BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 205 bits (522), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%) Query: 1 MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGR 60 MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGR Sbjct: 1 MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGR 60 Query: 61 LSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY 98 LSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY Sbjct: 61 LSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY 98 >gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 105 bits (263), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 52/93 (55%), Positives = 63/93 (67%) Query: 5 YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64 Y +E +EKRLV G+KKLDC V K F+ +RGCPDRLIITPNG +W+E+K GRLS+ Sbjct: 8 YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67 Query: 65 QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97 Q I L Q+V+VL S EEVD FL L C Sbjct: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 24.3 bits (51), Expect = 0.41, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 39 DRLIITPNGAHFWVEMKTS 57 D + P+G++ WV++K S Sbjct: 453 DHTVALPDGSYMWVQIKES 471 >gi|254781097|ref|YP_003065510.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 369 Score = 24.3 bits (51), Expect = 0.43, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 4 DYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLII 43 ++LS +L + L KK CLV + ++ +G P +++ Sbjct: 314 NFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLM 353 >gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 22.7 bits (47), Expect = 1.5, Method: Composition-based stats. Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 35 RGCPDRLIITPNGAH 49 + C + ++TPNG H Sbjct: 293 KACGEAFLMTPNGGH 307 >gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 21.2 bits (43), Expect = 4.5, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 80 QVLSSTEEVDGFLRMLECY 98 Q L+ EVD + +L C+ Sbjct: 90 QFLAHIREVDAIIHVLRCF 108 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.136 0.402 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,273 Number of Sequences: 1233 Number of extensions: 1690 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 98 length of database: 328,796 effective HSP length: 61 effective length of query: 37 effective length of database: 253,583 effective search space: 9382571 effective search space used: 9382571 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)