462 DDLAKRY--------LGHETIAF----ESIAGKGKSQLTFNQIPLEQATEYAAEDADVTM 509

Query: 170 EIFKRLEPLSS-----------KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           ++ + L                 E  L ++   +   G  +D       +  +    T L
Sbjct: 510 KLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRLTAL 569

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAI 274
           +++  +L      +    ++L+  LF + GL           +T + VL           
Sbjct: 570 EKQAYALAGQP-FNLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELAYSHELP- 627

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
           ++       S+      + L + +NS      T      + TGR S      QN+P  + 
Sbjct: 628 KILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNE 687

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R   IA EG  +V AD + IE R++A ++G
Sbjct: 688 EGRR-------------------------IRQAFIAREGYSIVAADYSQIELRIMAHLSG 722

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           +Q  + AF  G+D++ +T A  F V+  +VT +QR   K +                   
Sbjct: 723 DQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------GLI 768

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G++                                  + +        ++    + Q++
Sbjct: 769 YGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQRY 798

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG 574
             V +   ++ +  +                              +    GR L   D+ 
Sbjct: 799 PSVQQFMTDIREKAK--------------------------AQGYVETLFGRRLYLPDIN 832

Query: 575 NNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA-----GYDIVLTVH 629
           ++ +      +   R            +Q  + DI+   M+   +        ++++ VH
Sbjct: 833 SSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIRHDPNIEMIMQVH 883

Query: 630 DEIVCETP-DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           DE+V E   +   F    +   M +       +PL  E    + +
Sbjct: 884 DELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 926


>gi|322514149|ref|ZP_08067216.1| DNA-directed DNA polymerase I [Actinobacillus ureae ATCC 25976]
 gi|322119989|gb|EFX91987.1| DNA-directed DNA polymerase I [Actinobacillus ureae ATCC 25976]
          Length = 957

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 108/731 (14%), Positives = 216/731 (29%), Gaps = 192/731 (26%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVM-------- 53
             + +D ET S   ++            ++  +FG  +         H   +        
Sbjct: 356 KLVAVDTETDSLDSMS----------ANLVGISFGLANGEACYIPLTHKEQVTLEPQQSD 405

Query: 54  --------------------------PQVLKEALENTDVTIVAHNSYFERTVLKACFNLD 87
                                        LK  LEN DV  +  N  ++ T+        
Sbjct: 406 LFAEPTEAETITSFELAKNQLNLTACVTELKPLLENADVKKIGQNIKYDLTIFANH---G 462

Query: 88  IPIHRW-ICTLVLARSNGLP--SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD 144
           + +      T++ + +        +  + E           G + I      E       
Sbjct: 463 VQVEGVAFDTMLESYTLNSTGRHNMDELAERY--------LGHKTIEF----EEIAGKGK 510

Query: 145 RNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS-----------SKEQELWYLDQTIN 193
                 + A  +  +Y   D  VT ++ + L P               E  L  +   I 
Sbjct: 511 NQLTFDKIAIDVASQYAAEDADVTMKLHQVLAPELDKAPTLVKLFNEIEMPLVEVLSRIE 570

Query: 194 DRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED 253
             G  ++       +  ++    +L+Q + S     V +    ++L+  LF + GL +  
Sbjct: 571 RNGVLIEPEKLLAQSAEIEQRLAELEQLVHSEAG-EVFNLASTKQLQEILFTKLGLPVLK 629

Query: 254 LTE----TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMN-SDGRLRGTL 308
            T     +T + VL           ++       S+      + L   +N   GR+  + 
Sbjct: 630 KTPKGAPSTNEEVLDELAGRGHLVPKLLMEHRGLSKLKSTYTDKLPLMINQKTGRVHTSY 689

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
                + TGR S      QN+P  +                              +R   
Sbjct: 690 HQAV-TATGRLSSSDPNLQNIPIRNEEGRR-------------------------IRQAF 723

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           I ++G K+V AD + IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +Q
Sbjct: 724 ITNKGYKIVAADYSQIELRIMAHLANDEGMIIAFAEGKDIHRATAAEIFGLALDQVTSEQ 783

Query: 429 RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQEN 488
           R   K +   L                G++    ++                        
Sbjct: 784 RRSAKAINFGLI--------------YGMSEFGLSNQ----------------------- 806

Query: 489 HPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL 548
                          ++  + + Q++  V +   ++ ++                     
Sbjct: 807 -------LGISRADAKKYMERYFQRYPAVQQFMTDIRESA-------------------- 839

Query: 549 VYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRD 608
                      +    GR L   ++ ++ +      +   R            +Q  + D
Sbjct: 840 ------SEKGYVETLFGRRLYLPEIKSSNAMRR---KAAERVAINAP------MQGTAAD 884

