BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent
[Candidatus Liberibacter asiaticus str. psy62]
         (119 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040873|gb|ACT57669.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 119

 Score =  247 bits (631), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60
           MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM
Sbjct: 1   MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY
Sbjct: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119


>gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039808|gb|ACT56604.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|317120701|gb|ADV02524.1| DNA ligase [Liberibacter phage SC1]
 gi|317120744|gb|ADV02566.1| DNA ligase [Liberibacter phage SC2]
 gi|317120758|gb|ADV02579.1| DNA ligase [Liberibacter phage SC2]
 gi|317120805|gb|ADV02626.1| DNA ligase [Liberibacter phage SC1]
 gi|317120845|gb|ADV02666.1| DNA ligase [Candidatus Liberibacter asiaticus]
          Length = 119

 Score =  245 bits (626), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%)

Query: 1   MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60
           MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM
Sbjct: 1   MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           IEVEYLVKIALHHQKWYYRLD+PLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY
Sbjct: 61  IEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119


>gi|315121970|ref|YP_004062459.1| DNA ligase, NAD-dependent [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|315122938|ref|YP_004063427.1| DNA ligase, NAD-dependent [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495372|gb|ADR51971.1| DNA ligase, NAD-dependent [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496340|gb|ADR52939.1| DNA ligase, NAD-dependent [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 127

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 4/100 (4%)

Query: 23  QWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRL-- 80
           Q K LL  EAKFLP  R L   ++  K V+ LS  EA+IE EYL KI LHH++WYYRL  
Sbjct: 29  QLKSLLKFEAKFLPTPRQLLKIINDFKPVSQLSFWEALIETEYLTKIVLHHRRWYYRLSD 88

Query: 81  DNPLFTDGLYDRVSERLDALQEQFPELFDEDHP-WNTVGY 119
           + PL  D  YD++  R+  L E FPEL+   HP  + VGY
Sbjct: 89  ETPLL-DADYDKIEIRIIKLAEHFPELYSLAHPIISEVGY 127


>gi|299131914|ref|ZP_07025109.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
 gi|298592051|gb|EFI52251.1| DNA ligase, NAD-dependent [Afipia sp. 1NLS2]
          Length = 706

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 51/77 (66%), Gaps = 6/77 (7%)

Query: 47  KAKK----VTSLSKGEAMIEVEYL-VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQ 101
           KAKK    V +L+K +A +E+  L ++I++H ++ YY+ D P  +D  YD++ +RL A++
Sbjct: 4   KAKKAVTPVENLTKAQAKVELTRLALEISMHDER-YYQKDAPTVSDADYDKLRQRLSAIE 62

Query: 102 EQFPELFDEDHPWNTVG 118
           E+FPEL  +D P   VG
Sbjct: 63  ERFPELVAKDSPSQKVG 79


>gi|209550159|ref|YP_002282076.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|254781399|sp|B5ZWH9|DNLJ_RHILW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209535915|gb|ACI55850.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 718

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ QFPEL  E
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDALYHGKDRPQISDADYDALKRRNDALEVQFPELIRE 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPSRRVG 75


>gi|90418183|ref|ZP_01226095.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337855|gb|EAS51506.1| DNA ligase [Aurantimonas manganoxydans SI85-9A1]
          Length = 703

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 37/70 (52%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V +L + EA  E+E L      H + YYR D P  TD  YD +  R  A++ +FPEL 
Sbjct: 4   KAVETLDRDEAAAELERLAGEIAAHDRAYYREDAPTVTDAEYDTLRRRNAAIEARFPELI 63

Query: 109 DEDHPWNTVG 118
            ED P   VG
Sbjct: 64  REDSPSARVG 73


>gi|190892570|ref|YP_001979112.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
 gi|254781398|sp|B3PTU7|DNLJ_RHIE6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190697849|gb|ACE91934.1| DNA ligase (NAD+) protein [Rhizobium etli CIAT 652]
          Length = 718

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPEL  E
Sbjct: 8   VDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPELIRE 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPSRHVG 75


>gi|218515813|ref|ZP_03512653.1| NAD-dependent DNA ligase LigA [Rhizobium etli 8C-3]
          Length = 216

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (52%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +   V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPE
Sbjct: 4   EGSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPE 63

Query: 107 LFDEDHPWNTVG 118
           L  ED P   VG
Sbjct: 64  LIREDSPSRHVG 75


>gi|327194610|gb|EGE61460.1| DNA ligase (NAD+) protein [Rhizobium etli CNPAF512]
          Length = 718

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 38/72 (52%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +   V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPE
Sbjct: 4   EGSAVDTLTIEEAAAELERLAKEIAHHDSLYHGKDQPEISDADYDALKRRNDALEVRFPE 63

Query: 107 LFDEDHPWNTVG 118
           L  ED P   VG
Sbjct: 64  LIREDSPSRHVG 75


>gi|241205543|ref|YP_002976639.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859433|gb|ACS57100.1| DNA ligase, NAD-dependent [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 718

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 39/72 (54%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           ++  V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPE
Sbjct: 4   ESSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDRPEISDADYDALKRRNDALEVRFPE 63

Query: 107 LFDEDHPWNTVG 118
           L  ED P   VG
Sbjct: 64  LIREDSPSRHVG 75


>gi|218678588|ref|ZP_03526485.1| NAD-dependent DNA ligase LigA [Rhizobium etli CIAT 894]
          Length = 264

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (52%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +   V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPE
Sbjct: 4   EGSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEVRFPE 63

Query: 107 LFDEDHPWNTVG 118
           L  ED P   VG
Sbjct: 64  LIREDSPSRRVG 75


>gi|322437173|ref|YP_004219385.1| DNA ligase, NAD-dependent [Acidobacterium sp. MP5ACTX9]
 gi|321164900|gb|ADW70605.1| DNA ligase, NAD-dependent [Acidobacterium sp. MP5ACTX9]
          Length = 704

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SKG    +V+ L +   HH+  YY +D P  TDG YD +  RL AL+ + PE+   D P
Sbjct: 1   MSKGSVEEQVKELREQLEHHEHLYYVMDTPELTDGQYDSLMNRLKALEAEHPEMVTSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|316933200|ref|YP_004108182.1| NAD-dependent DNA ligase [Rhodopseudomonas palustris DX-1]
 gi|315600914|gb|ADU43449.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris DX-1]
          Length = 715

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           + A  + +L+K +A +E+  L  +   H K YY+ D P  +D  YD +  RL+A++++FP
Sbjct: 6   NPAPDIATLTKAKAKVELMRLRLVIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFP 65

Query: 106 ELFDEDHPWNTVG 118
           EL     P  TVG
Sbjct: 66  ELVSASSPTQTVG 78


>gi|218460243|ref|ZP_03500334.1| NAD-dependent DNA ligase LigA [Rhizobium etli Kim 5]
          Length = 327

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (52%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +   V +L+  EA  E+E L K   HH   Y+  D P  +D  YD +  R DAL+ +FPE
Sbjct: 4   EGSAVDTLTIEEAAAELERLAKEIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPE 63

Query: 107 LFDEDHPWNTVG 118
           L  ED P   VG
Sbjct: 64  LIREDSPSRHVG 75


>gi|86358438|ref|YP_470330.1| NAD-dependent DNA ligase LigA [Rhizobium etli CFN 42]
 gi|123738303|sp|Q2K6D3|DNLJ_RHIEC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86282540|gb|ABC91603.1| DNA ligase (NAD+) protein [Rhizobium etli CFN 42]
          Length = 718

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+  EA  E+E L +   HH   Y+  D P  +D  YD +  R DAL+ +FPEL  E
Sbjct: 8   VETLTIEEAAAELERLAREIAHHDALYHGKDQPEISDADYDALKRRNDALEARFPELIRE 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPSRRVG 75


>gi|146342488|ref|YP_001207536.1| DNA ligase [Bradyrhizobium sp. ORS278]
 gi|166215400|sp|A4YZJ3|DNLJ_BRASO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146195294|emb|CAL79319.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+])
           [Bradyrhizobium sp. ORS278]
          Length = 716

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 38/68 (55%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L+K +A +E + L      H + YY+ D P  +D  YD +  R +A++++FPEL   
Sbjct: 13  VADLTKAQAKVEWKRLALELETHDRLYYQEDAPKISDAAYDELRRRFNAIEKRFPELVSR 72

Query: 111 DHPWNTVG 118
           D P  TVG
Sbjct: 73  DSPSQTVG 80


>gi|209884394|ref|YP_002288251.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
 gi|254781382|sp|B6JB45|DNLJ_OLICO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209872590|gb|ACI92386.1| DNA ligase, NAD-dependent [Oligotropha carboxidovorans OM5]
          Length = 706

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 48/77 (62%), Gaps = 6/77 (7%)

Query: 47  KAKK----VTSLSKGEAMIEVEYL-VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQ 101
           K+KK    V  L+K +A +E + L ++IA+H ++ YY+ D P  +D  YD + +RL+A++
Sbjct: 4   KSKKPLPSVDQLTKAQAKVEHKRLALEIAMHDER-YYQKDAPTVSDAAYDSLRQRLNAVE 62

Query: 102 EQFPELFDEDHPWNTVG 118
            +FPEL   D P   VG
Sbjct: 63  ARFPELVTTDSPSQKVG 79


>gi|113460523|ref|YP_718587.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 129PT]
 gi|122945214|sp|Q0I2H6|DNLJ_HAES1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|112822566|gb|ABI24655.1| DNA ligase (NAD+) [Haemophilus somnus 129PT]
          Length = 673

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 54  LSKGEAMI--EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           + +G  MI  ++E L ++  HH+  Y+ LDNP   D  YDR+  +L AL++Q+PE   E+
Sbjct: 1   MKQGIFMIKQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYASEN 60

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 61  SPTQRVG 67


>gi|15603581|ref|NP_246655.1| NAD-dependent DNA ligase LigA [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|81636517|sp|Q9CKA9|DNLJ_PASMU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|12722128|gb|AAK03800.1| Lig [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 673

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E+E L +   +H+  Y+ LDNP   D  YDR+  RL  L++Q+P+ F  D P   VG
Sbjct: 7   LEIEQLRQTLRYHEYQYHVLDNPQIPDAEYDRLFHRLKTLEQQYPQWFSPDSPTQRVG 64


>gi|170718864|ref|YP_001784038.1| NAD-dependent DNA ligase LigA [Haemophilus somnus 2336]
 gi|254781341|sp|B0USD9|DNLJ_HAES2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168826993|gb|ACA32364.1| DNA ligase, NAD-dependent [Haemophilus somnus 2336]
          Length = 667

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L ++  HH+  Y+ LDNP   D  YDR+  +L AL++Q+PE   E+ P   VG
Sbjct: 5   QIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQLKALEQQYPEYASENSPTQRVG 61


>gi|83858905|ref|ZP_00952427.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
 gi|83853728|gb|EAP91580.1| NAD-dependent DNA ligase [Oceanicaulis alexandrii HTCC2633]
          Length = 695

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 38/70 (54%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V +L+  EA  E+E L +    H K YY  D P  +D  YD +  R  A++ +FPEL 
Sbjct: 6   KDVNALTSDEAASELERLAREISRHDKAYYEKDAPKISDAAYDALRARNSAIEARFPELK 65

Query: 109 DEDHPWNTVG 118
            +D P + VG
Sbjct: 66  RKDSPSDRVG 75


>gi|209963935|ref|YP_002296850.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
 gi|254781401|sp|B6IRF1|DNLJ_RHOCS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|209957401|gb|ACI98037.1| DNA ligase, NAD-dependent [Rhodospirillum centenum SW]
          Length = 719

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+  +A  E   LV+   HH+  YY  D P   D  YD +  RL  L+ +FPEL   
Sbjct: 12  VETLTLDQAAAEHAALVREIAHHRALYYGKDAPEIADSAYDALEHRLAGLEARFPELVTP 71

Query: 111 DHPWNTVG 118
           D P  TVG
Sbjct: 72  DSPTQTVG 79


>gi|92116846|ref|YP_576575.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
 gi|123083742|sp|Q1QNT2|DNLJ_NITHX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91799740|gb|ABE62115.1| DNA ligase, NAD-dependent [Nitrobacter hamburgensis X14]
          Length = 714

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 40/68 (58%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V SL++ +A IE + L      H + YY+ D P  +D  YD + +RL+A++ +FP+L   
Sbjct: 11  VDSLTRAQAKIEHKRLALEIETHNERYYQKDAPTVSDAAYDALRQRLEAIEARFPDLITA 70

Query: 111 DHPWNTVG 118
           + P  TVG
Sbjct: 71  NSPTQTVG 78


>gi|319782858|ref|YP_004142334.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168746|gb|ADV12284.1| DNA ligase, NAD-dependent [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 734

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 40/70 (57%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V SLS+ EA  E++ L +    H + Y+  D P+ TD  YD ++ R  A++E+FP L 
Sbjct: 4   KPVDSLSESEAEAELKRLAEEIAEHDRRYHTEDAPVITDAEYDALARRNLAIEERFPALV 63

Query: 109 DEDHPWNTVG 118
            ED P   VG
Sbjct: 64  REDSPSLRVG 73


>gi|254470147|ref|ZP_05083551.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
 gi|211960458|gb|EEA95654.1| DNA ligase, NAD-dependent [Pseudovibrio sp. JE062]
          Length = 722

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 39/70 (55%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K + +L+  EA +E+E L ++   + + Y+  D P+  D  YD +  R  AL+ +FPEL 
Sbjct: 9   KDIEALNAEEAALELERLARLIAEYDEAYHTQDAPIVDDATYDGLRRRNAALEAKFPELV 68

Query: 109 DEDHPWNTVG 118
             D P N VG
Sbjct: 69  RADSPSNRVG 78


>gi|85714986|ref|ZP_01045971.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
 gi|85698183|gb|EAQ36055.1| NAD-dependent DNA ligase [Nitrobacter sp. Nb-311A]
          Length = 705

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V SL++ +A +E + LV     H + YY+ D P  +D  YD +  RL+A++ +FP+L   
Sbjct: 11  VDSLTRSQARVEHKRLVLEIEAHNERYYQQDAPTVSDAAYDAMQRRLEAIEARFPDLVTA 70

Query: 111 DHPWNTVG 118
             P  TVG
Sbjct: 71  SSPTQTVG 78


>gi|302390293|ref|YP_003826114.1| DNA ligase, NAD-dependent [Thermosediminibacter oceani DSM 16646]
 gi|302200921|gb|ADL08491.1| DNA ligase, NAD-dependent [Thermosediminibacter oceani DSM 16646]
          Length = 672

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA   ++ L ++  +H + YY  DNP+ +D  YD++  +L+ L++QFPEL   D P
Sbjct: 1   MDRSEAEARIKELRELINYHNRQYYVYDNPVISDAEYDKLMRQLEKLEKQFPELITPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|90021526|ref|YP_527353.1| DNA ligase (NAD+) [Saccharophagus degradans 2-40]
 gi|123090491|sp|Q21JI8|DNLJ_SACD2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|89951126|gb|ABD81141.1| DNA ligase, NAD-dependent [Saccharophagus degradans 2-40]
          Length = 674

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/47 (46%), Positives = 29/47 (61%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H K YY LD P   D  YD++ + L A+++QFPEL  ED P   VG
Sbjct: 20  YHNKLYYVLDAPELPDAEYDKLFQELQAIEQQFPELVTEDSPTQRVG 66


>gi|103486042|ref|YP_615603.1| DNA ligase, NAD-dependent [Sphingopyxis alaskensis RB2256]
 gi|123078573|sp|Q1GVQ2|DNLJ_SPHAL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|98976119|gb|ABF52270.1| DNA ligase, NAD-dependent [Sphingopyxis alaskensis RB2256]
          Length = 714

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 37/70 (52%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V SL++ EA  E+  L K   HH K Y+  D+P  +D  YD +  R  A++E FP L 
Sbjct: 2   KDVGSLTEAEAANELMRLAKQIAHHNKLYHAEDSPEISDADYDALVRRNTAIEEAFPHLI 61

Query: 109 DEDHPWNTVG 118
             D P   VG
Sbjct: 62  RADSPNRLVG 71


>gi|192292401|ref|YP_001993006.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
 gi|254781404|sp|B3QFL8|DNLJ_RHOPT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|192286150|gb|ACF02531.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris TIE-1]
          Length = 715

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 41/71 (57%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A  + +L+K +A +E+  L      H K YY+ D P  +D  YD +  RL+A++++FPEL
Sbjct: 8   APDIATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPEL 67

Query: 108 FDEDHPWNTVG 118
            +   P  TVG
Sbjct: 68  VNASSPTQTVG 78


>gi|166216284|sp|Q6N423|DNLJ_RHOPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 41/71 (57%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A  + +L+K +A +E+  L      H K YY+ D P  +D  YD +  RL+A++++FPEL
Sbjct: 8   APDIATLTKPKAKVELMRLRLEIEGHDKAYYQDDAPKISDADYDALRRRLEAIEQKFPEL 67

Query: 108 FDEDHPWNTVG 118
            +   P  TVG
Sbjct: 68  VNASSPTQTVG 78


>gi|326573825|gb|EGE23778.1| NAD-dependent DNA ligase [Moraxella catarrhalis O35E]
          Length = 691

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +DG YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDGEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|27262356|gb|AAN87459.1| NAD-dependent DNA ligase [Heliobacillus mobilis]
          Length = 677

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA + V+ L +I  HH+  YY LD P  TD  YD +   L A+++ +PEL + D P   V
Sbjct: 16  EAEVRVKELREIIRHHEYRYYVLDAPEITDADYDALMRELQAIEDTYPELVEADSPTRRV 75

Query: 118 G 118
           G
Sbjct: 76  G 76


>gi|152979719|ref|YP_001345348.1| NAD-dependent DNA ligase LigA [Actinobacillus succinogenes 130Z]
 gi|190359224|sp|A6VR16|DNLJ_ACTSZ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150841442|gb|ABR75413.1| DNA ligase, NAD-dependent [Actinobacillus succinogenes 130Z]
          Length = 672

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/47 (48%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LDNP   D  YDR+  RL AL++Q PEL   D P   VG
Sbjct: 17  HHEYQYHVLDNPEIPDSEYDRLFHRLKALEQQHPELISADSPTQRVG 63


>gi|306844319|ref|ZP_07476911.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
 gi|306275391|gb|EFM57132.1| DNA ligase, NAD-dependent [Brucella sp. BO1]
          Length = 719

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D+P  +D  YD +  R +A++ +FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEARFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|262369277|ref|ZP_06062605.1| DNA ligase [Acinetobacter johnsonii SH046]
 gi|262315345|gb|EEY96384.1| DNA ligase [Acinetobacter johnsonii SH046]
          Length = 679

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L++I   H   YY +D P   D  YD++  +L AL+EQ+PE    D P N VG
Sbjct: 10  QMRQLIQILAQHNHAYYVMDQPTIADSEYDQLFHQLKALEEQYPEYIQPDSPINKVG 66


>gi|306843233|ref|ZP_07475843.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
 gi|306286556|gb|EFM58135.1| DNA ligase, NAD-dependent [Brucella sp. BO2]
          Length = 719

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D+P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|254719452|ref|ZP_05181263.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|265984457|ref|ZP_06097192.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306839229|ref|ZP_07472046.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
 gi|264663049|gb|EEZ33310.1| NAD-dependent DNA ligase LigA [Brucella sp. 83/13]
 gi|306405776|gb|EFM62038.1| DNA ligase, NAD-dependent [Brucella sp. NF 2653]
          Length = 719

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D+P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDSPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|256255361|ref|ZP_05460897.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|261222562|ref|ZP_05936843.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
 gi|260921146|gb|EEX87799.1| NAD-dependent DNA ligase LigA [Brucella ceti B1/94]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|86749131|ref|YP_485627.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
 gi|123004307|sp|Q2IYJ4|DNLJ_RHOP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86572159|gb|ABD06716.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris HaA2]
          Length = 714

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 37/71 (52%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A  + +L+K +A +E   L      H   YY+ D P  +D  YD +  RL+A++ +FPEL
Sbjct: 8   APDIATLTKAKAKVEAMRLRLEIERHNSAYYQHDAPTVSDAEYDALRRRLEAIEAKFPEL 67

