RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.1 bits (56), Expect = 1.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Query: 64 AQKRVIATLLLY 75 A K++ A+L LY Sbjct: 21 ALKKLQASLKLY 32 >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Score = 26.3 bits (57), Expect = 1.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 24 CLVFKTQFINQRGCPDRLIITPNGAHFWVE 53 CL K ++ RG + II P AH + Sbjct: 143 CLSAKMYALHHRGITEPEIIAPVTAHAGFD 172 >2bih_A Nitrate reductase [NADPH]; FAD, flavoprotein, heme, molybdenum, nitrate assimilation, oxidoreductase; HET: MTV; 2.60A {Pichia angusta} Length = 474 Score = 25.5 bits (55), Expect = 3.3 Identities = 5/12 (41%), Positives = 6/12 (50%) Query: 39 DRLIITPNGAHF 50 D +TP HF Sbjct: 66 DSGFLTPVSLHF 77 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 24.5 bits (52), Expect = 5.6 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Query: 39 DRLIITPNGAHFWVEMKTSRGRLS--NAQKRVI 69 DRL P W E + R RL +A +V+ Sbjct: 78 DRLTQEPESIRKWREEQ--RKRLQELDAASKVM 108 >1ie9_A Vitamin D3 receptor; VDR, MC1288, gene regulation; HET: VDX; 1.40A {Homo sapiens} SCOP: a.123.1.1 PDB: 1db1_A* 1ie8_A* 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3cs4_A* 3cs6_A* 2zfx_A* 2zmi_A* 2zla_A* 2zlc_A* 2zmh_A* 2zl9_A* ... Length = 259 Score = 24.3 bits (52), Expect = 7.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 58 RGRLSNAQKRVIATLLLYHQK 78 R +LS Q+R+IA LL H K Sbjct: 4 RPKLSEEQQRIIAILLDAHHK 24 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.324 0.136 0.402 Gapped Lambda K H 0.267 0.0504 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 774,020 Number of extensions: 29441 Number of successful extensions: 108 Number of sequences better than 10.0: 1 Number of HSP's gapped: 108 Number of HSP's successfully gapped: 7 Length of query: 98 Length of database: 5,693,230 Length adjustment: 64 Effective length of query: 34 Effective length of database: 4,141,614 Effective search space: 140814876 Effective search space used: 140814876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 50 (23.6 bits)