RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >gnl|CDD|149740 pfam08774, VRR_NUC, VRR-NUC domain. Length = 96 Score = 40.9 bits (96), Expect = 8e-05 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 36 GCPDRLIITPNGAHF-WVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTE 86 G PD ++ P G F VE+K +LS Q+ + L KV V S E Sbjct: 45 GVPDLILFLPPGKRFLLVEVKGPGDKLSPEQRAWLDRLARSGFKVAVCDSVE 96 >gnl|CDD|151735 pfam11294, DUF3095, Protein of unknown function (DUF3095). Some members in this bacterial family of proteins are annotated as adenylyl cyclase however this cannot be confirmed. Currently no function is known. Length = 373 Score = 28.8 bits (65), Expect = 0.36 Identities = 15/77 (19%), Positives = 24/77 (31%), Gaps = 20/77 (25%) Query: 38 PDRLIITPNGAHFWVEMKTSRG-------RLSNAQKRVIATLLL-------------YHQ 77 + + +E + RG RL + ++ LL Y Q Sbjct: 228 VEGPKLKWPPQGLDIEARARRGVGLLWLRRLKVLIQTLLGYLLFRTGLKLGGFDPRRYLQ 287 Query: 78 KVQVLSSTEEVDGFLRM 94 +V S + D LRM Sbjct: 288 EVVENSDFRKFDDGLRM 304 >gnl|CDD|178127 PLN02511, PLN02511, hydrolase. Length = 388 Score = 25.1 bits (55), Expect = 4.4 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 9/41 (21%) Query: 5 YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITP 45 Y+ L R SK +VF N RGC D + TP Sbjct: 117 YVRHMLLRAR----SKGWRVVVF-----NSRGCADSPVTTP 148 >gnl|CDD|180745 PRK06915, PRK06915, acetylornithine deacetylase; Validated. Length = 422 Score = 25.0 bits (55), Expect = 4.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 51 WVEMKTSRGRLSNAQKRVIATL 72 ++ K+ G S AQ VI L Sbjct: 26 LIQEKSVSGDESGAQAIVIEKL 47 >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional. Length = 506 Score = 24.9 bits (55), Expect = 5.1 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Query: 59 GRLS--NAQKRVIATLLLYHQKVQVL 82 RLS N QK V+A LL + K+ +L Sbjct: 404 ARLSGGNQQKAVLAKCLLLNPKILIL 429 >gnl|CDD|115607 pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins. Length = 140 Score = 24.1 bits (53), Expect = 7.4 Identities = 8/18 (44%), Positives = 10/18 (55%), Gaps = 1/18 (5%) Query: 26 VFKTQFINQRGCPDRLII 43 V + QFINQ P +I Sbjct: 120 VLQYQFINQVNAP-PFLI 136 >gnl|CDD|147889 pfam05977, DUF894, Bacterial protein of unknown function (DUF894). This family consists of several bacterial proteins, many of which are annotated as putative transmembrane transport proteins. Length = 524 Score = 24.3 bits (53), Expect = 7.8 Identities = 9/34 (26%), Positives = 12/34 (35%), Gaps = 4/34 (11%) Query: 43 ITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYH 76 P W+E R++ A K V L H Sbjct: 477 HVPT----WLEYLRQNHRVTQADKDVEERLRALH 506 >gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed. Length = 561 Score = 24.4 bits (53), Expect = 8.0 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Query: 26 VFKTQFINQR---GCPDRLIITPNGAH 49 V K Q++ ++ CPD +I+T G H Sbjct: 365 VIKPQYVIEQIYELCPDAIIVTEVGQH 391 >gnl|CDD|118672 pfam10144, SMP_2, Bacterial virulence factor haemolysin. Members of this family of bacterial proteins are membrane proteins that effect the expression of haemolysin under anaerobic conditions. Length = 210 Score = 24.0 bits (52), Expect = 9.6 Identities = 12/37 (32%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Query: 58 RGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRM 94 R RL+ K A Q V+ +S GFLR+ Sbjct: 110 RDRLALDGKE--AGSYFNQQIVEPISGKNGPLGFLRV 144 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.136 0.402 Gapped Lambda K H 0.267 0.0697 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,465,723 Number of extensions: 75616 Number of successful extensions: 173 Number of sequences better than 10.0: 1 Number of HSP's gapped: 173 Number of HSP's successfully gapped: 15 Length of query: 98 Length of database: 5,994,473 Length adjustment: 65 Effective length of query: 33 Effective length of database: 4,589,953 Effective search space: 151468449 Effective search space used: 151468449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 50 (23.1 bits)