Query: 108 FDEDHPWNTVG 118
                P  TVG
Sbjct: 68  VSASSPTQTVG 78


>gi|294852747|ref|ZP_06793420.1| DNA ligase [Brucella sp. NVSL 07-0026]
 gi|294821336|gb|EFG38335.1| DNA ligase [Brucella sp. NVSL 07-0026]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|225852902|ref|YP_002733135.1| NAD-dependent DNA ligase LigA [Brucella melitensis ATCC 23457]
 gi|256263616|ref|ZP_05466148.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|254781270|sp|C0RE59|DNLJ_BRUMB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225641267|gb|ACO01181.1| DNA ligase, NAD-dependent [Brucella melitensis ATCC 23457]
 gi|263093668|gb|EEZ17673.1| DNA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409444|gb|ADZ66509.1| NAD-dependent DNA ligase LigA [Brucella melitensis M28]
 gi|326539150|gb|ADZ87365.1| DNA ligase, NAD-dependent [Brucella melitensis M5-90]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|256061478|ref|ZP_05451622.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261325484|ref|ZP_05964681.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
 gi|261301464|gb|EEY04961.1| NAD-dependent DNA ligase LigA [Brucella neotomae 5K33]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|254702142|ref|ZP_05163970.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261752711|ref|ZP_05996420.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
 gi|261742464|gb|EEY30390.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 5 str. 513]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|148560656|ref|YP_001259312.1| NAD-dependent DNA ligase LigA [Brucella ovis ATCC 25840]
 gi|166215401|sp|A5VRG5|DNLJ_BRUO2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148371913|gb|ABQ61892.1| DNA ligase, NAD-dependent [Brucella ovis ATCC 25840]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|17986872|ref|NP_539506.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str. 16M]
 gi|256045051|ref|ZP_05447952.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565350|ref|ZP_05835834.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265991477|ref|ZP_06104034.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|81852173|sp|Q8YI56|DNLJ_BRUME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|17982511|gb|AAL51770.1| nad-dependent DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|260151418|gb|EEW86512.1| DNA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|263002261|gb|EEZ14836.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|23502291|ref|NP_698418.1| NAD-dependent DNA ligase LigA [Brucella suis 1330]
 gi|62290313|ref|YP_222106.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 1 str. 9-941]
 gi|82700237|ref|YP_414811.1| NAD-dependent DNA ligase LigA [Brucella melitensis biovar Abortus
           2308]
 gi|161619368|ref|YP_001593255.1| NAD-dependent DNA ligase LigA [Brucella canis ATCC 23365]
 gi|163843675|ref|YP_001628079.1| NAD-dependent DNA ligase LigA [Brucella suis ATCC 23445]
 gi|189024547|ref|YP_001935315.1| NAD-dependent DNA ligase LigA [Brucella abortus S19]
 gi|225627871|ref|ZP_03785908.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|254689615|ref|ZP_05152869.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|254694105|ref|ZP_05155933.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|254697757|ref|ZP_05159585.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704678|ref|ZP_05166506.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|254708093|ref|ZP_05169921.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|254710462|ref|ZP_05172273.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|254730646|ref|ZP_05189224.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|256031956|ref|ZP_05445570.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|256113974|ref|ZP_05454757.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160155|ref|ZP_05457849.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|256257864|ref|ZP_05463400.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|256369836|ref|YP_003107347.1| DNA ligase [Brucella microti CCM 4915]
 gi|260169093|ref|ZP_05755904.1| NAD-dependent DNA ligase LigA [Brucella sp. F5/99]
 gi|260546856|ref|ZP_05822595.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260566074|ref|ZP_05836544.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260755142|ref|ZP_05867490.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260758361|ref|ZP_05870709.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260762187|ref|ZP_05874530.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884154|ref|ZP_05895768.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|261214403|ref|ZP_05928684.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261315595|ref|ZP_05954792.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261318033|ref|ZP_05957230.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261755371|ref|ZP_05999080.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|261758598|ref|ZP_06002307.1| DNA ligase [Brucella sp. F5/99]
 gi|265989064|ref|ZP_06101621.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|265995315|ref|ZP_06107872.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998527|ref|ZP_06111084.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|297248700|ref|ZP_06932418.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
 gi|75496544|sp|Q57C89|DNLJ_BRUAB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81752355|sp|Q8FZQ3|DNLJ_BRUSU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123768412|sp|Q2YLZ6|DNLJ_BRUA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359236|sp|A9M679|DNLJ_BRUC2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359237|sp|B0CHK8|DNLJ_BRUSI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781269|sp|B2S6P4|DNLJ_BRUA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|23348266|gb|AAN30333.1| DNA ligase, NAD-dependent [Brucella suis 1330]
 gi|62196445|gb|AAX74745.1| LigA, DNA ligase, NAD-dependent [Brucella abortus bv. 1 str. 9-941]
 gi|82616338|emb|CAJ11395.1| BRCT domain:NAD-dependent DNA ligase:ATP/GTP-binding site motif A
           (P-loop):Zn-finger in NAD-dependent DNA ligase, C4
           type:NAD [Brucella melitensis biovar Abortus 2308]
 gi|161336179|gb|ABX62484.1| DNA ligase, NAD-dependent [Brucella canis ATCC 23365]
 gi|163674398|gb|ABY38509.1| DNA ligase, NAD-dependent [Brucella suis ATCC 23445]
 gi|189020119|gb|ACD72841.1| DNA ligase [Brucella abortus S19]
 gi|225617876|gb|EEH14921.1| DNA ligase, NAD-dependent [Brucella ceti str. Cudo]
 gi|255999999|gb|ACU48398.1| DNA ligase [Brucella microti CCM 4915]
 gi|260095906|gb|EEW79783.1| DNA ligase [Brucella abortus NCTC 8038]
 gi|260155592|gb|EEW90672.1| DNA ligase [Brucella suis bv. 4 str. 40]
 gi|260668679|gb|EEX55619.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 4 str. 292]
 gi|260672619|gb|EEX59440.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675250|gb|EEX62071.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 6 str. 870]
 gi|260873682|gb|EEX80751.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 9 str. C68]
 gi|260916010|gb|EEX82871.1| NAD-dependent DNA ligase LigA [Brucella abortus bv. 3 str. Tulya]
 gi|261297256|gb|EEY00753.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis B2/94]
 gi|261304621|gb|EEY08118.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M163/99/10]
 gi|261738582|gb|EEY26578.1| DNA ligase [Brucella sp. F5/99]
 gi|261745124|gb|EEY33050.1| NAD-dependent DNA ligase LigA [Brucella suis bv. 3 str. 686]
 gi|262553151|gb|EEZ08985.1| NAD-dependent DNA ligase LigA [Brucella ceti M490/95/1]
 gi|262766428|gb|EEZ12217.1| NAD-dependent DNA ligase LigA [Brucella melitensis bv. 3 str.
           Ether]
 gi|264661261|gb|EEZ31522.1| NAD-dependent DNA ligase LigA [Brucella pinnipedialis M292/94/1]
 gi|297175869|gb|EFH35216.1| DNA ligase, NAD-dependent [Brucella abortus bv. 5 str. B3196]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|27381702|ref|NP_773231.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
 gi|81735382|sp|Q89FV8|DNLJ_BRAJA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|27354871|dbj|BAC51856.1| DNA ligase [Bradyrhizobium japonicum USDA 110]
          Length = 716

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALH---HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           + V  L+K +A +E   L+++AL    H K YY+ D P  TD  YD + +R +A++++FP
Sbjct: 12  RDVAELTKAQAKVE---LMRLALELEGHDKRYYQDDAPTVTDAEYDALRQRFNAIEKRFP 68

Query: 106 ELFDEDHPWNTVG 118
           E    + P   VG
Sbjct: 69  EFVSAESPSQKVG 81


>gi|254714455|ref|ZP_05176266.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|254717353|ref|ZP_05179164.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261219183|ref|ZP_05933464.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261322244|ref|ZP_05961441.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
 gi|260924272|gb|EEX90840.1| NAD-dependent DNA ligase LigA [Brucella ceti M13/05/1]
 gi|261294934|gb|EEX98430.1| NAD-dependent DNA ligase LigA [Brucella ceti M644/93/1]
          Length = 719

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 6   VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSRRVG 73


>gi|119717662|ref|YP_924627.1| DNA ligase, NAD-dependent [Nocardioides sp. JS614]
 gi|166216220|sp|A1SMA5|DNLJ_NOCSJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119538323|gb|ABL82940.1| DNA ligase, NAD-dependent [Nocardioides sp. JS614]
          Length = 752

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 62  EVEYLVKIALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E   L+   +   +W YY LD+P   D  +DR   RL+AL+E+FPEL   D P  TVG
Sbjct: 65  EEHRLIAEEIEEARWRYYVLDSPTIDDADFDRRMRRLEALEEEFPELRTPDSPTQTVG 122


>gi|260892973|ref|YP_003239070.1| DNA ligase, NAD-dependent [Ammonifex degensii KC4]
 gi|260865114|gb|ACX52220.1| DNA ligase, NAD-dependent [Ammonifex degensii KC4]
          Length = 672

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LSK EA   +E L +   +H   YY LD+P+ +D  YDR+   L AL+E FPE    + P
Sbjct: 5   LSKEEAKRRIEELRREIAYHDYRYYVLDSPVISDAEYDRLVLELMALEEAFPEFITPNSP 64

Query: 114 WNTVG 118
              VG
Sbjct: 65  TQRVG 69


>gi|237815820|ref|ZP_04594817.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
 gi|237789118|gb|EEP63329.1| DNA ligase, NAD-dependent [Brucella abortus str. 2308 A]
          Length = 725

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  +
Sbjct: 12  VEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVRD 71

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 72  DSPSRRVG 79


>gi|75675255|ref|YP_317676.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
 gi|123773282|sp|Q3STR7|DNLJ_NITWN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|74420125|gb|ABA04324.1| NAD-dependent DNA ligase [Nitrobacter winogradskyi Nb-255]
          Length = 716

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V SL++ +A +E + L      H + YY+ D P  +D  YD +  RL+A++ +FP+L   
Sbjct: 11  VDSLTRSQARVEHKRLALEIETHNERYYQQDAPTVSDATYDALQRRLEAIEARFPDLVTA 70

Query: 111 DHPWNTVG 118
             P  TVG
Sbjct: 71  SSPTQTVG 78


>gi|85708859|ref|ZP_01039925.1| DNA ligase [Erythrobacter sp. NAP1]
 gi|85690393|gb|EAQ30396.1| DNA ligase [Erythrobacter sp. NAP1]
          Length = 698

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%)

Query: 42  ESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQ 101
           ES    A  V+ +S+ +A  E+  L K   HH + Y+  D+P  +D  YD +  R   L+
Sbjct: 5   ESAEVSANPVSQMSEADAANELMRLAKQIAHHDRLYHADDDPEISDQEYDALVRRNRELE 64

Query: 102 EQFPELFDEDHPWNTVGY 119
           E FP+L  ED P   VG+
Sbjct: 65  EAFPQLVREDSPSKRVGH 82


>gi|13471538|ref|NP_103104.1| DNA ligase [Mesorhizobium loti MAFF303099]
 gi|75543387|sp|Q98KC4|DNLJ_RHILO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|14022280|dbj|BAB48890.1| DNA ligase [Mesorhizobium loti MAFF303099]
          Length = 734

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 38/70 (54%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V SLS+ EA  E++ L +    H + Y+  D P  TD  YD +  R  A++E+FP L 
Sbjct: 4   KPVDSLSESEAEAELKRLAEEIAGHDRRYHAEDAPTITDAEYDALRRRNLAIEERFPGLV 63

Query: 109 DEDHPWNTVG 118
            ED P   VG
Sbjct: 64  REDSPSRRVG 73


>gi|260462100|ref|ZP_05810344.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
 gi|259031960|gb|EEW33227.1| DNA ligase, NAD-dependent [Mesorhizobium opportunistum WSM2075]
          Length = 734

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 38/70 (54%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V SLS+ EA  E++ L +    H + Y+  D P  TD  YD +  R  A++E+FP L 
Sbjct: 4   KPVDSLSESEAEAELQRLAEEIAEHDRRYHTEDAPTITDAEYDALRRRNLAIEERFPGLV 63

Query: 109 DEDHPWNTVG 118
            ED P   VG
Sbjct: 64  REDSPSLRVG 73


>gi|90424785|ref|YP_533155.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB18]
 gi|123275077|sp|Q211V0|DNLJ_RHOPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|90106799|gb|ABD88836.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB18]
          Length = 795

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 37/66 (56%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +LSK +A +E++ L      H   YY+ D P  +D  YD +  R++A++ +FPEL   D 
Sbjct: 14  TLSKAKAKVELKRLSLEIERHNNAYYQDDAPKISDAEYDALRHRVEAIEAKFPELVSSDS 73

Query: 113 PWNTVG 118
           P   VG
Sbjct: 74  PTQKVG 79


>gi|227822641|ref|YP_002826613.1| NAD-dependent DNA ligase LigA [Sinorhizobium fredii NGR234]
 gi|254781400|sp|C3MEL9|DNLJ_RHISN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|227341642|gb|ACP25860.1| DNA ligase [Sinorhizobium fredii NGR234]
          Length = 717

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 38/74 (51%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L++ K V  L++ EA  E+ +LV     H   Y+  D P  +D  YD +  R D ++E F
Sbjct: 2   LNEKKPVEQLTETEAAEELAFLVTELARHDALYHGQDAPEISDADYDALKRRNDLIEELF 61

Query: 105 PELFDEDHPWNTVG 118
           P L  ED P   +G
Sbjct: 62  PALIREDSPSRKIG 75


>gi|326570074|gb|EGE20120.1| NAD-dependent DNA ligase [Moraxella catarrhalis BC7]
          Length = 691

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 38/73 (52%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           + +K   S +  + + ++  L+K+   H   YY +D P  +DG YD +   L  L++Q P
Sbjct: 10  NTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDGEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|91977847|ref|YP_570506.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
 gi|123735250|sp|Q133Y4|DNLJ_RHOPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91684303|gb|ABE40605.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisB5]
          Length = 714

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 37/71 (52%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A  +  L+K +A +E+  L      H K YY+ D P   D  YD +  RL+A++ +FPEL
Sbjct: 9   APDIDKLTKPKAKVELMRLRLAIEGHDKAYYQDDAPKIPDADYDALRRRLEAIEAKFPEL 68

Query: 108 FDEDHPWNTVG 118
                P  TVG
Sbjct: 69  LSASSPSQTVG 79


>gi|53803401|ref|YP_114852.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
 gi|81681278|sp|Q604U8|DNLJ_METCA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|53757162|gb|AAU91453.1| DNA ligase, NAD-dependent [Methylococcus capsulatus str. Bath]
          Length = 673

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/46 (47%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YYRLD+PL TD  YDR+   L A++ ++PEL   D P   VG
Sbjct: 21  HNVRYYRLDDPLITDAEYDRLMAELLAIEARYPELVTPDSPTQRVG 66


>gi|320354711|ref|YP_004196050.1| NAD-dependent DNA ligase [Desulfobulbus propionicus DSM 2032]
 gi|320123213|gb|ADW18759.1| DNA ligase, NAD-dependent [Desulfobulbus propionicus DSM 2032]
          Length = 670

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + KG A   +E L      H   YY LD+P+ +DG YD +   L AL++++PEL   D P
Sbjct: 1   MDKGRAADRLEELRGQLRFHAHRYYVLDDPIISDGEYDALFRELLALEQEYPELVTADSP 60

Query: 114 WNTVG 118
            + VG
Sbjct: 61  SHRVG 65


>gi|184157078|ref|YP_001845417.1| NAD-dependent DNA ligase [Acinetobacter baumannii ACICU]
 gi|254778156|sp|B2HUJ5|DNLJ_ACIBC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|183208672|gb|ACC56070.1| NAD-dependent DNA ligase [Acinetobacter baumannii ACICU]
          Length = 673

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 60  MIE-VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           MIE +  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 1   MIEQMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 60


>gi|153009084|ref|YP_001370299.1| NAD-dependent DNA ligase LigA [Ochrobactrum anthropi ATCC 49188]
 gi|166216221|sp|A6WZR6|DNLJ_OCHA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151560972|gb|ABS14470.1| DNA ligase, NAD-dependent [Ochrobactrum anthropi ATCC 49188]
          Length = 721

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 37/68 (54%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA+ E+E L +   HH + Y+  D P  +D  YD +  R DA++ +FP L   
Sbjct: 6   VEKLTEPEAVSELERLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLVRT 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSLRVG 73


>gi|261884935|ref|ZP_06008974.1| NAD-dependent DNA ligase LigA [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 195

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
            V  L++ EA  E+E L +   HH + Y+  D P  +D  YD +  R +A++  FP L  
Sbjct: 5   SVEKLTELEAAAELERLARAIAHHDELYHAKDRPEISDAAYDALKRRNEAIEAHFPALVR 64

Query: 110 EDHPWNTVG 118
           +D P   VG
Sbjct: 65  DDSPSRRVG 73


>gi|154252874|ref|YP_001413698.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
 gi|190359267|sp|A7HVV8|DNLJ_PARL1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154156824|gb|ABS64041.1| DNA ligase, NAD-dependent [Parvibaculum lavamentivorans DS-1]
          Length = 710

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 38/70 (54%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V  L+  EA  E+E L      H K YY+ D P  +D  YD +  R +A++ ++PEL 
Sbjct: 15  KDVDHLTLEEAPEELERLAAEIEKHDKLYYQKDAPRISDAEYDTLRRRNEAIEARYPELV 74

Query: 109 DEDHPWNTVG 118
            ED P + VG
Sbjct: 75  REDSPSHRVG 84


>gi|293391716|ref|ZP_06636050.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952250|gb|EFE02369.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 671

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K   HH+  Y+ LD+P   D  YDR+  +L AL++Q PEL   D P   VG
Sbjct: 8   QIDDLRKTLRHHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELVTADSPTQRVG 64


>gi|261868202|ref|YP_003256124.1| NAD-dependent DNA ligase LigA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413534|gb|ACX82905.1| DNA ligase, NAD-dependent [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 670

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K   HH+  Y+ LD+P   D  YDR+  +L AL++Q PEL   D P   VG
Sbjct: 8   QIDDLRKTLRHHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELVTADSPTQRVG 64


>gi|332852097|ref|ZP_08433924.1| DNA ligase [Acinetobacter baumannii 6013150]
 gi|332867495|ref|ZP_08437648.1| DNA ligase [Acinetobacter baumannii 6013113]
 gi|332872654|ref|ZP_08440622.1| DNA ligase [Acinetobacter baumannii 6014059]
 gi|332729469|gb|EGJ60808.1| DNA ligase [Acinetobacter baumannii 6013150]
 gi|332733912|gb|EGJ65057.1| DNA ligase [Acinetobacter baumannii 6013113]
 gi|332739183|gb|EGJ70042.1| DNA ligase [Acinetobacter baumannii 6014059]
          Length = 683

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 14  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 70


>gi|323702801|ref|ZP_08114460.1| DNA ligase, NAD-dependent [Desulfotomaculum nigrificans DSM 574]
 gi|323532189|gb|EGB22069.1| DNA ligase, NAD-dependent [Desulfotomaculum nigrificans DSM 574]
          Length = 669

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 32/61 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E    VE L +   +H   YY LDNP  TDG YD++ + L  L+  +PEL   D P   V
Sbjct: 7   EIKARVEELRREINYHNHQYYVLDNPTITDGQYDQLVQELLRLENAYPELVSPDSPTQRV 66

Query: 118 G 118
           G
Sbjct: 67  G 67


>gi|260550982|ref|ZP_05825187.1| DNA ligase [Acinetobacter sp. RUH2624]
 gi|260405930|gb|EEW99417.1| DNA ligase [Acinetobacter sp. RUH2624]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 22  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQTDSPTTKVG 78


>gi|239501241|ref|ZP_04660551.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB900]
          Length = 678

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 65


>gi|213156587|ref|YP_002318248.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB0057]
 gi|215484469|ref|YP_002326704.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB307-0294]
 gi|301347734|ref|ZP_07228475.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB056]
 gi|301512482|ref|ZP_07237719.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB058]
 gi|301594386|ref|ZP_07239394.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB059]
 gi|221222446|sp|A3M2U3|DNLJ_ACIBT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254778154|sp|B7GZ71|DNLJ_ACIB3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254778155|sp|B7I790|DNLJ_ACIB5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781253|sp|B0V8E4|DNLJ_ACIBY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193076578|gb|ABO11237.2| DNA ligase [Acinetobacter baumannii ATCC 17978]
 gi|213055747|gb|ACJ40649.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB0057]
 gi|213986610|gb|ACJ56909.1| DNA ligase, NAD-dependent [Acinetobacter baumannii AB307-0294]
          Length = 678

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 65


>gi|169797009|ref|YP_001714802.1| DNA ligase [Acinetobacter baumannii AYE]
 gi|169149936|emb|CAM87830.1| DNA ligase [Acinetobacter baumannii AYE]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 22  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 78