Query: 609 ILAEGMMNATKA-----GYDIVLTVHDEIVCETPDTDEF-NASMLYHLMTSNPSWAKGLP 662
           I+   M+   KA        +++ VHDE+V E  +      + ++   M         +P
Sbjct: 885 IIKVAMIGIDKAIRGDENIKMIMQVHDELVFEVKEERVEHYSQLIKAEMEKAIQ--LKVP 942

Query: 663 LKAEGYESKRY 673
           L AE      +
Sbjct: 943 LIAEVGVGDNW 953


>gi|261250089|ref|ZP_05942666.1| DNA polymerase I [Vibrio orientalis CIP 102891]
 gi|260939593|gb|EEX95578.1| DNA polymerase I [Vibrio orientalis CIP 102891]
          Length = 931

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 100/703 (14%), Positives = 200/703 (28%), Gaps = 164/703 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S   +             ++  +F  ++         HD            + 
Sbjct: 355 AFDTETDSLDYMV----------ANLVGLSFATEEGVAAYVPVAHDYLDAPAQLERDWVL 404

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL-PSALKAVG 113
           + LK  LE+     V  N  ++ +VL     +++   +   T++ +              
Sbjct: 405 EQLKPILEDDAQAKVGQNLKYDASVLARY-GIEMKGIK-HDTMLASYVYNSVGGKHDMDS 462

Query: 114 EALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK 173
            AL+                   E       +    ++        Y   D  VT  +  
Sbjct: 463 LALRFLQHS----------CISFEQIAGKGKKQLTFNQIELDEASPYAAEDADVTLRLHN 512

Query: 174 RLEPLSSKEQ-----------ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           RL     +++            L  +   I   G  +D       +Q +     +L+Q+ 
Sbjct: 513 RLMENIDQDEKLKAIYQEIEVPLVPVLSRIERTGVLIDDMKLGAQSQEIAQRLDELEQQA 572

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLH----LEDLTETTCQRVLSSNKKLTPQAIQVFN 278
             +      +    ++L+  LF + GL         T +T + VL       P    +  
Sbjct: 573 YEI-AEQEFNMNSPKQLQALLFEKMGLPVIKKTPSGTPSTNEEVLQELALDYPLPKLILE 631

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
            R   ++      + L + +N +     T      + TGR S      QN+P  +     
Sbjct: 632 YR-GLAKLKSTYTDKLPKMINPETGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRR 690

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
                                    +R   IA  G K++  D + IE R++A ++G++  
Sbjct: 691 -------------------------IRQAFIAPHGYKIMAVDYSQIELRIMAHLSGDKAL 725

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AF+ G+D++  T A        QV+ +QR   K +                    G++
Sbjct: 726 LEAFQQGKDIHAATAAEIMGTTIDQVSSEQRRRAKAVNF--------------GLIYGMS 771

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                             A +        +     + +++  V 
Sbjct: 772 ------------------------------AFGLAKQLGIPRGEAQDYMNKYFERYPGVM 801

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRS 578
           +   +                                    +    GR L   ++ +   
Sbjct: 802 QYMEDTRSTA--------------------------SEQGYVETIYGRRLHLPEIQSRNG 835

Query: 579 YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK-------AGYDIVLTVHDE 631
                 +   R            +Q  + DI+ + M+   +           +++ VHDE
Sbjct: 836 MRR---KAAERAAINAP------MQGTAADIIKKAMLLVDEWIQTEGDGRVKLLMQVHDE 886

Query: 632 IVCETPDTDEFNAS-MLYHLMTSNPSWAKGLPLKAEGYESKRY 673
           +V E  ++        +  LM S       +PL AE      +
Sbjct: 887 LVFEVQESALTEIESKVQELMESAAE--LDVPLVAEAGHGDNW 927


>gi|157830862|pdb|1DPI|A Chain A, Structure Of Large Fragment Of Escherichia Coli Dna
           Polymerase I Complexed With DTMP
 gi|157831606|pdb|1KFD|A Chain A, Crystal Structures Of The Klenow Fragment Of Dna
           Polymerase I Complexed With Deoxynucleoside Triphosphate
           And Pyrophosphate
          Length = 605

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 102/704 (14%), Positives = 205/704 (29%), Gaps = 167/704 (23%)

Query: 5   FIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMP 54
             D ET S  +++            ++  +F  +          HD              
Sbjct: 30  AFDTETDSLDNIS----------ANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERAL 79

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKA 111
           ++LK  LE+     V  N  ++R +L     +++       T++ +           + +
Sbjct: 80  ELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIA-FDTMLESYILNSVAGRHDMDS 137

