RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >gnl|CDD|37354 KOG2143, KOG2143, KOG2143, Uncharacterized conserved protein [Function unknown]. Length = 854 Score = 25.8 bits (56), Expect = 2.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 36 GCPDRLIITPNGAHF-WVEMKTSRGRLSNAQKRVIATLLLYHQKVQV 81 G PD + P F VE+K RLS Q+ +A L +V+V Sbjct: 796 GFPDLTLWNPETKRFKLVEVKGPNDRLSEKQRLWLALLADSGIRVEV 842 >gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease. Length = 239 Score = 25.7 bits (57), Expect = 3.1 Identities = 15/75 (20%), Positives = 24/75 (32%), Gaps = 8/75 (10%) Query: 30 QFINQRGCPDRLIIT-PNGAHFWVEMKTSRGRLSNAQKRVIA-------TLLLYHQKVQV 81 + D LI T PN + E G + A ++ A L Sbjct: 42 AALADLDEYDWLIFTSPNAVEAFFEALEELGLRALAGLKIAAVGPKTAEALREAGLTADF 101 Query: 82 LSSTEEVDGFLRMLE 96 + + +G L +LE Sbjct: 102 VPEEGDSEGLLELLE 116 >gnl|CDD|37786 KOG2575, KOG2575, KOG2575, Glucosyltransferase - Alg6p [Carbohydrate transport and metabolism, Amino acid transport and metabolism]. Length = 510 Score = 24.1 bits (52), Expect = 8.2 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Query: 51 WVEMKTSRGRLSNAQKR------VIATLLLY 75 WV + TSRG S A K +I+ LL+Y Sbjct: 120 WVALHTSRGFESIAHKLFMRSTVIISDLLIY 150 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.136 0.402 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,077,698 Number of extensions: 45246 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's gapped: 110 Number of HSP's successfully gapped: 4 Length of query: 98 Length of database: 6,263,737 Length adjustment: 66 Effective length of query: 32 Effective length of database: 4,837,543 Effective search space: 154801376 Effective search space used: 154801376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 51 (23.8 bits)