>gi|37525354|ref|NP_928698.1| NAD-dependent DNA ligase LigA [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81416713|sp|Q7MBH2|DNLJ_PHOLL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|36784781|emb|CAE13691.1| DNA ligase (polydeoxyribonucleotide synthase [NAD+]) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 672

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L     HH+  Y+ +D P   D  YDR+ + L  L+EQ+PEL   D P   +G
Sbjct: 7   QIEKLRTTLRHHEYLYHVMDAPEIPDAEYDRLMQELQDLEEQYPELITSDSPTQRIG 63


>gi|294635487|ref|ZP_06713972.1| DNA ligase, NAD-dependent [Edwardsiella tarda ATCC 23685]
 gi|291091145|gb|EFE23706.1| DNA ligase, NAD-dependent [Edwardsiella tarda ATCC 23685]
          Length = 675

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L     HH+  YY LD P  TD  YDR+  +L AL+  +P+L   D P   VG
Sbjct: 8   QLEQLRAALRHHEYQYYVLDEPQVTDAEYDRLMMQLKALESDYPQLVTADSPSQRVG 64


>gi|227543584|ref|ZP_03973633.1| DNA ligase, NAD-dependent [Lactobacillus reuteri CF48-3A]
 gi|300909387|ref|ZP_07126848.1| NAD-dependent DNA ligase LigA [Lactobacillus reuteri SD2112]
 gi|227186424|gb|EEI66495.1| DNA ligase, NAD-dependent [Lactobacillus reuteri CF48-3A]
 gi|300893252|gb|EFK86611.1| NAD-dependent DNA ligase LigA [Lactobacillus reuteri SD2112]
          Length = 680

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 36/72 (50%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           K   V  L+  EA  E++ L        K YY  DNP   D +YDR  +RL  L+EQFP+
Sbjct: 4   KQTPVKELTLQEAQDEIKPLRAKLTEWGKEYYEQDNPTVEDHVYDRAYQRLVQLEEQFPQ 63

Query: 107 LFDEDHPWNTVG 118
           L   D P   VG
Sbjct: 64  LLSADSPTQRVG 75


>gi|296132371|ref|YP_003639618.1| DNA ligase, NAD-dependent [Thermincola sp. JR]
 gi|296030949|gb|ADG81717.1| DNA ligase, NAD-dependent [Thermincola potens JR]
          Length = 665

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A   +  L K    H  +YY LD P  TD  YDR+   L  L++Q+P+L   D P
Sbjct: 1   MDKAAAAKRINELRKQIEEHNYYYYVLDRPRITDAEYDRLMRELTELEQQYPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|296126514|ref|YP_003633766.1| DNA ligase, NAD-dependent [Brachyspira murdochii DSM 12563]
 gi|296018330|gb|ADG71567.1| DNA ligase, NAD-dependent [Brachyspira murdochii DSM 12563]
          Length = 663

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++K EA  +++ L +   +H K YY  DNP   D  YD++   L+ L+ +FPEL  +D P
Sbjct: 1   MNKEEAKQKIKQLTETINYHNKLYYTDDNPEIEDYEYDKLFRELENLEREFPELKKDDSP 60

Query: 114 WNTVG 118
            N VG
Sbjct: 61  TNKVG 65


>gi|262373317|ref|ZP_06066596.1| DNA ligase, NAD-dependent [Acinetobacter junii SH205]
 gi|262313342|gb|EEY94427.1| DNA ligase, NAD-dependent [Acinetobacter junii SH205]
          Length = 677

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  TD  YD +  +L AL++Q+PE    D P N VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTITDSEYDHLFHQLKALEQQYPEFMQADTPTNKVG 65


>gi|149184723|ref|ZP_01863041.1| DNA ligase [Erythrobacter sp. SD-21]
 gi|148832043|gb|EDL50476.1| DNA ligase [Erythrobacter sp. SD-21]
          Length = 690

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 36/72 (50%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A K   +++ EA  E+  L +    H K Y+  D P  TD  +D +  R   L+EQFP L
Sbjct: 3   ASKPVDMTEAEAANELMRLARAIAKHNKLYHAEDAPEITDQEFDALVRRNAELEEQFPHL 62

Query: 108 FDEDHPWNTVGY 119
             ED P   VG+
Sbjct: 63  VREDSPSKVVGH 74


>gi|326574755|gb|EGE24691.1| NAD-dependent DNA ligase [Moraxella catarrhalis 101P30B1]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|326572929|gb|EGE22914.1| NAD-dependent DNA ligase [Moraxella catarrhalis CO72]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|326569993|gb|EGE20040.1| NAD-dependent DNA ligase [Moraxella catarrhalis BC1]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|326564268|gb|EGE14498.1| NAD-dependent DNA ligase [Moraxella catarrhalis 103P14B1]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|296113927|ref|YP_003627865.1| NAD-dependent DNA ligase [Moraxella catarrhalis RH4]
 gi|295921621|gb|ADG61972.1| NAD-dependent DNA ligase [Moraxella catarrhalis RH4]
          Length = 691

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  DTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|194466912|ref|ZP_03072899.1| DNA ligase, NAD-dependent [Lactobacillus reuteri 100-23]
 gi|194453948|gb|EDX42845.1| DNA ligase, NAD-dependent [Lactobacillus reuteri 100-23]
          Length = 680

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           +K   V  L+  EA  E++ L        K YY  DNP   D +YDR  +RL  L+EQFP
Sbjct: 3   EKQTPVKELTLQEAQDEIKPLRAKLTKWGKEYYEQDNPTVEDHVYDRAYQRLVQLEEQFP 62

Query: 106 ELFDEDHPWNTVG 118
           +L   D P   VG
Sbjct: 63  QLVSADSPTQRVG 75


>gi|148544657|ref|YP_001272027.1| DNA ligase, NAD-dependent [Lactobacillus reuteri DSM 20016]
 gi|184154010|ref|YP_001842351.1| NAD-dependent DNA ligase [Lactobacillus reuteri JCM 1112]
 gi|227363780|ref|ZP_03847887.1| DNA ligase, NAD-dependent [Lactobacillus reuteri MM2-3]
 gi|325682991|ref|ZP_08162507.1| NAD-dependent DNA ligase LigA [Lactobacillus reuteri MM4-1A]
 gi|209572830|sp|A5VLG6|DNLJ_LACRD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781354|sp|B2G8T9|DNLJ_LACRJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148531691|gb|ABQ83690.1| DNA ligase, NAD-dependent [Lactobacillus reuteri DSM 20016]
 gi|183225354|dbj|BAG25871.1| NAD-dependent DNA ligase [Lactobacillus reuteri JCM 1112]
 gi|227071137|gb|EEI09453.1| DNA ligase, NAD-dependent [Lactobacillus reuteri MM2-3]
 gi|324977341|gb|EGC14292.1| NAD-dependent DNA ligase LigA [Lactobacillus reuteri MM4-1A]
          Length = 680

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           +K   V  L+  EA  E++ L        K YY  DNP   D +YDR  +RL  L+EQFP
Sbjct: 3   EKQTPVKELTLQEAQDEIKPLRAKLTKWGKEYYEQDNPTVEDHVYDRAYQRLVQLEEQFP 62

Query: 106 ELFDEDHPWNTVG 118
           +L   D P   VG
Sbjct: 63  QLVSADSPTQRVG 75


>gi|300870442|ref|YP_003785313.1| NAD-dependent DNA ligase [Brachyspira pilosicoli 95/1000]
 gi|300688141|gb|ADK30812.1| NAD-dependent DNA ligase [Brachyspira pilosicoli 95/1000]
          Length = 663

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA  ++E L     +H K YY  DNP   D  YD++   L+ L+ +FPEL  +D P N V
Sbjct: 5   EARKKIEQLTATINYHNKLYYTDDNPEIEDYEYDKLFRELENLEREFPELKKDDSPTNKV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|126640855|ref|YP_001083839.1| DNA ligase [Acinetobacter baumannii ATCC 17978]
 gi|322506977|gb|ADX02431.1| DNA ligase [Acinetobacter baumannii 1656-2]
 gi|323516844|gb|ADX91225.1| DNA ligase, NAD-dependent [Acinetobacter baumannii TCDC-AB0715]
          Length = 669

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 4   LIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTTKVG 56


>gi|225620892|ref|YP_002722150.1| NAD-dependent DNA ligase LigA [Brachyspira hyodysenteriae WA1]
 gi|254781267|sp|C0QVE5|DNLJ_BRAHW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225215712|gb|ACN84446.1| NAD-dependent DNA ligase LigA [Brachyspira hyodysenteriae WA1]
          Length = 663

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   +E L +   +H K YY  DNP   D  YD++   L+ L+ +FPEL  +D P N V
Sbjct: 5   EAKQRIEQLTETINYHNKLYYTDDNPEIEDYEYDKLFRELENLEREFPELKKDDSPTNKV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|183981708|ref|YP_001849999.1| NAD-dependent DNA ligase LigA [Mycobacterium marinum M]
 gi|254781377|sp|B2HIF0|DNLJ_MYCMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|183175034|gb|ACC40144.1| DNA ligase [NAD dependent] LigA [Mycobacterium marinum M]
          Length = 687

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ TD  +D +  RL+AL+EQ+PEL   D P   V
Sbjct: 4   EVLRQWQELAEQVREHQFRYYVRDAPVITDAEFDELLRRLEALEEQYPELRTPDSPTQLV 63

Query: 118 G 118
           G
Sbjct: 64  G 64


>gi|82913524|ref|XP_728678.1| NAD-dependent DNA ligase [Plasmodium yoelii yoelii str. 17XNL]
 gi|23485151|gb|EAA20243.1| DNA ligase, NAD-dependent, putative [Plasmodium yoelii yoelii]
          Length = 354

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YYRLD+PL TD  YDR+   L A++ ++PEL   D P   VG
Sbjct: 201 HNVRYYRLDDPLITDAEYDRLMAELLAIEARYPELVTPDSPTQRVG 246


>gi|291569184|dbj|BAI91456.1| DNA ligase [Arthrospira platensis NIES-39]
          Length = 683

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P+  DG+YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 30  YYVLDDPIMEDGVYDRLYRELQELENQYPELISPDSPTQRVG 71


>gi|257454409|ref|ZP_05619671.1| DNA ligase, NAD-dependent [Enhydrobacter aerosaccus SK60]
 gi|257448175|gb|EEV23156.1| DNA ligase, NAD-dependent [Enhydrobacter aerosaccus SK60]
          Length = 675

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LDNPL  D  YD++ + L AL+  +P+L   D P N VG
Sbjct: 21  QHNHAYYVLDNPLLEDSEYDQLRQELVALETAYPQLVQSDSPTNQVG 67


>gi|319899147|ref|YP_004159240.1| DNA ligase [Bartonella clarridgeiae 73]
 gi|319403111|emb|CBI76669.1| DNA ligase [Bartonella clarridgeiae 73]
          Length = 718

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D  K +T+L   EA  E+E+L K    H   YYR D P  +D  YD +  R  A++  FP
Sbjct: 4   DVIKNLTAL---EAASELEWLAKEIARHDVLYYRDDQPEISDAEYDALRRRNGAIENLFP 60

Query: 106 ELFDEDHPWNTVG 118
           EL   D P   +G
Sbjct: 61  ELIRADSPTFKIG 73


>gi|253988889|ref|YP_003040245.1| NAD-dependent DNA ligase LigA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780339|emb|CAQ83500.1| DNA ligase [Photorhabdus asymbiotica]
          Length = 672

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L K   HH+  Y+ +D P  +D  YDR+ + L  L+ Q PEL   D P   VG
Sbjct: 7   QIENLRKTLRHHEYLYHVMDAPEISDAEYDRLMQELKTLEGQHPELITSDSPTQRVG 63


>gi|116626792|ref|YP_828948.1| DNA ligase, NAD-dependent [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122251346|sp|Q01NV7|DNLJ_SOLUE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116229954|gb|ABJ88663.1| DNA ligase, NAD-dependent [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 662

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E+E L +   HH+  YY LD P  TD  YD +  RL  L+ + P+L   D P   VG
Sbjct: 6   VEIEKLREQLHHHEHLYYVLDKPEITDAEYDALMHRLQELETKHPDLLTPDSPTQRVG 63


>gi|73748436|ref|YP_307675.1| DNA ligase, NAD-dependent [Dehalococcoides sp. CBDB1]
 gi|123759761|sp|Q3ZX08|DNLJ_DEHSC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|73660152|emb|CAI82759.1| DNA ligase, NAD-dependent [Dehalococcoides sp. CBDB1]
          Length = 677

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 31/59 (52%)

Query: 60  MIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +IEVE L +    H + YY  DNP  +D  YD +  RL  L+E  PEL   D P   VG
Sbjct: 5   LIEVENLRREINRHNQLYYVQDNPEISDAQYDTLIRRLKELEEAHPELVTPDSPTQKVG 63


>gi|289432483|ref|YP_003462356.1| DNA ligase, NAD-dependent [Dehalococcoides sp. GT]
 gi|288946203|gb|ADC73900.1| DNA ligase, NAD-dependent [Dehalococcoides sp. GT]
          Length = 680

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 31/59 (52%)

Query: 60  MIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +IEVE L +    H + YY  DNP  +D  YD +  RL  L+E  PEL   D P   VG
Sbjct: 8   LIEVENLRREINRHNQLYYVQDNPEISDAQYDTLISRLKELEEAHPELVTPDSPTQKVG 66


>gi|326562480|gb|EGE12798.1| NAD-dependent DNA ligase [Moraxella catarrhalis 46P47B1]
 gi|326567201|gb|EGE17321.1| NAD-dependent DNA ligase [Moraxella catarrhalis 12P80B1]
 gi|326568292|gb|EGE18374.1| NAD-dependent DNA ligase [Moraxella catarrhalis BC8]
          Length = 691

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 38/73 (52%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           + +K   S +  + + ++  L+K+   H   YY +D P  +DG YD +   L  L++Q P
Sbjct: 10  NTSKNNPSKANDQIIAQMCALIKLLKRHNHAYYVMDAPTISDGEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|260555699|ref|ZP_05827919.1| DNA ligase, NAD-dependent [Acinetobacter baumannii ATCC 19606]
 gi|260410610|gb|EEX03908.1| DNA ligase, NAD-dependent [Acinetobacter baumannii ATCC 19606]
          Length = 691

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PEL   D P   VG
Sbjct: 22  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPELVQADSPTMKVG 78


>gi|147669216|ref|YP_001214034.1| DNA ligase, NAD-dependent [Dehalococcoides sp. BAV1]
 gi|190359250|sp|A5FRL4|DNLJ_DEHSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146270164|gb|ABQ17156.1| DNA ligase, NAD-dependent [Dehalococcoides sp. BAV1]
          Length = 680

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 31/59 (52%)

Query: 60  MIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +IEVE L +    H + YY  DNP  +D  YD +  RL  L+E  PEL   D P   VG
Sbjct: 8   LIEVENLRREINRHNQLYYVQDNPEISDAQYDTLIRRLKELEEAHPELVTPDSPTQRVG 66


>gi|169630426|ref|YP_001704075.1| NAD-dependent DNA ligase LigA [Mycobacterium abscessus ATCC 19977]
 gi|254781373|sp|B1MDV2|DNLJ_MYCA9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169242393|emb|CAM63421.1| DNA ligase (polydeoxyribonucleotide synthase NAD+) [Mycobacterium
           abscessus]
          Length = 681

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/46 (47%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +DG +D +  RL AL+EQ+PEL   D P   VG
Sbjct: 19  HQFRYYVKDAPVISDGQFDELLRRLTALEEQYPELRTPDSPTQLVG 64


>gi|154245706|ref|YP_001416664.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
 gi|254782313|sp|A7IG64|DNLJ_XANP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154159791|gb|ABS67007.1| DNA ligase, NAD-dependent [Xanthobacter autotrophicus Py2]
          Length = 720

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 37/72 (51%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +A  V  LS  EA  E + L +    H   YYR D P+ +D  YD +  R +A++E+FP 
Sbjct: 17  RAIPVDDLSPAEAASEHKALAQEITGHDAAYYREDAPVVSDAEYDALRHRYEAIEERFPG 76

Query: 107 LFDEDHPWNTVG 118
           L  ED     VG
Sbjct: 77  LRGEDSLSEKVG 88


>gi|85859410|ref|YP_461612.1| NAD-dependent DNA ligase [Syntrophus aciditrophicus SB]
 gi|123738818|sp|Q2LTN8|DNLJ_SYNAS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|85722501|gb|ABC77444.1| NAD-dependent DNA ligase [Syntrophus aciditrophicus SB]
          Length = 672

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H + YY+LD+P  +D  YD + + L AL++QFP+   ED P   +G
Sbjct: 20  YHNRRYYQLDDPEISDAEYDSLLQELIALEKQFPQWLTEDSPSRRIG 66


>gi|71064896|ref|YP_263623.1| NAD dependent DNA ligase [Psychrobacter arcticus 273-4]
 gi|123734475|sp|Q4FUW9|DNLJ_PSYA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71037881|gb|AAZ18189.1| probable NAD dependent DNA ligase [Psychrobacter arcticus 273-4]
          Length = 691

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +D AK +T+      + ++   +     H   YY LDNP+  D  YD++   L  L+E++
Sbjct: 13  IDTAKPITN--DDAIVTQMRTFIDTLKQHNYAYYVLDNPILEDSEYDQLRRSLLELEEEY 70

Query: 105 PELFDEDHPWNTVG 118
           P+L   D P N VG
Sbjct: 71  PDLVQPDSPINQVG 84


>gi|238752012|ref|ZP_04613496.1| DNA ligase [Yersinia rohdei ATCC 43380]
 gi|238709712|gb|EEQ01946.1| DNA ligase [Yersinia rohdei ATCC 43380]
          Length = 670

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 58  EAMIEVEYLVKIAL-HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           E++I+    +K +L HH+  YY LD P   D  YDR+ ++L  L+ Q PEL   D P   
Sbjct: 2   ESIIQQINQLKTSLRHHEHQYYVLDAPEIPDAEYDRMMQQLRELEAQHPELITNDSPTQR 61

Query: 117 VG 118
           VG
Sbjct: 62  VG 63


>gi|293609092|ref|ZP_06691395.1| DNA ligase [Acinetobacter sp. SH024]
 gi|292829665|gb|EFF88027.1| DNA ligase [Acinetobacter sp. SH024]
          Length = 679

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+P+L   D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPDLVQSDSPTTKVG 65


>gi|325121133|gb|ADY80656.1| DNA ligase [Acinetobacter calcoaceticus PHEA-2]
          Length = 679

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+P+L   D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPDLVQSDSPTTKVG 65


>gi|50084060|ref|YP_045570.1| DNA ligase [Acinetobacter sp. ADP1]
 gi|81393600|sp|Q6FDW0|DNLJ_ACIAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49530036|emb|CAG67748.1| DNA ligase [Acinetobacter sp. ADP1]
          Length = 676

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +   + + ++  L+++   H   YY +D P  TD  YD++  +L AL+ ++PEL   D P
Sbjct: 2   MQPADIVAQMRQLIQLIAKHNHAYYVMDQPSITDNEYDQLFHQLKALEAEYPELTQADTP 61

Query: 114 WNTVG 118
            N VG
Sbjct: 62  TNRVG 66


>gi|118617527|ref|YP_905859.1| NAD-dependent DNA ligase LigA [Mycobacterium ulcerans Agy99]
 gi|166216215|sp|A0PPW9|DNLJ_MYCUA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|118569637|gb|ABL04388.1| DNA ligase [NAD dependent] LigA [Mycobacterium ulcerans Agy99]
          Length = 683

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/46 (47%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ TD  +D +  RL+AL+EQ+PEL   D P   VG
Sbjct: 15  HQFRYYVRDAPVITDAEFDELLRRLEALEEQYPELRTPDSPTQLVG 60


>gi|83592275|ref|YP_426027.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
 gi|123753272|sp|Q2RVV5|DNLJ_RHORT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83575189|gb|ABC21740.1| DNA ligase (NAD+) [Rhodospirillum rubrum ATCC 11170]
          Length = 698

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA  E+E L      H + Y++ D P  TDG YD +  R + ++  FPEL   
Sbjct: 4   VADLTEAEAARELERLAAEIARHDRLYHQQDAPEITDGEYDALVRRNNEIEAAFPELVRG 63

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 64  DSPSAHVG 71


>gi|258514074|ref|YP_003190296.1| DNA ligase, NAD-dependent [Desulfotomaculum acetoxidans DSM 771]
 gi|257777779|gb|ACV61673.1| DNA ligase, NAD-dependent [Desulfotomaculum acetoxidans DSM 771]
          Length = 677

