HHsearch alignment for GI: 254781196 and conserved domain: smart00532

>smart00532 LIGANc Ligase N family.
Probab=99.72  E-value=1.6e-17  Score=132.27  Aligned_cols=61  Identities=39%  Similarity=0.593  Sum_probs=59.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             9999999999999999975545898569899999999999999978642689897353889
Q gi|254781196|r   59 AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY  119 (119)
Q Consensus        59 A~~eie~L~k~I~~Hn~~YY~~D~P~ISDaEYD~L~~eL~~LE~~~PeL~~~dSPT~~VGy  119 (119)
T Consensus         1 ak~~i~~L~~~I~~~n~~YY~~~~p~ISD~eYD~L~~eL~~Le~~~P~l~~~~SPt~~VG~   61 (441)
T smart00532        1 AQKEISELRKLLNKHDYRYYVLDAPIISDAEYDRLMRELKELEEKHPELKTPDSPTQRVGG   61 (441)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             9789999999999999987618998799899999999999999869144689998545576