HHSEARCH alignment of GI: 254781196 and SCOP domain: d1b04a_

Alignment
>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]}
Probab=99.62  E-value=6.1e-16  Score=119.40  Aligned_cols=65  Identities=32%  Similarity=0.454  Sum_probs=62.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             99999999999999999999975545898569899999999999999978642689897353889
Q gi|254781196|r   55 SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY  119 (119)
Q Consensus        55 sk~EA~~eie~L~k~I~~Hn~~YY~~D~P~ISDaEYD~L~~eL~~LE~~~PeL~~~dSPT~~VGy  119 (119)
                      .+.+|+.||++|+++|.+||++||+.++|+|||++||+|+.+|..||.+||+|+..+||+++||.
T Consensus         1 ~~~~~~~~i~~L~~~i~~~~~~Yy~~~~p~isD~eYD~L~~~L~~le~~~p~l~~~~s~~~~v~~   65 (312)
T d1b04a_           1 DRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQRIGG   65 (312)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHTTCSCCSSCHHHHHHHHHHHHHHHHCGGGCCTTCGGGGTCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             95899999999999999999998628999799999999999999999868222468997512233


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Bacillus stearothermophilus [TaxId: 1422]