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY +DNP+  D  YDR+   L AL++QFP+L  E  P   VG
Sbjct: 20  HNYNYYVMDNPVIGDAEYDRLMLELTALEQQFPDLLSEHSPTQRVG 65


>gi|197105771|ref|YP_002131148.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
 gi|254781386|sp|B4RFE9|DNLJ_PHEZH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|196479191|gb|ACG78719.1| DNA ligase, NAD-dependent [Phenylobacterium zucineum HLK1]
          Length = 692

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 34/70 (48%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V SL++ EA  E+  L      H   YYR D P  +D  YD +  R D L+  FP L 
Sbjct: 2   KSVESLTEAEAAEELTRLADEIAAHDIRYYREDAPTISDAAYDALRRRNDELEAAFPHLI 61

Query: 109 DEDHPWNTVG 118
            E+ P   +G
Sbjct: 62  RENSPSLRIG 71


>gi|224369899|ref|YP_002604063.1| LigA1 [Desulfobacterium autotrophicum HRM2]
 gi|254781310|sp|C0QJ86|DNLJ_DESAH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|223692616|gb|ACN15899.1| LigA1 [Desulfobacterium autotrophicum HRM2]
          Length = 685

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 66  LVKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L++  LH H   Y+  D+P+ +DG YDR+ +RL A++ QFPEL   D P   +G
Sbjct: 17  LLREQLHVHNINYHVKDDPVISDGEYDRMMQRLIAIETQFPELSTPDSPTRRIG 70


>gi|166216283|sp|Q07PR9|DNLJ_RHOP5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 715

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+K +A +E+  L      H K YY+ D P  +D  YD +  RL+ ++ +FPEL   
Sbjct: 11  VATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHKFPELVSG 70

Query: 111 DHPWNTVG 118
             P   VG
Sbjct: 71  ASPSQKVG 78


>gi|254781232|sp|B0VU02|DNLJ_ACIBS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 678

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PE    D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPEFVQADSPTTKVG 65


>gi|169634132|ref|YP_001707868.1| DNA ligase [Acinetobacter baumannii SDF]
 gi|169152924|emb|CAP01965.1| DNA ligase [Acinetobacter baumannii]
          Length = 691

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PE    D P   VG
Sbjct: 22  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPEFVQADSPTTKVG 78


>gi|148257407|ref|YP_001241992.1| DNA ligase (polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
 gi|166215399|sp|A5EPJ2|DNLJ_BRASB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146409580|gb|ABQ38086.1| DNA ligase (Polydeoxyribonucleotide synthase (NAD+))
           [Bradyrhizobium sp. BTAi1]
          Length = 716

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           K   V  L+K +A +E + L      H + YY+ D P  +D  YD +  R +A++ +FPE
Sbjct: 9   KPVDVAELTKAQAKVEWKRLALELEVHDRLYYQDDAPKISDAEYDELRRRFNAIETRFPE 68

Query: 107 LFDEDHPWNTVG 118
           L   + P   VG
Sbjct: 69  LVSSESPSQKVG 80


>gi|115524134|ref|YP_781045.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
 gi|115518081|gb|ABJ06065.1| DNA ligase, NAD-dependent [Rhodopseudomonas palustris BisA53]
          Length = 730

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+K +A +E+  L      H K YY+ D P  +D  YD +  RL+ ++ +FPEL   
Sbjct: 26  VATLTKAKAKVELMRLALEIERHDKAYYQEDAPKVSDADYDALRRRLEEIEHKFPELVSG 85

Query: 111 DHPWNTVG 118
             P   VG
Sbjct: 86  ASPSQKVG 93


>gi|317491275|ref|ZP_07949711.1| DNA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920822|gb|EFV42145.1| DNA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 678

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/47 (46%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L AL+EQ PEL   D P   VG
Sbjct: 22  HHEYQYHVLDAPEIPDAEYDRLMRELRALEEQHPELITPDSPTQRVG 68


>gi|259502571|ref|ZP_05745473.1| DNA ligase [Lactobacillus antri DSM 16041]
 gi|259169461|gb|EEW53956.1| DNA ligase [Lactobacillus antri DSM 16041]
          Length = 678

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 37/74 (50%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +DK   V  L+   A  E+  L +      + YY  DNP   D +YDR  +RL  L+++F
Sbjct: 1   MDKQTPVDQLTLAAAKQEIAPLRQQLTKWGREYYEQDNPSVEDYVYDRAYQRLVELEQRF 60

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   VG
Sbjct: 61  PELKTSDSPTQHVG 74


>gi|134300185|ref|YP_001113681.1| NAD-dependent DNA ligase [Desulfotomaculum reducens MI-1]
 gi|190359251|sp|A4J703|DNLJ_DESRM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|134052885|gb|ABO50856.1| DNA ligase, NAD-dependent [Desulfotomaculum reducens MI-1]
          Length = 670

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 32/61 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           ++   VE L +   HH   YY LD P  TD  YD++ + L  L+E+ PEL   D P   V
Sbjct: 7   QSKARVEALRREINHHNYQYYVLDQPTITDAQYDQLMQELLRLEERHPELVTPDSPTQRV 66

Query: 118 G 118
           G
Sbjct: 67  G 67


>gi|291277000|ref|YP_003516772.1| DNA ligase [Helicobacter mustelae 12198]
 gi|290964194|emb|CBG40040.1| DNA ligase [Helicobacter mustelae 12198]
          Length = 669

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 4/72 (5%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           K+KK TS+ K +   +VE L K+A H    YY LD+P+ +D  YD +   +   +E  PE
Sbjct: 13  KSKKETSMEKEQYEKKVEQLKKMAYH----YYVLDDPISSDEEYDILYHEVKGYEEAHPE 68

Query: 107 LFDEDHPWNTVG 118
              ED P   VG
Sbjct: 69  AIREDSPTQRVG 80


>gi|284053772|ref|ZP_06383982.1| NAD-dependent DNA ligase LigA [Arthrospira platensis str. Paraca]
          Length = 683

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  DG+YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 30  YYVLDAPIMEDGVYDRLYRELQELENQYPELISPDSPTQRVG 71


>gi|294649516|ref|ZP_06726937.1| NAD-dependent DNA ligase LigA [Acinetobacter haemolyticus ATCC
           19194]
 gi|292824577|gb|EFF83359.1| NAD-dependent DNA ligase LigA [Acinetobacter haemolyticus ATCC
           19194]
          Length = 675

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL++Q+PE    D P N VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPSISDSEYDHLFHQLKALEQQYPECIQADTPTNKVG 65


>gi|226953496|ref|ZP_03823960.1| DNA ligase [Acinetobacter sp. ATCC 27244]
 gi|226835781|gb|EEH68164.1| DNA ligase [Acinetobacter sp. ATCC 27244]
          Length = 675

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL++Q+PE    D P N VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPSISDSEYDHLFHQLKALEQQYPECIQADTPTNKVG 65


>gi|163760776|ref|ZP_02167856.1| DNA ligase, NAD-dependent [Hoeflea phototrophica DFL-43]
 gi|162282098|gb|EDQ32389.1| DNA ligase, NAD-dependent [Hoeflea phototrophica DFL-43]
          Length = 739

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 37/70 (52%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K + +LS+ EA  E++ L      H + Y+R D P+ +D  YD    R  A++E+FP L 
Sbjct: 42  KPIEALSEAEAKAELDRLAAEIARHDEAYHRKDAPIVSDAEYDAFKRRNLAIEERFPHLR 101

Query: 109 DEDHPWNTVG 118
             D P   VG
Sbjct: 102 LADSPSLKVG 111


>gi|114570616|ref|YP_757296.1| DNA ligase [Maricaulis maris MCS10]
 gi|122315591|sp|Q0AMX9|DNLJ_MARMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114341078|gb|ABI66358.1| DNA ligase, NAD-dependent [Maricaulis maris MCS10]
          Length = 701

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 36/70 (51%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K V  L++ EA  E   L +    H K YY+ D P  +D  YD +  +L+A++ +FP+  
Sbjct: 5   KDVDQLTEAEARAEHARLAREIAGHDKAYYQSDAPKISDAAYDALRRKLEAIEVRFPQFI 64

Query: 109 DEDHPWNTVG 118
           D   P   VG
Sbjct: 65  DLLSPTQRVG 74


>gi|227515527|ref|ZP_03945576.1| DNA ligase (NAD(+)) [Lactobacillus fermentum ATCC 14931]
 gi|227086140|gb|EEI21452.1| DNA ligase (NAD(+)) [Lactobacillus fermentum ATCC 14931]
          Length = 679

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQ 101
           + K + V+ L+K +A  E   L  +    +KW   YY  DNP   D +YDR  +RL  ++
Sbjct: 1   MSKQEAVSELTKQQAQAE---LTPLREQLKKWGAEYYEQDNPSVEDYVYDRAYQRLVEIE 57

Query: 102 EQFPELFDEDHPWNTVG 118
           ++FP+L   D P   VG
Sbjct: 58  QRFPDLVVPDSPTQRVG 74


>gi|39936579|ref|NP_948855.1| DNA ligase [Rhodopseudomonas palustris CGA009]
 gi|39650435|emb|CAE28958.1| DNA ligase [Rhodopseudomonas palustris CGA009]
          Length = 692

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 29/46 (63%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H K YY+ D P  +D  YD +  RL+A++++FPEL +   P  TVG
Sbjct: 10  HDKAYYQDDAPKISDADYDALRRRLEAIEQKFPELVNASSPTQTVG 55


>gi|262375659|ref|ZP_06068891.1| DNA ligase, NAD-dependent [Acinetobacter lwoffii SH145]
 gi|262309262|gb|EEY90393.1| DNA ligase, NAD-dependent [Acinetobacter lwoffii SH145]
          Length = 679

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P   D  YD++  +L AL++Q+P+L   D P + VG
Sbjct: 10  QMRQLIQLLAKHNHAYYVMDQPSIEDSEYDQLFHQLKALEQQYPDLIQSDSPTDKVG 66


>gi|291296053|ref|YP_003507451.1| DNA ligase NAD-dependent [Meiothermus ruber DSM 1279]
 gi|290471012|gb|ADD28431.1| DNA ligase, NAD-dependent [Meiothermus ruber DSM 1279]
          Length = 666

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           + ++E+  L++   +H   YY LD P  +D  YDR+ + L AL+E  PEL   D P  TV
Sbjct: 6   QRIMELRELIR---YHNYRYYVLDKPEISDAEYDRLLQELRALEEAHPELIIPDSPTQTV 62

Query: 118 G 118
           G
Sbjct: 63  G 63


>gi|315634861|ref|ZP_07890143.1| NAD-dependent DNA ligase LigA [Aggregatibacter segnis ATCC 33393]
 gi|315476413|gb|EFU67163.1| NAD-dependent DNA ligase LigA [Aggregatibacter segnis ATCC 33393]
          Length = 671

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K   +H+  Y+ LD+P   D  YDR+  +L AL++Q PEL   D P   VG
Sbjct: 8   QIDDLRKTLRYHEYQYHVLDDPQIPDSEYDRLFHQLKALEQQHPELITADSPTQRVG 64


>gi|284047985|ref|YP_003398324.1| DNA ligase, NAD-dependent [Acidaminococcus fermentans DSM 20731]
 gi|283952206|gb|ADB47009.1| DNA ligase, NAD-dependent [Acidaminococcus fermentans DSM 20731]
          Length = 675

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ ++K  A   ++ L  +   +   YY  DNPL TD  YD +   L AL+ ++PEL   
Sbjct: 1   MSEMTKEAAAARIDQLRAVMKKNSYLYYVQDNPLITDAEYDAMMRELKALEAEYPELVTP 60

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 61  DSPSQHVG 68


>gi|297566494|ref|YP_003685466.1| DNA ligase, NAD-dependent [Meiothermus silvanus DSM 9946]
 gi|296850943|gb|ADH63958.1| DNA ligase, NAD-dependent [Meiothermus silvanus DSM 9946]
          Length = 670

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   +  L +   +H   YY LD+P+ +D  YDR+   L  L+ ++PEL   D P  TV
Sbjct: 10  EAQRRIHQLREEIRYHNYRYYVLDDPVISDAEYDRLLRELKELEARYPELVTPDSPTQTV 69

Query: 118 G 118
           G
Sbjct: 70  G 70


>gi|84516174|ref|ZP_01003534.1| DNA ligase [Loktanella vestfoldensis SKA53]
 gi|84509870|gb|EAQ06327.1| DNA ligase [Loktanella vestfoldensis SKA53]
          Length = 722

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EAM+E+  L +        Y+R D P  +D  YD + +R  A++ +F EL   
Sbjct: 24  VADLTRAEAMVELARLAQTLAQANTAYHRNDTPEISDAAYDALKQRNAAIEARFRELKRA 83

Query: 111 DHPWNTVG 118
           D P + VG
Sbjct: 84  DSPSDQVG 91


>gi|325675870|ref|ZP_08155554.1| DNA ligase [Rhodococcus equi ATCC 33707]
 gi|325553841|gb|EGD23519.1| DNA ligase [Rhodococcus equi ATCC 33707]
          Length = 711

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L ++  +HQ  YY LD+P+ +DG +D++   L+AL+E+ P+L   D P   VG
Sbjct: 32  LAEVVRNHQFRYYVLDSPIVSDGEFDQLFGELNALEERHPDLRTPDSPTQLVG 84


>gi|254480787|ref|ZP_05094034.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2148]
 gi|214039370|gb|EEB80030.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2148]
          Length = 677

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D  YDR   +L   +EQFPEL  ED P   VG
Sbjct: 24  YYVLDDPSVPDAEYDRYLRQLQGFEEQFPELVTEDSPTQRVG 65


>gi|312140511|ref|YP_004007847.1| DNA ligase (nad+) liga [Rhodococcus equi 103S]
 gi|311889850|emb|CBH49167.1| DNA ligase (NAD+) LigA [Rhodococcus equi 103S]
          Length = 712

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L ++  +HQ  YY LD+P+ +DG +D++   L+AL+E+ P+L   D P   VG
Sbjct: 32  LAEVVRNHQFRYYVLDSPIVSDGEFDQLFGELNALEERHPDLRTPDSPTQLVG 84


>gi|268316781|ref|YP_003290500.1| DNA ligase, NAD-dependent [Rhodothermus marinus DSM 4252]
 gi|262334315|gb|ACY48112.1| DNA ligase, NAD-dependent [Rhodothermus marinus DSM 4252]
          Length = 712

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 29  TLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDG 88
           T EA+ L     L   + + + + ++ + EA      L ++   H   YY LDNPL  D 
Sbjct: 9   TAEARLLEATHTLLQTV-RQRDLEAIDRKEAEALAARLREVLNQHAYRYYVLDNPLIPDA 67

Query: 89  LYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            YD + + L  L+ +FPEL   D P   VG
Sbjct: 68  DYDLLMQALRKLEARFPELVTPDSPTQRVG 97


>gi|1352292|sp|P49421|DNLJ_RHOMR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|607820|gb|AAA93198.1| DNA ligase [Rhodothermus marinus]
          Length = 712

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 29  TLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDG 88
           T EA+ L     L   + + + + ++ + EA      L ++   H   YY LDNPL  D 
Sbjct: 9   TAEARLLEATHTLLQTV-RQRDLEAIDRKEAEALAARLREVLNQHAYRYYVLDNPLIPDA 67

Query: 89  LYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            YD + + L  L+ +FPEL   D P   VG
Sbjct: 68  DYDLLMQALRKLEARFPELVTPDSPTQRVG 97


>gi|326559356|gb|EGE09783.1| NAD-dependent DNA ligase [Moraxella catarrhalis 7169]
          Length = 691

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           + +K   S +  + + ++  L+K+   H   YY +D P  +D  YD +   L  L++Q P
Sbjct: 10  NTSKNNPSKANDQIIAQMRALIKLLKRHNHAYYVMDAPTISDDEYDGLRRTLMMLEQQHP 69

Query: 106 ELFDEDHPWNTVG 118
            L   D P NTVG
Sbjct: 70  NLIQPDSPINTVG 82


>gi|262280095|ref|ZP_06057880.1| DNA ligase [Acinetobacter calcoaceticus RUH2202]
 gi|262260446|gb|EEY79179.1| DNA ligase [Acinetobacter calcoaceticus RUH2202]
          Length = 692

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+PE    D P   VG
Sbjct: 22  QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPEQVQSDSPTTKVG 78


>gi|94263030|ref|ZP_01286849.1| DNA ligase (NAD+) [delta proteobacterium MLMS-1]
 gi|93456573|gb|EAT06681.1| DNA ligase (NAD+) [delta proteobacterium MLMS-1]
          Length = 678

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           IA H+ + YY LD+P  +DG YDR+   L+ L+ ++PEL   D P   VG
Sbjct: 24  IAYHNHR-YYVLDDPELSDGEYDRLFRELEELESRWPELVTADSPSRRVG 72


>gi|262379150|ref|ZP_06072306.1| DNA ligase, NAD-dependent [Acinetobacter radioresistens SH164]
 gi|262298607|gb|EEY86520.1| DNA ligase, NAD-dependent [Acinetobacter radioresistens SH164]
          Length = 682

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+P+L   D P   VG
Sbjct: 14  QMRQLIQLIAQHNHAYYVMDQPSISDNEYDSLFHQLKALEEQYPDLVQNDTPTRRVG 70


>gi|239832299|ref|ZP_04680628.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
 gi|239824566|gb|EEQ96134.1| DNA ligase, NAD-dependent [Ochrobactrum intermedium LMG 3301]
          Length = 734

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ EA+ E+  L +   HH + Y+  D P  +D  YD +  R DA++ +FP L   
Sbjct: 21  VEKLTEPEAVSELGRLAREIAHHDELYHANDRPEISDAEYDALKRRNDAIEARFPHLVRT 80

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 81  DSPSLRVG 88


>gi|255318624|ref|ZP_05359855.1| DNA ligase, NAD-dependent [Acinetobacter radioresistens SK82]
 gi|255304306|gb|EET83492.1| DNA ligase, NAD-dependent [Acinetobacter radioresistens SK82]
          Length = 678

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+P+L   D P   VG
Sbjct: 10  QMRQLIQLIAQHNHAYYVMDQPSISDNEYDSLFHQLKALEEQYPDLVQNDTPTRRVG 66


>gi|307944884|ref|ZP_07660221.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
 gi|307771808|gb|EFO31032.1| DNA ligase, NAD-dependent [Roseibium sp. TrichSKD4]
          Length = 721

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+  +A  E+E L      H K Y++ D P  +D  YD +  R  A++ +FP+L  +
Sbjct: 15  VEALTSEQAETELERLANAIAKHDKLYHQDDAPAISDADYDALRRRNTAIEARFPDLVRD 74

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 75  DSPSRNVG 82


>gi|332798609|ref|YP_004460108.1| DNA ligase [Tepidanaerobacter sp. Re1]
 gi|332696344|gb|AEE90801.1| DNA ligase [Tepidanaerobacter sp. Re1]
          Length = 675

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LDNP  TD  YD++   L +L+ QFP+L   D P   VG
Sbjct: 19  YHNYRYYVLDNPEITDAEYDKLMRELISLESQFPQLITPDSPSQRVG 65


>gi|304392246|ref|ZP_07374188.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
 gi|303296475|gb|EFL90833.1| DNA ligase, NAD-dependent [Ahrensia sp. R2A130]
          Length = 716

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+  D P  +DG YD + +R  A++E+FP+L  ED P N VG
Sbjct: 33  HDARYHNDDAPTISDGAYDTLRKRNTAIEERFPDLVREDSPSNNVG 78


>gi|169831769|ref|YP_001717751.1| NAD-dependent DNA ligase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|254781311|sp|B1I551|DNLJ_DESAP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169638613|gb|ACA60119.1| DNA ligase, NAD-dependent [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 672

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA    E L +   +H   YY LD+P+  D  YDR+   L AL+  +PEL   D P   V
Sbjct: 5   EARARAEELRREIEYHDHRYYVLDDPVIEDAEYDRLVRELVALETAYPELVTPDSPTQRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|93005182|ref|YP_579619.1| DNA ligase, NAD-dependent [Psychrobacter cryohalolentis K5]
 gi|122989955|sp|Q1QDW8|DNLJ_PSYCK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|92392860|gb|ABE74135.1| DNA ligase, NAD-dependent [Psychrobacter cryohalolentis K5]
          Length = 691