Query: 112 VGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           + E              L  +    E            ++ A    G Y   D  VT ++
Sbjct: 138 LAER------------WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQL 185

Query: 172 FKRLEPLSSKE-----------QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
             ++ P   K              L  +   I   G  +D  + H  ++ + +   +L++
Sbjct: 186 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 245

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQV 276
           +   +      +    ++L+T LF + G+     T     +T + VL       P    +
Sbjct: 246 KAHEIAG-EEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 304

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH 336
              R   ++      + L   +N       T      + TGR S      QN+P  +   
Sbjct: 305 LEYR-GLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEG 363

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                                      +R   IA E   +V AD + IE R++A ++ ++
Sbjct: 364 RR-------------------------IRQAFIAPEDYVIVSADYSQIELRIMAHLSRDK 398

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
             L AF  G+D++  T A  F +    VT +QR   K +                    G
Sbjct: 399 GLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYG 444

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           ++                                  A +        ++    + +++  
Sbjct: 445 MS------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPG 474

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNN 576
           V E         ++                             +    GR L   D+ ++
Sbjct: 475 VLEYMERTRAQAKE--------------------------QGYVETLDGRRLYLPDIKSS 508

Query: 577 RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA------GYDIVLTVHD 630
                    +               +Q  + DI+   M+              +++ VHD
Sbjct: 509 NGARRAAAER---------AAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHD 559

Query: 631 EIVCETPDTDEFNASM-LYHLMTSNPSWAKGLPLKAEGYESKRY 673
           E+V E    D    +  ++ LM +       +PL  E    + +
Sbjct: 560 ELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|154246319|ref|YP_001417277.1| DNA polymerase I [Xanthobacter autotrophicus Py2]
 gi|154160404|gb|ABS67620.1| DNA polymerase I [Xanthobacter autotrophicus Py2]
          Length = 1000

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 112/714 (15%), Positives = 205/714 (28%), Gaps = 174/714 (24%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVH-------------D 50
           L  D ET S   +             ++  +     +        H              
Sbjct: 413 LAFDTETNSLDPM----------QADLVGVSLALSPNEACYIPLAHTGAGDGLFSEGQLP 462

Query: 51  PVMP-----QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL 105
             +P       LK  LE+     V HN  +++ VL       I +  + CT+ ++ +   
Sbjct: 463 GQIPVRDAIAALKGVLEDKGTLKVGHNVKYDQLVLARH---GIDVAPFDCTMCMSYALDA 519

Query: 106 P---SALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCK 162
                 +  +          +  G + IA                   + A      Y  
Sbjct: 520 GKNGHGMDELS--------VLHLGHQPIAF----SEVTGKGKGKVTFDKVALEPATHYAA 567

Query: 163 GDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
            D  VT  +++ L+P            + E+ L  +   +  RG  +D A+   L+    
Sbjct: 568 EDADVTLRLWQVLKPRLAAEGRTTVYETLERPLIAVLARMESRGISIDKAMLARLSSEFA 627

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKK 268
               +++ E+  L      +    +++   LF + GL     T     +T    L    +
Sbjct: 628 QGAARIEDEIAELAG-ERLNVGSPKQMGDILFGKMGLPGGTKTATGMWSTKATALEELAE 686

Query: 269 LTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQN 328
              +  Q      + S+      + L   +N   R   T   L A+ TGR S      QN
Sbjct: 687 AGHKLPQKILEWRQLSKLRSTYTDALPNFVNPQTRRVHTSYALAATTTGRLSSSDPNLQN 746

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
           +P  +                              +R   +A EG  LV AD + IE R+
Sbjct: 747 IPIRTEEGRR-------------------------IRRAFVAEEGNLLVSADYSQIELRL 781

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           LA +A       AF  G D++  T +  FNV    +  + R   K +             
Sbjct: 782 LAEIAEIPALRTAFTEGLDIHAMTASEMFNVPVKDMPAEVRRRAKAINF----------- 830

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
                  G++                                  A +         +  K
Sbjct: 831 ---GIIYGIS------------------------------AFGLANQLGIPREEAGQYIK 857

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            + ++   + +   E      +                          +  +    GR  
Sbjct: 858 RYFERFPGIRDYMEETKTFCRE--------------------------HGYVETLFGRRC 891

Query: 569 VYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT------KAGY 622
            Y ++        +      R             Q  + DI+   M+         K   
Sbjct: 892 HYPEIAAKNP---SIRAFNERAAINARL------QGTAADIIRRAMIRMEPALEKAKLSA 942

Query: 623 DIVLTVHDEIVCETPDTDEFN-ASMLYHLMTS--NPSWAKGLPLKAEGYESKRY 673