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP+  D  YD++   L  L+E++P+L   D P N VG
Sbjct: 39  HNYAYYVLDNPILEDSEYDQLRRSLLELEEEYPDLIQPDSPINQVG 84


>gi|319407493|emb|CBI81141.1| DNA ligase [Bartonella sp. 1-1C]
          Length = 725

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L+  EA  E+E+L K    H   Y+R D P  +D  YD +  R + ++  FPEL   
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 111 DHPWNTVG 118
           D P + +G
Sbjct: 66  DSPSSKIG 73


>gi|319404500|emb|CBI78105.1| DNA ligase [Bartonella rochalimae ATCC BAA-1498]
          Length = 725

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L+  EA  E+E+L K    H   Y+R D P  +D  YD +  R + ++  FPEL   
Sbjct: 6   IKNLTALEAASELEWLAKEIARHDVLYHRDDQPEISDAEYDALCRRNEEIEALFPELIRA 65

Query: 111 DHPWNTVG 118
           D P + +G
Sbjct: 66  DSPSSKIG 73


>gi|240168924|ref|ZP_04747583.1| NAD-dependent DNA ligase LigA [Mycobacterium kansasii ATCC 12478]
          Length = 683

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ TD  +D +  RL+ L+EQ+PEL   D P   VG
Sbjct: 15  HQFRYYVRDAPIITDAEFDELLRRLEVLEEQYPELRTPDSPTQLVG 60


>gi|304415222|ref|ZP_07395930.1| DNA ligase (NAD(+)-dependent) [Candidatus Regiella insecticola
           LSR1]
 gi|304282928|gb|EFL91383.1| DNA ligase (NAD(+)-dependent) [Candidatus Regiella insecticola
           LSR1]
          Length = 674

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 27/50 (54%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           I  HH+  Y+ LDNP   D  YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 14  ILQHHEYQYHVLDNPEIPDAEYDRLMNELRELETQYPELICADSPTQRVG 63


>gi|15642875|ref|NP_227916.1| DNA ligase [Thermotoga maritima MSB8]
 gi|7674016|sp|Q9WXV5|DNLJ_THEMA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|4980590|gb|AAD35194.1|AE001696_8 DNA ligase [Thermotoga maritima MSB8]
          Length = 688

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + EVE L +   +H   YY L++P+ TD  YDR+  RL  L+  +PEL   D P   V
Sbjct: 9   EVIEEVERLREEIEYHNYRYYVLNDPVITDEEYDRLMRRLIELERMYPELVTPDSPTQRV 68

Query: 118 G 118
           G
Sbjct: 69  G 69


>gi|310823543|ref|YP_003955901.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309396615|gb|ADO74074.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
          Length = 673

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD+P  +D  YDR+   L  L+ QFP L   D P   VG
Sbjct: 19  HHNHRYYVLDSPEVSDAEYDRLMRELQGLEAQFPALATPDSPTQRVG 65


>gi|222099565|ref|YP_002534133.1| DNA ligase [Thermotoga neapolitana DSM 4359]
 gi|254781438|sp|B9K734|DNLJ_THENN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221571955|gb|ACM22767.1| DNA ligase [Thermotoga neapolitana DSM 4359]
          Length = 693

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + EVE L +   +H   YY L++P+ TD  YDR+  RL  L+  +PEL   D P   V
Sbjct: 14  EVIEEVERLREEIEYHNYRYYVLNDPVITDEEYDRLMRRLIELERMYPELVTPDSPTQRV 73

Query: 118 G 118
           G
Sbjct: 74  G 74


>gi|260887264|ref|ZP_05898527.1| DNA ligase, NAD-dependent [Selenomonas sputigena ATCC 35185]
 gi|330838979|ref|YP_004413559.1| DNA ligase, NAD-dependent [Selenomonas sputigena ATCC 35185]
 gi|260863326|gb|EEX77826.1| DNA ligase, NAD-dependent [Selenomonas sputigena ATCC 35185]
 gi|329746743|gb|AEC00100.1| DNA ligase, NAD-dependent [Selenomonas sputigena ATCC 35185]
          Length = 669

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   E+  L +   HH   YY  DNP  +D  YD++  +L AL+ ++PEL  E+ P   V
Sbjct: 5   EVKKELAQLRRTIRHHNVRYYNDDNPEISDYEYDQLMLQLKALEREYPELITENSPTQKV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|116334213|ref|YP_795740.1| NAD-dependent DNA ligase [Lactobacillus brevis ATCC 367]
 gi|122269104|sp|Q03Q13|DNLJ_LACBA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116099560|gb|ABJ64709.1| NAD-dependent DNA ligase [Lactobacillus brevis ATCC 367]
          Length = 676

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 34/70 (48%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K + +L+  +A  E   L    L   K YY  D P   D +YDRV  RL AL+  FPE+ 
Sbjct: 4   KPIKTLTVEQAAEEAADLRPQLLEWGKQYYEADAPSVEDDVYDRVYARLVALETAFPEIV 63

Query: 109 DEDHPWNTVG 118
             D P   VG
Sbjct: 64  TPDSPTQRVG 73


>gi|313903518|ref|ZP_07836909.1| DNA ligase, NAD-dependent [Thermaerobacter subterraneus DSM 13965]
 gi|313466339|gb|EFR61862.1| DNA ligase, NAD-dependent [Thermaerobacter subterraneus DSM 13965]
          Length = 817

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 30/60 (50%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A   VE L +   HH   YY LD P   D  YD +  +L  L+++FPEL   D P   VG
Sbjct: 57  ARARVEALREQIRHHDYLYYVLDRPEIDDAAYDALMRQLRELEQRFPELVTPDSPTQRVG 116


>gi|307244055|ref|ZP_07526174.1| DNA ligase (NAD+) [Peptostreptococcus stomatis DSM 17678]
 gi|306492579|gb|EFM64613.1| DNA ligase (NAD+) [Peptostreptococcus stomatis DSM 17678]
          Length = 702

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK EA + V  L++I  +H   YY  D+P  +D  YDR+ + L  L+E FPE   +D P
Sbjct: 22  ISKKEAGLMVGDLIEILNYHSDRYYNSDSPEISDMDYDRLMKSLILLEEAFPEYKKKDSP 81

Query: 114 WNTVG 118
              VG
Sbjct: 82  TVRVG 86


>gi|306819948|ref|ZP_07453599.1| NAD-dependent DNA ligase LigA [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304551984|gb|EFM39924.1| NAD-dependent DNA ligase LigA [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 675

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA +++E L      + K YY  DNP+ +D  YD +  +L +L+E++PEL   D P N V
Sbjct: 6   EARVKIEELKAEIEKNNKLYYEDDNPVISDYDYDMMMRQLISLEEKYPELKTPDSPSNRV 65

Query: 118 G 118
           G
Sbjct: 66  G 66


>gi|238792031|ref|ZP_04635667.1| DNA ligase [Yersinia intermedia ATCC 29909]
 gi|238728662|gb|EEQ20180.1| DNA ligase [Yersinia intermedia ATCC 29909]
          Length = 670

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L +L+ Q PEL   D P   VG
Sbjct: 17  HHEHLYHVLDAPEIPDAEYDRLMQQLRSLEAQHPELITHDSPTQRVG 63


>gi|254785950|ref|YP_003073379.1| DNA ligase, NAD-dependent [Teredinibacter turnerae T7901]
 gi|237685872|gb|ACR13136.1| DNA ligase, NAD-dependent [Teredinibacter turnerae T7901]
          Length = 676

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH + YY LD P   D  YDR+   L  L+ +FP+L   D P   VG
Sbjct: 24  HHNRQYYLLDEPEIPDAEYDRLFHELKTLEAEFPQLETADSPTQRVG 70


>gi|147678862|ref|YP_001213077.1| NAD-dependent DNA ligase [Pelotomaculum thermopropionicum SI]
 gi|190359268|sp|A5CZ68|DNLJ_PELTS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146274959|dbj|BAF60708.1| NAD-dependent DNA ligase [Pelotomaculum thermopropionicum SI]
          Length = 679

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P  TD  YDR+   L+ L++QFP L     P   VG
Sbjct: 21  HHNYLYYVLDRPAITDAQYDRLMRELERLEKQFPALVTPYSPTQRVG 67


>gi|239815926|ref|YP_002944836.1| DNA ligase, NAD-dependent [Variovorax paradoxus S110]
 gi|239802503|gb|ACS19570.1| DNA ligase, NAD-dependent [Variovorax paradoxus S110]
          Length = 694

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 71  LH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LH H   YY LD P   D  YDR+ +RL AL+ ++PEL   D P   VG
Sbjct: 18  LHKHAHLYYVLDAPELPDAEYDRLFQRLQALEAEYPELRTPDSPTQRVG 66


>gi|319793880|ref|YP_004155520.1| DNA ligase, NAD-dependent [Variovorax paradoxus EPS]
 gi|315596343|gb|ADU37409.1| DNA ligase, NAD-dependent [Variovorax paradoxus EPS]
          Length = 694

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 71  LH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LH H   YY LD P   D  YD++ +RL AL+ +FPEL   D P   VG
Sbjct: 18  LHKHAHLYYVLDAPELPDAEYDKLFQRLQALETEFPELRTPDSPTQRVG 66


>gi|308375959|ref|ZP_07668156.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu007]
 gi|308344705|gb|EFP33556.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu007]
          Length = 614

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   V
Sbjct: 12  EVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|258651684|ref|YP_003200840.1| DNA ligase, NAD-dependent [Nakamurella multipartita DSM 44233]
 gi|258554909|gb|ACV77851.1| DNA ligase, NAD-dependent [Nakamurella multipartita DSM 44233]
          Length = 736

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +I    Q  YY LD P  +DG +D V   LD L+EQ+P L   D P   VG
Sbjct: 30  LTQIITDAQFRYYVLDAPTMSDGEFDTVLRELDGLEEQYPSLRTPDSPTQRVG 82


>gi|114705256|ref|ZP_01438164.1| DNA ligase, NAD-dependent [Fulvimarina pelagi HTCC2506]
 gi|114540041|gb|EAU43161.1| DNA ligase, NAD-dependent [Fulvimarina pelagi HTCC2506]
          Length = 821

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L + EA  E+E L +    H + YY  D P  +D  YD +  R  A++ +FP L   
Sbjct: 6   VENLDETEAASELERLAREIAEHDRAYYGDDAPTLSDADYDALRRRNTAIEARFPALIRA 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSKRVG 73


>gi|258592875|emb|CBE69184.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [NC10
           bacterium 'Dutch sediment']
          Length = 684

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +V+ L ++   H+  YY LD P  TD  +D + +RL  L+ Q PEL   D P   VG
Sbjct: 10  QVDDLRQLIRRHEYLYYVLDRPEITDAEFDTLYQRLQTLETQHPELITPDSPTQRVG 66


>gi|215412865|ref|ZP_03421575.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis
           94_M4241A]
 gi|298526485|ref|ZP_07013894.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis
           94_M4241A]
 gi|298496279|gb|EFI31573.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis
           94_M4241A]
          Length = 691

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   V
Sbjct: 12  EVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|15610151|ref|NP_217530.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis H37Rv]
 gi|31794191|ref|NP_856684.1| NAD-dependent DNA ligase LigA [Mycobacterium bovis AF2122/97]
 gi|121638896|ref|YP_979120.1| NAD-dependent DNA ligase LigA [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148662865|ref|YP_001284388.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis H37Ra]
 gi|148824204|ref|YP_001288958.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis F11]
 gi|161350059|ref|NP_337609.2| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis CDC1551]
 gi|167967816|ref|ZP_02550093.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis H37Ra]
 gi|215431968|ref|ZP_03429887.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis EAS054]
 gi|219559049|ref|ZP_03538125.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis T17]
 gi|224991388|ref|YP_002646077.1| NAD-dependent DNA ligase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|254365649|ref|ZP_04981694.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|260188040|ref|ZP_05765514.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis CPHL_A]
 gi|260206343|ref|ZP_05773834.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis K85]
 gi|289448688|ref|ZP_06438432.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis CPHL_A]
 gi|289553196|ref|ZP_06442406.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis KZN 605]
 gi|289571216|ref|ZP_06451443.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis T17]
 gi|289575722|ref|ZP_06455949.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis K85]
 gi|289755132|ref|ZP_06514510.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis EAS054]
 gi|294993895|ref|ZP_06799586.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis 210]
 gi|297635642|ref|ZP_06953422.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis KZN 4207]
 gi|297732640|ref|ZP_06961758.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis KZN R506]
 gi|306777310|ref|ZP_07415647.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu001]
 gi|306785860|ref|ZP_07424182.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu003]
 gi|306789901|ref|ZP_07428223.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu004]
 gi|306794711|ref|ZP_07433013.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu005]
 gi|306798954|ref|ZP_07437256.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu006]
 gi|306969091|ref|ZP_07481752.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu009]
 gi|306973427|ref|ZP_07486088.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu010]
 gi|307081136|ref|ZP_07490306.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu011]
 gi|307085740|ref|ZP_07494853.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu012]
 gi|313659972|ref|ZP_07816852.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis KZN
           V2475]
 gi|54036987|sp|P63973|DNLJ_MYCTU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|54036988|sp|P63974|DNLJ_MYCBO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215822|sp|A1KN09|DNLJ_MYCBP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166216214|sp|A5U726|DNLJ_MYCTA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781375|sp|C1AGD0|DNLJ_MYCBT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|2791611|emb|CAA16099.1| PROBABLE DNA LIGASE [NAD DEPENDENT] LIGA (POLYDEOXYRIBONUCLEOTIDE
           SYNTHASE [NAD+]) [Mycobacterium tuberculosis H37Rv]
 gi|31619786|emb|CAD96726.1| PROBABLE DNA LIGASE [NAD DEPENDENT] LIGA (POLYDEOXYRIBONUCLEOTIDE
           SYNTHASE [NAD+]) [Mycobacterium bovis AF2122/97]
 gi|121494544|emb|CAL73025.1| Probable dna ligase [nad dependent] ligA [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|134151162|gb|EBA43207.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507017|gb|ABQ74826.1| DNA ligase (NAD dependent) LigA [Mycobacterium tuberculosis H37Ra]
 gi|148722731|gb|ABR07356.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis F11]
 gi|224774503|dbj|BAH27309.1| NAD-dependent DNA ligase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|289421646|gb|EFD18847.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis CPHL_A]
 gi|289437828|gb|EFD20321.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis KZN 605]
 gi|289540153|gb|EFD44731.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis K85]
 gi|289544970|gb|EFD48618.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis T17]
 gi|289695719|gb|EFD63148.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis EAS054]
 gi|308214358|gb|EFO73757.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu001]
 gi|308329532|gb|EFP18383.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu003]
 gi|308333670|gb|EFP22521.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu004]
 gi|308337029|gb|EFP25880.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu005]
 gi|308340842|gb|EFP29693.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu006]
 gi|308353381|gb|EFP42232.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu009]
 gi|308357226|gb|EFP46077.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu010]
 gi|308361179|gb|EFP50030.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu011]
 gi|308364771|gb|EFP53622.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu012]
 gi|323718395|gb|EGB27569.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis CDC1551A]
 gi|326904628|gb|EGE51561.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis W-148]
 gi|328457668|gb|AEB03091.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis KZN 4207]
          Length = 691

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   V
Sbjct: 12  EVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|290476106|ref|YP_003469005.1| DNA ligase [Xenorhabdus bovienii SS-2004]
 gi|289175438|emb|CBJ82241.1| DNA ligase [Xenorhabdus bovienii SS-2004]
          Length = 672

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 58  EAMIE-VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           E++IE +  L     HH+  Y+ +D P   D  YDR+   L  L+EQ PEL   D P   
Sbjct: 2   ESIIEKINKLRATLRHHEYLYHVMDAPEIPDAEYDRLLRELKVLEEQHPELITADSPTQR 61

Query: 117 VG 118
           VG
Sbjct: 62  VG 63


>gi|115379272|ref|ZP_01466385.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
 gi|115363713|gb|EAU62835.1| DNA ligase [Stigmatella aurantiaca DW4/3-1]
          Length = 443

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD+P  +D  YDR+   L  L+ QFP L   D P   VG
Sbjct: 61  HHNHRYYVLDSPEVSDAEYDRLMRELQGLEAQFPALATPDSPTQRVG 107


>gi|11095423|gb|AAG29863.1|AF313764_6 DNA ligase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|49284|emb|CAA77966.1| DNA ligase [Zymomonas mobilis subsp. mobilis CP4]
 gi|382210|prf||1819268B DNA ligase
          Length = 731

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +LS+ +A+IE+E L K+  H+   Y+  DNP   D  YD +  R   +++ FP+L   D 
Sbjct: 25  NLSREQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDS 84

Query: 113 PWNTVG 118
           P   VG
Sbjct: 85  PSKKVG 90


>gi|215405001|ref|ZP_03417182.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis 02_1987]
 gi|289746820|ref|ZP_06506198.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis 02_1987]
 gi|289687348|gb|EFD54836.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis 02_1987]
          Length = 691

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   V
Sbjct: 12  EVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|209527955|ref|ZP_03276440.1| DNA ligase, NAD-dependent [Arthrospira maxima CS-328]
 gi|209491614|gb|EDZ91984.1| DNA ligase, NAD-dependent [Arthrospira maxima CS-328]
          Length = 680

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   DG+YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 31  YYVLDAPTMEDGVYDRLYRELQELETQYPELISPDSPTQRVG 72


>gi|307152955|ref|YP_003888339.1| NAD-dependent DNA ligase [Cyanothece sp. PCC 7822]
 gi|306983183|gb|ADN15064.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 7822]
          Length = 682

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   L+ L+ Q+PEL   D P   VG
Sbjct: 26  YYVLDNPIMEDAVYDQLYRELENLETQYPELITPDSPTQRVG 67


>gi|90416525|ref|ZP_01224456.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2207]
 gi|90331724|gb|EAS46952.1| DNA ligase, NAD-dependent [marine gamma proteobacterium HTCC2207]
          Length = 677

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR   RL  +++Q PEL  +D P   VG
Sbjct: 21  QHNHRYYVLDEPTIPDSEYDRSMRRLQDIEQQHPELLSDDSPSQRVG 67


>gi|56551260|ref|YP_162099.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59802648|sp|P28719|DNLJ_ZYMMO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56542834|gb|AAV88988.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 731

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS+ +A+IE+E L K+  H+   Y+  DNP   D  YD +  R   +++ FP+L   D P
Sbjct: 26  LSREQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDSP 85

Query: 114 WNTVG 118
              VG
Sbjct: 86  SKKVG 90


>gi|218754780|ref|ZP_03533576.1| NAD-dependent DNA ligase LigA [Mycobacterium tuberculosis GM 1503]
 gi|289763195|ref|ZP_06522573.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis GM
           1503]
 gi|289710701|gb|EFD74717.1| DNA ligase [NAD dependent] ligA [Mycobacterium tuberculosis GM
           1503]
          Length = 690

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + + + L +    HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   V
Sbjct: 12  EVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|268593162|ref|ZP_06127383.1| DNA ligase, NAD-dependent [Providencia rettgeri DSM 1131]
 gi|291311208|gb|EFE51661.1| DNA ligase, NAD-dependent [Providencia rettgeri DSM 1131]
          Length = 671

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L K   HH+  Y+ LD P   D  YD++ +RL  ++ Q PEL   D P   VG
Sbjct: 6   EIDELKKQLRHHEYQYHVLDAPEIPDVEYDKLMQRLKEIEAQHPELVTSDSPTQRVG 62


>gi|77360026|ref|YP_339601.1| NAD-dependent DNA ligase [Pseudoalteromonas haloplanktis TAC125]
 gi|123730523|sp|Q3IKB8|DNLJ_PSEHT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|76874937|emb|CAI86158.1| NAD-dependent DNA ligase [Pseudoalteromonas haloplanktis TAC125]
          Length = 673

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L      H   YY LD P   D  YDR+ ++L AL+ Q PEL   D P   VG
Sbjct: 8   QINHLRSTLEQHSYNYYVLDTPSIPDAEYDRLLQQLSALETQHPELITADSPTQKVG 64


>gi|327399096|ref|YP_004339965.1| DNA ligase [Hippea maritima DSM 10411]
 gi|327181725|gb|AEA33906.1| DNA ligase [Hippea maritima DSM 10411]
          Length = 667

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   +E L K   +H   YY LD+P+ +D  YD + + L  L+E +P+ +DE+ P   V
Sbjct: 5   EAKERIEQLRKKLHYHNYRYYVLDDPIISDSEYDMMLKELKELEESYPQFYDENSPTVRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|296046583|gb|ADG86433.1| NAD-dependent DNA ligase [Francisella novicida]
          Length = 673

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L      H   YY LD P   D  YDR+ ++L AL+ Q PEL   D P   VG
Sbjct: 8   QINHLRSTLEQHSYNYYVLDTPSIPDAEYDRLLQQLSALETQHPELITADSPTQKVG 64


>gi|116253034|ref|YP_768872.1| NAD-dependent DNA ligase LigA [Rhizobium leguminosarum bv. viciae
           3841]
 gi|123261370|sp|Q1ME47|DNLJ_RHIL3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115257682|emb|CAK08780.1| putative DNA ligase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 718

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   Y+  D P  +D  YD +  R DAL+ +FPEL  ED P   VG
Sbjct: 29  HHDALYHGKDQPEISDADYDALKRRNDALEVRFPELIREDSPSRHVG 75


>gi|260912664|ref|ZP_05919150.1| DNA ligase [Pasteurella dagmatis ATCC 43325]
 gi|260633042|gb|EEX51207.1| DNA ligase [Pasteurella dagmatis ATCC 43325]
          Length = 673

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L K    ++  Y+ LDNP   D  YDR+  +L  L+ ++P+   ED P   VG
Sbjct: 8   EMEQLRKTLRRYEYQYHVLDNPTVPDAEYDRLFHQLKKLEREYPQFITEDSPTQRVG 64


>gi|260904918|ref|ZP_05913240.1| DNA ligase, NAD-dependent [Brevibacterium linens BL2]
          Length = 729

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY+ D+PL  D  YD +  RL+ L+E+FPEL  +  P  TVG
Sbjct: 40  YYKDDSPLVADAEYDDLVHRLEDLEEKFPELVTDSSPTQTVG 81


>gi|6561410|gb|AAF16907.1|AF173987_5 DNA ligase [Rhodothermus marinus DSM 4252]
          Length = 154

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 29  TLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDG 88
           T EA+ L     L   + + + + ++ + EA      L ++   H   YY LDNPL  D 
Sbjct: 9   TAEARLLEATHTLLQTV-RQRDLEAIDRKEAEALAARLREVLNQHAYRYYVLDNPLIPDA 67

Query: 89  LYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            YD + + L  L+ +FPEL   D P   VG
Sbjct: 68  DYDLLMQALRKLEARFPELVTPDSPTQRVG 97


>gi|331695637|ref|YP_004331876.1| DNA ligase [Pseudonocardia dioxanivorans CB1190]
 gi|326950326|gb|AEA24023.1| DNA ligase [Pseudonocardia dioxanivorans CB1190]
          Length = 812

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P+ +DG +D +   L AL+E++P+L   D P   VG
Sbjct: 40  HQFRYYVLDAPVVSDGQFDELWRELVALEERYPDLVSPDSPTQKVG 85


>gi|300743918|ref|ZP_07072938.1| DNA ligase, NAD-dependent [Rothia dentocariosa M567]
 gi|300380279|gb|EFJ76842.1| DNA ligase, NAD-dependent [Rothia dentocariosa M567]
          Length = 740

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 39  RALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLD 98
           RAL++ LD + ++T   + E   E+   ++ A H    YY+ D P  +D  YDR+  RL+
Sbjct: 14  RALKA-LDSSAELTDTIRAE-YAELTDTIRAARHD---YYQADAPTLSDAEYDRLYRRLE 68

Query: 99  ALQEQFPELFDEDHPWNTVG 118
            ++ Q+P L   D P   VG
Sbjct: 69  QIEAQYPALIANDSPTQEVG 88


>gi|299771367|ref|YP_003733393.1| DNA ligase, NAD-dependent [Acinetobacter sp. DR1]
 gi|298701455|gb|ADI92020.1| DNA ligase, NAD-dependent [Acinetobacter sp. DR1]
          Length = 679

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L+++   H   YY +D P  +D  YD +  +L AL+EQ+P+    D P   VG
Sbjct: 9   QMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPDQVQSDSPTTKVG 65


>gi|52425821|ref|YP_088958.1| NAD-dependent DNA ligase LigA [Mannheimia succiniciproducens
           MBEL55E]
 gi|81386743|sp|Q65RN7|DNLJ_MANSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|52307873|gb|AAU38373.1| Lig protein [Mannheimia succiniciproducens MBEL55E]
          Length = 675

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L     +H+  Y+ LD+P   D  YDR+  +L AL++Q PEL   D P   VG
Sbjct: 9   QIKQLRDTLRYHEYQYHVLDDPKIPDAEYDRLFHQLKALEQQHPELITADSPTQRVG 65


>gi|332982281|ref|YP_004463722.1| DNA ligase, NAD-dependent [Mahella australiensis 50-1 BON]
 gi|332699959|gb|AEE96900.1| DNA ligase, NAD-dependent [Mahella australiensis 50-1 BON]
          Length = 665

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           V  L +I  HH   YY LD+P  +D  YD +   L+ L+ ++PE+   D P   VG
Sbjct: 11  VNELRQIIEHHNYMYYVLDSPEISDAEYDALMRELEQLESKYPEIITPDSPTQRVG 66


>gi|289522353|ref|ZP_06439207.1| DNA ligase, NAD-dependent [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289504189|gb|EFD25353.1| DNA ligase, NAD-dependent [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 674

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (51%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           GEA    E L K    H  +YY LD+P+ TD  YD +   L  L+ +FPE+   D P   
Sbjct: 6   GEAKKRAEELRKEIEKHNYYYYVLDSPVITDEEYDALYRGLVELERRFPEIITPDSPTQR 65

Query: 117 VG 118
           VG
Sbjct: 66  VG 67


>gi|49474446|ref|YP_032488.1| NAD-dependent DNA ligase LigA [Bartonella quintana str. Toulouse]
 gi|81646941|sp|Q6FZ81|DNLJ_BARQU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49239950|emb|CAF26355.1| DNA ligase [Bartonella quintana str. Toulouse]
          Length = 719

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D+ K +T+L   EA  E+E+L K    H   Y R D P  +D  YD +  R   ++  FP
Sbjct: 4   DEIKNLTAL---EAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFP 60

Query: 106 ELFDEDHPWNTVG 118
           EL   D P + +G
Sbjct: 61  ELIRSDSPSHKIG 73


>gi|300114089|ref|YP_003760664.1| DNA ligase, NAD-dependent [Nitrosococcus watsonii C-113]
 gi|299540026|gb|ADJ28343.1| DNA ligase, NAD-dependent [Nitrosococcus watsonii C-113]
          Length = 675

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY +DNPL  D  YDR+   L  L+E +PEL   D P   VG
Sbjct: 25  YYVMDNPLIPDSEYDRLIRELRVLEENYPELITLDSPTQRVG 66


>gi|332162521|ref|YP_004299098.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606605|emb|CBY28103.1| DNA ligase [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666751|gb|ADZ43395.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860741|emb|CBX71032.1| DNA ligase [Yersinia enterocolitica W22703]
          Length = 672

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELITNDSPTQRVG 63


>gi|123441550|ref|YP_001005536.1| NAD-dependent DNA ligase LigA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166216254|sp|A1JLA4|DNLJ_YERE8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|122088511|emb|CAL11304.1| DNA ligase [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 672

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELITNDSPTQRVG 63


>gi|308377195|ref|ZP_07441467.2| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu008]
 gi|13882885|gb|AAK47423.1| DNA ligase [Mycobacterium tuberculosis CDC1551]
 gi|308348655|gb|EFP37506.1| NAD-dependent DNA ligase ligA [Mycobacterium tuberculosis SUMu008]
          Length = 679

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   VG
Sbjct: 15  HQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVG 60


>gi|294085891|ref|YP_003552651.1| DNA ligase (NAD+) [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665466|gb|ADE40567.1| DNA ligase (NAD+) [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 696

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 35/67 (52%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           + +S  +A  E+ YL +   +H + Y+  D P  +D  YD +  R +AL+  FPEL   D
Sbjct: 9   SKMSADDAAQELAYLAERIAYHDRKYHGEDAPDISDADYDMLVARNNALEASFPELIRPD 68

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 69  SPSQRVG 75


>gi|126736446|ref|ZP_01752187.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
 gi|126713984|gb|EBA10854.1| DNA ligase, NAD-dependent [Roseobacter sp. CCS2]
          Length = 715

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V SLS  +A  E+ +L          Y+R D P  +D  YD +  R  A++ QFP+L  +
Sbjct: 17  VASLSPEQATKELSWLATQLNAANTAYHRDDAPDISDATYDALKRRNAAIEAQFPDLKRQ 76

Query: 111 DHPWNTVG 118
           D P  TVG
Sbjct: 77  DSPSETVG 84


>gi|325972726|ref|YP_004248917.1| DNA ligase, NAD-dependent [Spirochaeta sp. Buddy]
 gi|324027964|gb|ADY14723.1| DNA ligase, NAD-dependent [Spirochaeta sp. Buddy]
          Length = 696

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  LV+    +QK YY  + PL +D  YDR+ +RL AL+ Q+P L   D P   VG
Sbjct: 7   EIHSLVEQLASYQKAYYVDNRPLVSDLEYDRLFDRLVALETQYPHLKLADSPTQRVG 63


>gi|311113170|ref|YP_003984392.1| NAD-dependent DNA ligase LigA [Rothia dentocariosa ATCC 17931]
 gi|310944664|gb|ADP40958.1| NAD-dependent DNA ligase LigA [Rothia dentocariosa ATCC 17931]
          Length = 740

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 39  RALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLD 98
           RAL++ LD + ++T   + E   E+   ++ A H    YY+ D P  +D  YDR+  RL+
Sbjct: 14  RALKA-LDSSAELTDTIRAE-YAELTDTIRTARHD---YYQEDAPTLSDAEYDRLYRRLE 68

Query: 99  ALQEQFPELFDEDHPWNTVG 118
            ++ Q+P L   D P   VG
Sbjct: 69  QIEAQYPALIANDSPTQEVG 88


>gi|296285034|ref|ZP_06863032.1| DNA ligase [Citromicrobium bathyomarinum JL354]
          Length = 733

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 36/74 (48%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D+      LS+ EA  E+  L +    H + Y+  D P  TD  YD +  R +AL+  FP
Sbjct: 3   DQKDLAEPLSEAEAANELMRLARTIRKHNRLYHAEDAPEITDQEYDALVRRNEALEAAFP 62

Query: 106 ELFDEDHPWNTVGY 119
           +L   D P   VG+
Sbjct: 63  DLVRPDSPSKGVGH 76


>gi|332705189|ref|ZP_08425270.1| DNA ligase, NAD-dependent [Lyngbya majuscula 3L]
 gi|332355932|gb|EGJ35391.1| DNA ligase, NAD-dependent [Lyngbya majuscula 3L]
          Length = 1092

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   L  L+ ++PEL   D P   VG
Sbjct: 26  YYVLDNPIMADAIYDQLYRELQELETEYPELVTSDSPTQRVG 67


>gi|269138493|ref|YP_003295193.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|267984153|gb|ACY83982.1| NAD-dependent DNA ligase [Edwardsiella tarda EIB202]
 gi|304558517|gb|ADM41181.1| DNA ligase [Edwardsiella tarda FL6-60]
          Length = 675

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L     HH+  YY LD P  TD  YDR+  +L  L+ + P L   D P   VG
Sbjct: 8   QLEQLRDALRHHEYQYYVLDEPQVTDAEYDRLMAQLKQLEAEHPALVTADSPSQRVG 64


>gi|238785571|ref|ZP_04629551.1| DNA ligase [Yersinia bercovieri ATCC 43970]
 gi|238713506|gb|EEQ05538.1| DNA ligase [Yersinia bercovieri ATCC 43970]
          Length = 670

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRLMQQLRDLESQHPELITSDSPTQRVG 63


>gi|312870519|ref|ZP_07730638.1| DNA ligase (NAD+) [Lactobacillus oris PB013-T2-3]
 gi|311093981|gb|EFQ52306.1| DNA ligase (NAD+) [Lactobacillus oris PB013-T2-3]
          Length = 679

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +DK   V  L+   A  E+  L +  +   + YY  DNP   D +YDR  +RL  L+++F
Sbjct: 1   MDKPTPVDQLTLAAAKQEIAPLREQLIKWGQEYYEQDNPSVEDYVYDRAYQRLVELEQRF 60

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   VG
Sbjct: 61  PELKTSDSPTQHVG 74


>gi|294102358|ref|YP_003554216.1| DNA ligase, NAD-dependent [Aminobacterium colombiense DSM 12261]
 gi|293617338|gb|ADE57492.1| DNA ligase, NAD-dependent [Aminobacterium colombiense DSM 12261]
          Length = 684

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA+  +E L +    H   YY LD P   D  YD +   L +L+E FPE  D D P
Sbjct: 1   MDRREALQRIEALREEINRHAHLYYVLDTPEIADHEYDALFRELASLEEAFPEFDDPDSP 60

Query: 114 WNTVG 118
            + VG
Sbjct: 61  THRVG 65


>gi|319405996|emb|CBI79627.1| DNA ligase [Bartonella sp. AR 15-3]
          Length = 718

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L+  EA  E+E+L K    H   Y+R D P  +D  YD +  R + ++  FPEL   
Sbjct: 6   IKNLTALEAEGELEWLAKEIARHDVLYHRDDQPEISDAEYDALRRRNEEIEALFPELVRV 65

Query: 111 DHPWNTVG 118
           D P + +G
Sbjct: 66  DSPSSKIG 73


>gi|226327977|ref|ZP_03803495.1| hypothetical protein PROPEN_01868 [Proteus penneri ATCC 35198]
 gi|225203681|gb|EEG86035.1| hypothetical protein PROPEN_01868 [Proteus penneri ATCC 35198]
          Length = 505

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L AL+ ++PEL   D P   VG
Sbjct: 18  HHEYLYHVMDAPEIPDAEYDRLMNELKALEAEYPELITSDSPTQRVG 64


>gi|281412160|ref|YP_003346239.1| DNA ligase, NAD-dependent [Thermotoga naphthophila RKU-10]
 gi|281373263|gb|ADA66825.1| DNA ligase, NAD-dependent [Thermotoga naphthophila RKU-10]
          Length = 688

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + EVE L +   +H   YY L++P+ TD  YD++  RL  L+  +PEL   D P   V
Sbjct: 9   EVIEEVERLREEIEYHNYRYYVLNDPVITDEEYDKLMRRLIELERMYPELVTPDSPTQRV 68

Query: 118 G 118
           G
Sbjct: 69  G 69


>gi|148269959|ref|YP_001244419.1| DNA ligase, NAD-dependent [Thermotoga petrophila RKU-1]
 gi|170288644|ref|YP_001738882.1| DNA ligase, NAD-dependent [Thermotoga sp. RQ2]
 gi|190359298|sp|A5IKX0|DNLJ_THEP1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781442|sp|B1LA51|DNLJ_THESQ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147735503|gb|ABQ46843.1| DNA ligase, NAD-dependent [Thermotoga petrophila RKU-1]
 gi|170176147|gb|ACB09199.1| DNA ligase, NAD-dependent [Thermotoga sp. RQ2]
          Length = 688

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + EVE L +   +H   YY L++P+ TD  YD++  RL  L+  +PEL   D P   V
Sbjct: 9   EVIEEVERLREEIEYHNYRYYVLNDPVITDEEYDKLMRRLIELERMYPELVTPDSPTQRV 68

Query: 118 G 118
           G
Sbjct: 69  G 69


>gi|332290231|ref|YP_004421083.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
 gi|330433127|gb|AEC18186.1| NAD-dependent DNA ligase LigA [Gallibacterium anatis UMN179]
          Length = 671

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L     +H+  Y+ LDNP+  D  YDR+  +L  L+ + PEL  +D P   VG
Sbjct: 8   IEQLRNDLRYHEYQYHVLDNPVIPDAEYDRMMNQLKRLEAEHPELITDDSPTQRVG 63


>gi|295401729|ref|ZP_06811695.1| DNA ligase, NAD-dependent [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976216|gb|EFG51828.1| DNA ligase, NAD-dependent [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 670

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  A+  +E L ++   +   YY LD P   D  YDR+ + L AL+EQ+P+L  +D P
Sbjct: 1   MERQAAIKRIEELRELLNQYNYEYYVLDRPSVPDSEYDRLMQELIALEEQYPDLKTKDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|226305867|ref|YP_002765827.1| NAD(+)-dependent DNA ligase [Rhodococcus erythropolis PR4]
 gi|254781402|sp|C0ZXK3|DNLJ_RHOE4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226184984|dbj|BAH33088.1| NAD(+)-dependent DNA ligase [Rhodococcus erythropolis PR4]
          Length = 700

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            HQ  YY  D P+ +DG +D +  +L+AL+EQ+P+L   D P   VG
Sbjct: 28  QHQFRYYVRDAPVISDGAFDTLLGQLNALEEQYPDLRTPDSPTQLVG 74


>gi|315445158|ref|YP_004078037.1| DNA ligase, NAD-dependent [Mycobacterium sp. Spyr1]
 gi|315263461|gb|ADU00203.1| DNA ligase, NAD-dependent [Mycobacterium sp. Spyr1]
          Length = 701

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ TD  +D++  RL AL++++PEL   D P   VG
Sbjct: 28  HQFRYYIRDAPIITDAEFDQLLRRLQALEDEYPELRTPDSPTQLVG 73


>gi|312112463|ref|YP_003990779.1| DNA ligase, NAD-dependent [Geobacillus sp. Y4.1MC1]
 gi|311217564|gb|ADP76168.1| DNA ligase, NAD-dependent [Geobacillus sp. Y4.1MC1]
          Length = 670

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  A+  +E L ++   +   YY LD P   D  YDR+ + L AL+EQ+P+L  +D P
Sbjct: 1   MERQAAIKRIEELRELLNQYNYEYYVLDRPSVPDSEYDRLMQELIALEEQYPDLKTKDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|238759468|ref|ZP_04620632.1| DNA ligase [Yersinia aldovae ATCC 35236]
 gi|238702365|gb|EEP94918.1| DNA ligase [Yersinia aldovae ATCC 35236]
          Length = 670

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHLYHVLDAPEIPDAEYDRLMQQLRELEAQHPELVTNDSPTQRVG 63


>gi|145224827|ref|YP_001135505.1| NAD-dependent DNA ligase LigA [Mycobacterium gilvum PYR-GCK]
 gi|190359265|sp|A4TDZ8|DNLJ_MYCGI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145217313|gb|ABP46717.1| DNA ligase, NAD-dependent [Mycobacterium gilvum PYR-GCK]
          Length = 712

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ TD  +D++  RL AL++++PEL   D P   VG
Sbjct: 39  HQFRYYIRDAPIITDAEFDQLLRRLQALEDEYPELRTPDSPTQLVG 84


>gi|315223028|ref|ZP_07864907.1| DNA ligase, NAD-dependent [Streptococcus anginosus F0211]
 gi|315187978|gb|EFU21714.1| DNA ligase, NAD-dependent [Streptococcus anginosus F0211]
          Length = 652

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LVK+   +   YY  DNP  +D  YDR+   L  L++Q+PEL   D P + VG
Sbjct: 8   LVKLLNQYAHEYYTTDNPTVSDSEYDRLYHELLDLEQQYPELVQADSPTHRVG 60


>gi|149915267|ref|ZP_01903795.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
 gi|149810988|gb|EDM70827.1| DNA ligase, NAD-dependent [Roseobacter sp. AzwK-3b]
          Length = 720

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 36/71 (50%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           + V  LS  +A  E+  L  +       Y+  D P+ +D  YD + +R  A++ +FP+L 
Sbjct: 16  RPVDKLSADQAAQELARLADLVAQADAAYHGQDAPIMSDAAYDALVQRNAAIEARFPDLM 75

Query: 109 DEDHPWNTVGY 119
            ED P   VG+
Sbjct: 76  REDSPSRRVGF 86


>gi|77165170|ref|YP_343695.1| DNA ligase (NAD+) [Nitrosococcus oceani ATCC 19707]
 gi|254433594|ref|ZP_05047102.1| DNA ligase, NAD-dependent [Nitrosococcus oceani AFC27]
 gi|123730661|sp|Q3JAI1|DNLJ_NITOC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|76883484|gb|ABA58165.1| DNA ligase (NAD+) [Nitrosococcus oceani ATCC 19707]
 gi|207089927|gb|EDZ67198.1| DNA ligase, NAD-dependent [Nitrosococcus oceani AFC27]
          Length = 675

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY ++NPL  D  YDR+   L AL+E +PEL   D P   VG
Sbjct: 25  YYVVNNPLVPDSEYDRLIRELQALEENYPELITLDSPTQRVG 66


>gi|229493359|ref|ZP_04387148.1| DNA ligase, NAD-dependent [Rhodococcus erythropolis SK121]
 gi|229319675|gb|EEN85507.1| DNA ligase, NAD-dependent [Rhodococcus erythropolis SK121]
          Length = 700

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            HQ  YY  D P+ +DG +D +  +L+AL+EQ+P+L   D P   VG
Sbjct: 28  QHQFRYYVRDAPVISDGAFDTLLGQLNALEEQYPDLRTPDSPTQLVG 74


>gi|193212122|ref|YP_001998075.1| DNA ligase, NAD-dependent [Chlorobaculum parvum NCIB 8327]
 gi|254781284|sp|B3QLI5|DNLJ_CHLP8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193085599|gb|ACF10875.1| DNA ligase, NAD-dependent [Chlorobaculum parvum NCIB 8327]
          Length = 674

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +DKAK    + K  A IE          H + YY    P  +D  +D++ ERL AL+ +F
Sbjct: 1   MDKAKAQQEIGKLRAEIE---------RHNRLYYLEAKPEISDFEFDKLLERLIALETEF 51

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   VG
Sbjct: 52  PELVTPDSPSQRVG 65


>gi|260662792|ref|ZP_05863686.1| DNA ligase, NAD-dependent [Lactobacillus fermentum 28-3-CHN]
 gi|260552873|gb|EEX25872.1| DNA ligase, NAD-dependent [Lactobacillus fermentum 28-3-CHN]
          Length = 679

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQ 101
           + K + V+ L+K +A  E   L  +    +KW   YY  DNP   D +YDR  +RL  ++
Sbjct: 1   MSKQEAVSELTKQQAQAE---LTPLREQLKKWGAEYYEQDNPSVEDYVYDRAYQRLVEIE 57

Query: 102 EQFPELFDEDHPWNTVG 118
           ++FP+L   D P   VG
Sbjct: 58  QRFPDLVVPDSPTQRVG 74


>gi|238765534|ref|ZP_04626449.1| DNA ligase [Yersinia kristensenii ATCC 33638]
 gi|238696249|gb|EEP89051.1| DNA ligase [Yersinia kristensenii ATCC 33638]
          Length = 670

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITNDSPTQRVG 63


>gi|88861394|ref|ZP_01136024.1| NAD-dependent DNA ligase [Pseudoalteromonas tunicata D2]
 gi|88816660|gb|EAR26485.1| NAD-dependent DNA ligase [Pseudoalteromonas tunicata D2]
          Length = 673

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 67  VKIALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K+ L    + YY LDNP   D  YDRV   L AL+ Q+P+    D P   VG
Sbjct: 12  LKVQLEEYNYQYYVLDNPSVPDSEYDRVMRELIALETQYPQFLSADSPSQKVG 64


>gi|238790828|ref|ZP_04634584.1| DNA ligase [Yersinia frederiksenii ATCC 33641]
 gi|238721075|gb|EEQ12759.1| DNA ligase [Yersinia frederiksenii ATCC 33641]
          Length = 670

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITNDSPTQRVG 63


>gi|299783520|gb|ADJ41518.1| DNA ligase, NAD-dependent [Lactobacillus fermentum CECT 5716]
          Length = 679

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQ 101
           + K + V+ L+K +A  E   L  +    +KW   YY  DNP   D +YDR  +RL  ++
Sbjct: 1   MSKQEAVSELTKQQAQAE---LTPLREQLKKWGAEYYEQDNPSVEDYVYDRAYQRLVEIE 57

Query: 102 EQFPELFDEDHPWNTVG 118
           ++FP+L   D P   VG
Sbjct: 58  QRFPDLVVPDSPTQRVG 74


>gi|238799224|ref|ZP_04642672.1| DNA ligase [Yersinia mollaretii ATCC 43969]
 gi|238716921|gb|EEQ08789.1| DNA ligase [Yersinia mollaretii ATCC 43969]
          Length = 670

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRLMQQLRDLEAQHPELITSDSPTQRVG 63


>gi|184155951|ref|YP_001844291.1| NAD-dependent DNA ligase [Lactobacillus fermentum IFO 3956]
 gi|254781353|sp|B2GDS9|DNLJ_LACF3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|183227295|dbj|BAG27811.1| NAD-dependent DNA ligase [Lactobacillus fermentum IFO 3956]
          Length = 679

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQ 101
           + K + V+ L+K +A  E   L  +    +KW   YY  DNP   D +YDR  +RL  ++
Sbjct: 1   MSKQEAVSELTKQQAQAE---LTPLREQLKKWGAEYYEQDNPSVEDYVYDRAYQRLVEIE 57

Query: 102 EQFPELFDEDHPWNTVG 118
           ++FP+L   D P   VG
Sbjct: 58  QRFPDLVVPDSPTQRVG 74


>gi|239825842|ref|YP_002948466.1| NAD-dependent DNA ligase LigA [Geobacillus sp. WCH70]
 gi|239806135|gb|ACS23200.1| DNA ligase, NAD-dependent [Geobacillus sp. WCH70]
          Length = 670

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  AM  +E L ++   +   YY LD P   D  YDR+ + L AL+EQ+P+L  +D P
Sbjct: 1   MDRQAAMKRIEELRELLNKYNYEYYVLDRPSVPDAEYDRLMQELIALEEQYPDLKTKDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|114767408|ref|ZP_01446210.1| DNA ligase, NAD-dependent [Pelagibaca bermudensis HTCC2601]
 gi|114540493|gb|EAU43572.1| DNA ligase, NAD-dependent [Roseovarius sp. HTCC2601]
          Length = 757

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +LS+ +A  E+E L  +       Y+  D P  +D  YD +  R  A++E+FPEL  E
Sbjct: 15  VEALSEDQARAELERLAGLLAQANLAYHTEDAPEISDADYDALKRRNVAIEERFPELKRE 74

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 75  DSPSEQVG 82


>gi|255658313|ref|ZP_05403722.1| DNA ligase, NAD-dependent [Mitsuokella multacida DSM 20544]
 gi|260849632|gb|EEX69639.1| DNA ligase, NAD-dependent [Mitsuokella multacida DSM 20544]
          Length = 675

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L K   +H   YY  DNP  +D  YD++  RL A++ ++PEL  ++ P   VG
Sbjct: 16  ELTELRKTIRYHNNRYYNEDNPEISDYEYDQLMLRLKAIEAKYPELITKNSPTQVVG 72


>gi|288554984|ref|YP_003426919.1| NAD-dependent DNA ligase LigA [Bacillus pseudofirmus OF4]
 gi|288546144|gb|ADC50027.1| NAD-dependent DNA ligase LigA [Bacillus pseudofirmus OF4]
          Length = 668

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL TD  YD++ + L AL+ + PEL  ED P   VG
Sbjct: 24  YYVLDQPLVTDAEYDQLMQELIALEGEHPELVSEDSPSVRVG 65


>gi|222149123|ref|YP_002550080.1| NAD-dependent DNA ligase LigA [Agrobacterium vitis S4]
 gi|254781248|sp|B9JY41|DNLJ_AGRVS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221736108|gb|ACM37071.1| DNA ligase [Agrobacterium vitis S4]
          Length = 719

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 33/68 (48%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  LS+ +A  E+  L     HH   Y+  D P  +D  YD +  R DA++ +FP L   
Sbjct: 8   VEDLSEEQAGQELIRLAAAIAHHDALYHGKDQPEISDADYDALKRRNDAIEARFPTLVRS 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPSQRVG 75


>gi|49475845|ref|YP_033886.1| NAD-dependent DNA ligase LigA [Bartonella henselae str. Houston-1]
 gi|81647763|sp|Q6G2R5|DNLJ_BARHE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49238653|emb|CAF27899.1| DNA ligase [Bartonella henselae str. Houston-1]
          Length = 716

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 35/69 (50%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           ++ +L+  EA  E+E+L K    H   Y R D P  +D  YD +  R   ++  FPEL  
Sbjct: 5   EIQNLTALEAASELEWLAKEITRHDVLYNRNDQPEISDAEYDALRRRNAEIEALFPELIR 64

Query: 110 EDHPWNTVG 118
            D P + +G
Sbjct: 65  PDSPSHKIG 73


>gi|116494557|ref|YP_806291.1| NAD-dependent DNA ligase [Lactobacillus casei ATCC 334]
 gi|122264017|sp|Q03AC3|DNLJ_LACC3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116104707|gb|ABJ69849.1| NAD-dependent DNA ligase [Lactobacillus casei ATCC 334]
          Length = 674

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 33/71 (46%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK     +  EA  EVE L K     +  YY  D P  TD +YD     L AL+E +P+L
Sbjct: 3   AKPAAQFTLEEAQAEVEKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEEAYPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQEVG 73


>gi|301066103|ref|YP_003788126.1| NAD-dependent DNA ligase [Lactobacillus casei str. Zhang]
 gi|300438510|gb|ADK18276.1| NAD-dependent DNA ligase [Lactobacillus casei str. Zhang]
          Length = 674

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 33/71 (46%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK     +  EA  EVE L K     +  YY  D P  TD +YD     L AL+E +P+L
Sbjct: 3   AKPAAQFTLEEAQAEVEKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEEAYPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQEVG 73


>gi|294677201|ref|YP_003577816.1| DNA ligase [Rhodobacter capsulatus SB 1003]
 gi|294476021|gb|ADE85409.1| DNA ligase (NAD(+)) [Rhodobacter capsulatus SB 1003]
          Length = 707

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 34/66 (51%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SL++ EA  EV  LV         Y+ LD P  +D  YD +  RL A++ +FP+L   D 
Sbjct: 12  SLTRAEAEAEVPELVARIEAANHAYHTLDAPKISDADYDALKRRLAAIEARFPDLARADS 71

Query: 113 PWNTVG 118
           P   VG
Sbjct: 72  PTMRVG 77


>gi|239631844|ref|ZP_04674875.1| NAD-dependent DNA ligase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|239526309|gb|EEQ65310.1| NAD-dependent DNA ligase [Lactobacillus paracasei subsp. paracasei
           8700:2]
          Length = 674

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 33/71 (46%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK     +  EA  EVE L K     +  YY  D P  TD +YD     L AL+E +P+L
Sbjct: 3   AKPAAQFTLEEAQAEVEKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEEAYPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQEVG 73


>gi|191637997|ref|YP_001987163.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [Lactobacillus
           casei BL23]
 gi|254781352|sp|B3WD54|DNLJ_LACCB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190712299|emb|CAQ66305.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [Lactobacillus
           casei BL23]
 gi|327382073|gb|AEA53549.1| DNA ligase [Lactobacillus casei LC2W]
 gi|327385217|gb|AEA56691.1| DNA ligase [Lactobacillus casei BD-II]
          Length = 674

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 33/71 (46%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK     +  EA  EVE L K     +  YY  D P  TD +YD     L AL+E +P+L
Sbjct: 3   AKPAAQFTLEEAQAEVEKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEEAYPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQEVG 73


>gi|292491548|ref|YP_003526987.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
 gi|291580143|gb|ADE14600.1| DNA ligase, NAD-dependent [Nitrosococcus halophilus Nc4]
          Length = 675

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 33/64 (51%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           +  +A   VE L K+   +   YY LD+P+  D  YDR+   L  L+ Q+PEL   D P 
Sbjct: 3   ATAQARERVETLRKLINDYNYNYYVLDSPVVPDSEYDRLMRELQNLEAQYPELVVPDSPT 62

Query: 115 NTVG 118
             VG
Sbjct: 63  QRVG 66


>gi|225018630|ref|ZP_03707822.1| hypothetical protein CLOSTMETH_02580 [Clostridium methylpentosum
           DSM 5476]
 gi|224948624|gb|EEG29833.1| hypothetical protein CLOSTMETH_02580 [Clostridium methylpentosum
           DSM 5476]
          Length = 659

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +A + V  L K   +H   YY LD+P  +D  YD +   L+ L+ +FPEL  ++ P
Sbjct: 1   MDKKDAQLRVAELTKQLHYHSHRYYVLDDPEISDFDYDAMLRELETLEAEFPELRSDNSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TVRVG 65


>gi|206895761|ref|YP_002246502.1| DNA ligase, NAD-dependent [Coprothermobacter proteolyticus DSM
           5265]
 gi|254781298|sp|B5Y6V5|DNLJ_COPPD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206738378|gb|ACI17456.1| DNA ligase, NAD-dependent [Coprothermobacter proteolyticus DSM
           5265]
          Length = 666

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA   +E L ++  +H   YY LD+P  +D  YD++   L  L++QFPE    D P
Sbjct: 1   MTREEAKKRIERLRELIEYHNYRYYVLDSPEISDEEYDKLYRELVTLEKQFPEFITPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|294504743|ref|YP_003568805.1| DNA ligase [Yersinia pestis Z176003]
 gi|262362805|gb|ACY59526.1| DNA ligase [Yersinia pestis D106004]
 gi|262366729|gb|ACY63286.1| DNA ligase [Yersinia pestis D182038]
 gi|294355202|gb|ADE65543.1| DNA ligase [Yersinia pestis Z176003]
          Length = 656

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 3   HHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTNDSPTQRVG 49


>gi|83590843|ref|YP_430852.1| DNA ligase, NAD-dependent [Moorella thermoacetica ATCC 39073]
 gi|123739230|sp|Q2RGY0|DNLJ_MOOTA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83573757|gb|ABC20309.1| DNA ligase, NAD-dependent [Moorella thermoacetica ATCC 39073]
          Length = 666

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L ++   H   YY LD P  +D  YD + + L AL+E +PEL   D P   VG
Sbjct: 10  VEELRRLIEEHNYRYYVLDQPSISDREYDALMQELIALEEAYPELRTPDSPSQRVG 65


>gi|51597030|ref|YP_071221.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis IP
           32953]
 gi|186896113|ref|YP_001873225.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis PB1/+]
 gi|81638946|sp|Q668M6|DNLJ_YERPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781913|sp|B2K917|DNLJ_YERPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|51590312|emb|CAH21949.1| DNA ligase [Yersinia pseudotuberculosis IP 32953]
 gi|186699139|gb|ACC89768.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis PB1/+]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTNDSPTQRVG 63


>gi|153948204|ref|YP_001400300.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis IP
           31758]
 gi|170023674|ref|YP_001720179.1| NAD-dependent DNA ligase LigA [Yersinia pseudotuberculosis YPIII]
 gi|190359300|sp|A7FGC2|DNLJ_YERP3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781915|sp|B1JFZ0|DNLJ_YERPY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|152959699|gb|ABS47160.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis IP 31758]
 gi|169750208|gb|ACA67726.1| DNA ligase, NAD-dependent [Yersinia pseudotuberculosis YPIII]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTNDSPTQRVG 63


>gi|22125389|ref|NP_668812.1| NAD-dependent DNA ligase LigA [Yersinia pestis KIM 10]
 gi|45442391|ref|NP_993930.1| NAD-dependent DNA ligase LigA [Yersinia pestis biovar Microtus str.
           91001]
 gi|108808172|ref|YP_652088.1| NAD-dependent DNA ligase LigA [Yersinia pestis Antiqua]
 gi|108811556|ref|YP_647323.1| NAD-dependent DNA ligase LigA [Yersinia pestis Nepal516]
 gi|145599373|ref|YP_001163449.1| NAD-dependent DNA ligase LigA [Yersinia pestis Pestoides F]
 gi|149365146|ref|ZP_01887181.1| DNA ligase [Yersinia pestis CA88-4125]
 gi|162420672|ref|YP_001607138.1| NAD-dependent DNA ligase LigA [Yersinia pestis Angola]
 gi|165926903|ref|ZP_02222735.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940356|ref|ZP_02228875.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011271|ref|ZP_02232169.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212520|ref|ZP_02238555.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398917|ref|ZP_02304441.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421338|ref|ZP_02313091.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424444|ref|ZP_02316197.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470665|ref|ZP_02335369.1| DNA ligase, NAD-dependent [Yersinia pestis FV-1]
 gi|218930038|ref|YP_002347913.1| NAD-dependent DNA ligase LigA [Yersinia pestis CO92]
 gi|229838581|ref|ZP_04458740.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895648|ref|ZP_04510819.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Pestoides A]
 gi|229899147|ref|ZP_04514290.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901826|ref|ZP_04516947.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Nepal516]
 gi|270490015|ref|ZP_06207089.1| DNA ligase (NAD(+)) [Yersinia pestis KIM D27]
 gi|122980211|sp|Q1CJV7|DNLJ_YERPN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123372308|sp|Q1C5X9|DNLJ_YERPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123776939|sp|Q7CJF3|DNLJ_YERPE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166216255|sp|A4TMG4|DNLJ_YERPP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781914|sp|A9QZH0|DNLJ_YERPG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|21958274|gb|AAM85063.1|AE013752_4 DNA ligase [Yersinia pestis KIM 10]
 gi|45437255|gb|AAS62807.1| DNA ligase [Yersinia pestis biovar Microtus str. 91001]
 gi|108775204|gb|ABG17723.1| DNA ligase [Yersinia pestis Nepal516]
 gi|108780085|gb|ABG14143.1| DNA ligase [Yersinia pestis Antiqua]
 gi|115348649|emb|CAL21593.1| DNA ligase [Yersinia pestis CO92]
 gi|145211069|gb|ABP40476.1| DNA ligase [Yersinia pestis Pestoides F]
 gi|149291559|gb|EDM41633.1| DNA ligase [Yersinia pestis CA88-4125]
 gi|162353487|gb|ABX87435.1| DNA ligase, NAD-dependent [Yersinia pestis Angola]
 gi|165911711|gb|EDR30369.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921254|gb|EDR38478.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989949|gb|EDR42250.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206451|gb|EDR50931.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960827|gb|EDR56848.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051421|gb|EDR62829.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056326|gb|EDR66095.1| DNA ligase, NAD-dependent [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229680722|gb|EEO76817.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Nepal516]
 gi|229687549|gb|EEO79622.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694947|gb|EEO84994.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701454|gb|EEO89482.1| DNA ligase, NAD(+)-dependent [Yersinia pestis Pestoides A]
 gi|270338519|gb|EFA49296.1| DNA ligase (NAD(+)) [Yersinia pestis KIM D27]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTNDSPTQRVG 63


>gi|320014458|gb|ADV98029.1| DNA ligase, NAD(+)-dependent [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ ++L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRMMQQLRDLEAQHPELVTNDSPTQRVG 63


>gi|78043193|ref|YP_359946.1| DNA ligase, NAD-dependent [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123743192|sp|Q3AD38|DNLJ_CARHZ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77995308|gb|ABB14207.1| DNA ligase, NAD-dependent [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 664

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L  +  +H   YY LD P  +D  YDR+   L +L++Q+PE    D P   VG
Sbjct: 10  IEELRALLHYHNYRYYVLDQPEISDAEYDRMLRELISLEQQYPEFITPDSPSQRVG 65


>gi|307718507|ref|YP_003874039.1| DNA ligase [Spirochaeta thermophila DSM 6192]
 gi|306532232|gb|ADN01766.1| DNA ligase [Spirochaeta thermophila DSM 6192]
          Length = 673

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA  E++ LV++       YY L  P  TD  YD + +RL  L+ QFP L   D P
Sbjct: 1   MTEQEAKKEIDRLVELLQRADYEYYVLGRPHLTDQEYDSLFDRLKTLEAQFPHLKRADSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|89094416|ref|ZP_01167356.1| DNA ligase [Oceanospirillum sp. MED92]
 gi|89081308|gb|EAR60540.1| DNA ligase [Oceanospirillum sp. MED92]
          Length = 674

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD+P   D  YDR+   L  L+   PEL  ED P   VG
Sbjct: 16  HHNYQYYVLDDPEVPDAEYDRLFRELKKLESDNPELITEDSPTQRVG 62


>gi|330808456|ref|YP_004352918.1| DNA ligase (NAD(+)) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376564|gb|AEA67914.1| DNA ligase (NAD(+)) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 785

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+EQ PEL   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEEQHPELVTSDSPTQRVG 63


>gi|312173113|emb|CBX81368.1| DNA ligase [Erwinia amylovora ATCC BAA-2158]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +  H++  Y+ LD P   D  YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 7   KITHLRTLLRHYEHQYHVLDAPTVPDAEYDRLMGELRELETQYPELLTSDSPTQRVG 63


>gi|292488952|ref|YP_003531839.1| DNA ligase [Erwinia amylovora CFBP1430]
 gi|292900089|ref|YP_003539458.1| DNA ligase [Erwinia amylovora ATCC 49946]
 gi|291199937|emb|CBJ47061.1| DNA ligase [Erwinia amylovora ATCC 49946]
 gi|291554386|emb|CBA21816.1| DNA ligase [Erwinia amylovora CFBP1430]
          Length = 670

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +  H++  Y+ LD P   D  YDR+   L  L+ Q+PEL   D P   VG
Sbjct: 7   KITHLRTLLRHYEHQYHVLDAPTVPDAEYDRLMGELRELETQYPELLTSDSPTQRVG 63


>gi|300724062|ref|YP_003713378.1| DNA ligase [Xenorhabdus nematophila ATCC 19061]
 gi|297630595|emb|CBJ91260.1| DNA ligase [Xenorhabdus nematophila ATCC 19061]
          Length = 658

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L AL+EQ PE    D P   +G
Sbjct: 3   HHEYLYHVMDAPEIPDAEYDRLMRELKALEEQHPEWVTADSPTQRIG 49


>gi|304312656|ref|YP_003812254.1| DNA ligase, NAD-dependent [gamma proteobacterium HdN1]
 gi|301798389|emb|CBL46613.1| DNA ligase, NAD-dependent [gamma proteobacterium HdN1]
          Length = 677

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P   D  YDR+ +RL AL++  P+L  +D P   VG
Sbjct: 22  HNYRYYVLDDPSVPDSEYDRLFQRLLALEQAHPDLITQDSPTQRVG 67


>gi|296140594|ref|YP_003647837.1| DNA ligase, NAD-dependent [Tsukamurella paurometabola DSM 20162]
 gi|296028728|gb|ADG79498.1| DNA ligase, NAD-dependent [Tsukamurella paurometabola DSM 20162]
          Length = 688

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +DG +D + +RL A+++ FPEL   D P   VG
Sbjct: 23  HQFRYYVQDAPVLSDGEFDALLKRLQAMEDAFPELAVPDSPTKLVG 68


>gi|56479083|ref|YP_160672.1| NAD-dependent DNA ligase [Aromatoleum aromaticum EbN1]
 gi|81356392|sp|Q5NYU3|DNLJ_AZOSE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56315126|emb|CAI09771.1| NAD-dependent DNA ligase [Aromatoleum aromaticum EbN1]
          Length = 681

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   LDAL+ + PEL   D P   VG
Sbjct: 21  HDHAYYVLDAPTVPDAEYDRLFRELDALERRHPELLVPDSPTRRVG 66


>gi|154248881|ref|YP_001409706.1| DNA ligase, NAD-dependent [Fervidobacterium nodosum Rt17-B1]
 gi|190359256|sp|A7HJG6|DNLJ_FERNB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154152817|gb|ABS60049.1| DNA ligase, NAD-dependent [Fervidobacterium nodosum Rt17-B1]
          Length = 681

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EVE L K   +H   YY L  P+ +D  YD++ +RL  L+E++PEL   D P   VG
Sbjct: 9   EVEKLRKEIEYHNYRYYVLAQPVISDEEYDKLMKRLMELEEKYPELKTPDSPTQRVG 65


>gi|330466191|ref|YP_004403934.1| DNA ligase [Verrucosispora maris AB-18-032]
 gi|328809162|gb|AEB43334.1| DNA ligase, NAD-dependent [Verrucosispora maris AB-18-032]
          Length = 717

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +D  +DR    L AL+E+FP L   D P   VG
Sbjct: 46  HQYRYYVLDAPTVSDAEFDRQLRELTALEEEFPALRTPDSPTQRVG 91


>gi|227356188|ref|ZP_03840577.1| DNA ligase [Proteus mirabilis ATCC 29906]
 gi|227163652|gb|EEI48568.1| DNA ligase [Proteus mirabilis ATCC 29906]
          Length = 675

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L AL+ + PEL   D P   VG
Sbjct: 18  HHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELITPDSPTQRVG 64


>gi|197285679|ref|YP_002151551.1| NAD-dependent DNA ligase LigA [Proteus mirabilis HI4320]
 gi|254781393|sp|B4EZR2|DNLJ_PROMH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194683166|emb|CAR43788.1| DNA ligase [Proteus mirabilis HI4320]
          Length = 675

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L AL+ + PEL   D P   VG
Sbjct: 18  HHEYLYHVMDAPEIPDAEYDRLMNKLKALEAEHPELITPDSPTQRVG 64


>gi|240948595|ref|ZP_04752968.1| NAD-dependent DNA ligase LigA [Actinobacillus minor NM305]
 gi|240297103|gb|EER47674.1| NAD-dependent DNA ligase LigA [Actinobacillus minor NM305]
          Length = 679

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 31/60 (51%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ E+E L      ++  Y+ LDNPL  D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 12  SLSEIETLRNKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELITPDSPTQRVG 71


>gi|219870289|ref|YP_002474664.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis SH0165]
 gi|254781340|sp|B8F314|DNLJ_HAEPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219690493|gb|ACL31716.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis SH0165]
          Length = 675

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E+L +    ++  Y+ LDNPL  D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 8   QLEHLREKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELITSDSPTQRVG 64


>gi|167855687|ref|ZP_02478444.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis 29755]
 gi|167853205|gb|EDS24462.1| NAD-dependent DNA ligase LigA [Haemophilus parasuis 29755]
          Length = 675

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E+L +    ++  Y+ LDNPL  D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 8   QLEHLREKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELITSDSPTQRVG 64


>gi|167750769|ref|ZP_02422896.1| hypothetical protein EUBSIR_01747 [Eubacterium siraeum DSM 15702]
 gi|167656204|gb|EDS00334.1| hypothetical protein EUBSIR_01747 [Eubacterium siraeum DSM 15702]
          Length = 660

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +   E E L K A  H   YY LD+P   D  YDR+  R+  ++ + PE+  E  P
Sbjct: 1   MDKEQIKSEYEQLCKQAEQHNFNYYVLDDPTIEDDEYDRLMRRIKEIEAENPEIVSESSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQHVG 65


>gi|57234606|ref|YP_181338.1| DNA ligase, NAD-dependent [Dehalococcoides ethenogenes 195]
 gi|123759715|sp|Q3Z8W1|DNLJ_DEHE1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|57225054|gb|AAW40111.1| DNA ligase, NAD-dependent [Dehalococcoides ethenogenes 195]
          Length = 677

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L +    H + YY  DNP  +D  YD +  RL  L+E  PEL   D P   VG
Sbjct: 7   EIENLRREINRHNQLYYVQDNPEISDSEYDALLRRLKELEEAHPELVTADSPTQRVG 63


>gi|116617684|ref|YP_818055.1| NAD-dependent DNA ligase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122272115|sp|Q03YP0|DNLJ_LEUMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116096531|gb|ABJ61682.1| NAD-dependent DNA ligase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 680

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  L+  +A  E   L K  + +   YY  D PL  D +YD +  RL AL+E+FP+    
Sbjct: 8   IEKLTTQDAQQETARLQKQLVQYGTAYYEDDAPLVEDYIYDALYARLVALEEKFPQYVIP 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQNVG 75


>gi|291530728|emb|CBK96313.1| DNA ligase, NAD-dependent [Eubacterium siraeum 70/3]
          Length = 660

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +   E E L K A  H   YY LD+P   D  YDR+  R+  ++ + PE+  E  P
Sbjct: 1   MDKEQIKSEYEQLCKQAEQHNFNYYVLDDPTIEDDEYDRLMRRIKEIEAENPEIVSESSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQHVG 65


>gi|218281363|ref|ZP_03487841.1| hypothetical protein EUBIFOR_00406 [Eubacterium biforme DSM 3989]
 gi|218217455|gb|EEC90993.1| hypothetical protein EUBIFOR_00406 [Eubacterium biforme DSM 3989]
          Length = 667

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           YY  DNP  TD  YDR+ + L AL+E++PE++D   P
Sbjct: 24  YYVYDNPSITDQEYDRLMQELMALEEKYPEMYDATSP 60


>gi|158421773|ref|YP_001523065.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
 gi|190359227|sp|A8IGY0|DNLJ_AZOC5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158328662|dbj|BAF86147.1| NAD-dependent DNA ligase [Azorhizobium caulinodans ORS 571]
          Length = 739

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 37  NKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSER 96
           N+ AL +   + K V+ LS  EA  E   L +    H   YY+ D P+ +D  YDR+  R
Sbjct: 4   NRPALPT---RDKAVSDLSATEASDEHAALSQEIASHDARYYQEDAPVISDADYDRLRRR 60

Query: 97  LDALQEQFPELFDEDHPWNTVG 118
            + ++ +FP L ++D     VG
Sbjct: 61  YEDIEARFPALKNDDSLSRKVG 82


>gi|241760920|ref|ZP_04759009.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374539|gb|EER64000.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 731

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS+ +A+IE+E L  +  H+   Y+  DNP   D  YD +  R   +++ FP+L   D P
Sbjct: 26  LSREQAVIELERLANLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDSP 85

Query: 114 WNTVG 118
              VG
Sbjct: 86  SKKVG 90


>gi|302337851|ref|YP_003803057.1| DNA ligase, NAD-dependent [Spirochaeta smaragdinae DSM 11293]
 gi|301635036|gb|ADK80463.1| DNA ligase, NAD-dependent [Spirochaeta smaragdinae DSM 11293]
          Length = 703

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 33/63 (52%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K +A  EV  L  +   + + YY    P  +D  YDR+  RL  L+EQ+PEL  ED P  
Sbjct: 9   KEKATEEVRRLADLLFRYNRAYYIEGKPEVSDTEYDRLFLRLQELEEQWPELKREDSPTL 68

Query: 116 TVG 118
            VG
Sbjct: 69  RVG 71


>gi|260753112|ref|YP_003226005.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552475|gb|ACV75421.1| DNA ligase, NAD-dependent [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 731

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS+ +A+IE+E L  +  H+   Y+  DNP   D  YD +  R   +++ FP+L   D P
Sbjct: 26  LSREQAVIELERLANLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDSP 85

Query: 114 WNTVG 118
              VG
Sbjct: 86  SKKVG 90


>gi|251793989|ref|YP_003008721.1| NAD-dependent DNA ligase LigA [Aggregatibacter aphrophilus NJ8700]
 gi|247535388|gb|ACS98634.1| DNA ligase, NAD-dependent [Aggregatibacter aphrophilus NJ8700]
          Length = 671

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K   +H+  Y+ LD P   D  YDR+  +L AL++Q P L   D P   VG
Sbjct: 8   QIDDLRKTLRYHEYQYHVLDEPQIPDSEYDRLFHQLKALEQQHPALITADSPTQRVG 64


>gi|227432449|ref|ZP_03914436.1| NAD-dependent DNA ligase [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227351770|gb|EEJ42009.1| NAD-dependent DNA ligase [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 680

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  L+  +A  E   L K  + +   YY  D PL  D +YD +  RL AL+E+FP+    
Sbjct: 8   IEKLTTQDAQQETARLQKQLVQYGTAYYEDDAPLVEDYIYDALYARLVALEEKFPQYVIP 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQNVG 75


>gi|223041748|ref|ZP_03611941.1| DNA ligase [Actinobacillus minor 202]
 gi|223017432|gb|EEF15850.1| DNA ligase [Actinobacillus minor 202]
          Length = 680

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L      ++  Y+ LDNPL  D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 15  EIETLRNKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPELITPDSPTQRVG 71


>gi|227498670|ref|ZP_03928814.1| DNA ligase [Acidaminococcus sp. D21]
 gi|226904126|gb|EEH90044.1| DNA ligase [Acidaminococcus sp. D21]
          Length = 674

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++K EA+++ + L K    +   YY  D P  TD  YD +  +L A++ ++PEL   D P
Sbjct: 1   MTKQEALLKAQALRKELERNSYLYYVEDMPTITDAEYDSLMRQLRAIEAEYPELVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQHVG 65


>gi|160872442|ref|ZP_02062574.1| DNA ligase, NAD-dependent [Rickettsiella grylli]
 gi|159121241|gb|EDP46579.1| DNA ligase, NAD-dependent [Rickettsiella grylli]
          Length = 674

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD PL  D  YD +   L+A+++++PEL   D P   VG
Sbjct: 22  HNYHYYILDAPLINDATYDTLFRELEAIEKRYPELITPDSPTQRVG 67


>gi|294506892|ref|YP_003570950.1| NAD-dependent DNA ligase [Salinibacter ruber M8]
 gi|294343220|emb|CBH23998.1| NAD-dependent DNA ligase [Salinibacter ruber M8]
          Length = 691

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P+ +D  YDR+ ++L  L+ ++P L   D P + VG
Sbjct: 34  HHNYRYYVLDAPVVSDAEYDRLFQQLQTLEAEYPGLQTPDSPTHQVG 80


>gi|315498681|ref|YP_004087485.1| DNA ligase, nad-dependent [Asticcacaulis excentricus CB 48]
 gi|315416693|gb|ADU13334.1| DNA ligase, NAD-dependent [Asticcacaulis excentricus CB 48]
          Length = 697

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  YY  + P  TD  YD + + L AL+ Q+P+L   D P   VG
Sbjct: 22  HHRDLYYNQEAPELTDAEYDALEQELRALEAQYPDLHTVDSPTEQVG 68


>gi|83816597|ref|YP_445022.1| DNA ligase, NAD-dependent [Salinibacter ruber DSM 13855]
 gi|123739757|sp|Q2S459|DNLJ_SALRD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83757991|gb|ABC46104.1| DNA ligase, NAD-dependent [Salinibacter ruber DSM 13855]
          Length = 690

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P+ +D  YDR+ ++L  L+ ++P L   D P + VG
Sbjct: 34  HHNYRYYVLDAPVVSDAEYDRLFQQLQTLEAEYPVLQTPDSPTHQVG 80


>gi|326330727|ref|ZP_08197031.1| DNA ligase, NAD-dependent [Nocardioidaceae bacterium Broad-1]
 gi|325951568|gb|EGD43604.1| DNA ligase, NAD-dependent [Nocardioidaceae bacterium Broad-1]
          Length = 702

 Score = 43.9 bits (102), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P  +D  +D+   R++ L+EQFPEL   D P   VG
Sbjct: 31  YYVLDDPTLSDADFDQKWRRINELEEQFPELRTPDSPTQKVG 72


>gi|121533514|ref|ZP_01665342.1| DNA ligase, NAD-dependent [Thermosinus carboxydivorans Nor1]
 gi|121308073|gb|EAX48987.1| DNA ligase, NAD-dependent [Thermosinus carboxydivorans Nor1]
          Length = 673

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A  E E L +   +H   YY LD P  +D  +D +  RL A++E +P L   D P   V
Sbjct: 11  QAAREAEQLRRQIHYHNHRYYVLDAPEISDAEFDALMRRLIAIEEAYPSLITPDSPTQRV 70

Query: 118 G 118
           G
Sbjct: 71  G 71


>gi|114327083|ref|YP_744240.1| NAD-dependent DNA ligase [Granulibacter bethesdensis CGDNIH1]
 gi|122327935|sp|Q0BV35|DNLJ_GRABC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114315257|gb|ABI61317.1| NAD-dependent DNA ligase [Granulibacter bethesdensis CGDNIH1]
          Length = 700

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 33/66 (50%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +LS  EA  E+E L          YYR D PL TD  YD + +R   ++  FP+   ++ 
Sbjct: 16  ALSPAEARAELERLASRIAELDDAYYRDDAPLVTDADYDALRQRNAEIERLFPDAILKNS 75

Query: 113 PWNTVG 118
           P N VG
Sbjct: 76  PANRVG 81


>gi|160899029|ref|YP_001564611.1| NAD-dependent DNA ligase [Delftia acidovorans SPH-1]
 gi|254781308|sp|A9BZW4|DNLJ_DELAS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160364613|gb|ABX36226.1| DNA ligase, NAD-dependent [Delftia acidovorans SPH-1]
          Length = 703

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 24/41 (58%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P   DG YDRV ++L AL+  +PEL   D P   V
Sbjct: 43  YYVLDTPTVPDGEYDRVFQQLQALEGAYPELVTPDSPTQRV 83


>gi|221066629|ref|ZP_03542734.1| DNA ligase, NAD-dependent [Comamonas testosteroni KF-1]
 gi|220711652|gb|EED67020.1| DNA ligase, NAD-dependent [Comamonas testosteroni KF-1]
          Length = 708

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 70  ALHHQKW-----YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           AL  Q W     YY LD P   DG YDRV ++L+AL+  +P L   D P   V
Sbjct: 35  ALRAQLWQWAHEYYVLDAPTVPDGEYDRVYQQLEALEGAYPALVTPDSPTQRV 87


>gi|301063517|ref|ZP_07204049.1| DNA ligase (NAD(+)) [delta proteobacterium NaphS2]
 gi|300442456|gb|EFK06689.1| DNA ligase (NAD(+)) [delta proteobacterium NaphS2]
          Length = 671

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L +   +H   YY LD+P   D  YDR+ +RL  L+ + PEL   D P   VG
Sbjct: 7   EIDELKQKIEYHNHRYYVLDDPEIPDADYDRLFQRLLELETKHPELRSPDSPTRKVG 63


>gi|120403104|ref|YP_952933.1| NAD-dependent DNA ligase LigA [Mycobacterium vanbaalenii PYR-1]
 gi|166216216|sp|A1T6X7|DNLJ_MYCVP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119955922|gb|ABM12927.1| DNA ligase, NAD-dependent [Mycobacterium vanbaalenii PYR-1]
          Length = 707

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ TD  +D +  RL+AL+E  PEL   D P   VG
Sbjct: 39  HQFRYYVRDAPIITDAEFDAMLRRLEALEEAHPELRTPDSPTQLVG 84


>gi|282899989|ref|ZP_06307949.1| NAD-dependent DNA ligase [Cylindrospermopsis raciborskii CS-505]
 gi|281195087|gb|EFA70024.1| NAD-dependent DNA ligase [Cylindrospermopsis raciborskii CS-505]
          Length = 690

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L K+       YY LD+P+  D +YDR+   L  L++++P L   D P   VG
Sbjct: 14  VEELRKLLQQASYAYYVLDSPIMEDTIYDRLYRELQELEKKYPNLVTTDSPTQRVG 69


>gi|254460861|ref|ZP_05074277.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium HTCC2083]
 gi|206677450|gb|EDZ41937.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium HTCC2083]
          Length = 706

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +T LS  EA  E+  L K        Y+  DNP  +D  YD + +R  A+++ FP L  E
Sbjct: 6   ITELSVEEARAELAALSKALNTANVAYHGKDNPDLSDANYDALKQRNAAIEDHFPTLVRE 65

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 66  DSPSKLVG 73


>gi|299139723|ref|ZP_07032896.1| DNA ligase, NAD-dependent [Acidobacterium sp. MP5ACTX8]
 gi|298598347|gb|EFI54512.1| DNA ligase, NAD-dependent [Acidobacterium sp. MP5ACTX8]
          Length = 723

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L +   HH+  YY LD P  TD  YD     L  L+ + PEL   D P   VG
Sbjct: 14  QIEALREDLRHHEHLYYVLDAPELTDAQYDARMNELRRLETEHPELVTPDSPTQRVG 70


>gi|258542980|ref|YP_003188413.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634058|dbj|BAI00034.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637118|dbj|BAI03087.1| DNA ligase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640170|dbj|BAI06132.1| DNA ligase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643227|dbj|BAI09182.1| DNA ligase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646282|dbj|BAI12230.1| DNA ligase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649335|dbj|BAI15276.1| DNA ligase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652321|dbj|BAI18255.1| DNA ligase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655379|dbj|BAI21306.1| DNA ligase [Acetobacter pasteurianus IFO 3283-12]
          Length = 685

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ +A  E+E L     HH   YYR D P  +D  YD +  R DA+  Q PE   E+  
Sbjct: 1   MTQQQAREELERLAAEIAHHNAAYYRNDAPEISDAEYDALRRRYDAIVAQHPEAEPENSA 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  AQAVG 65


>gi|332704021|ref|ZP_08424109.1| DNA ligase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554170|gb|EGJ51214.1| DNA ligase [Desulfovibrio africanus str. Walvis Bay]
          Length = 771

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L K    H   YY LD P+ +D  YDR+   L  L+E  PEL D   P   VG
Sbjct: 12  VERLRKELHFHNYRYYVLDAPVISDAEYDRMMRELQDLEEHNPELRDTSSPTQRVG 67


>gi|119472555|ref|ZP_01614603.1| NAD-dependent DNA ligase [Alteromonadales bacterium TW-7]
 gi|119444879|gb|EAW26179.1| NAD-dependent DNA ligase [Alteromonadales bacterium TW-7]
          Length = 672

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +   H   YY LD P   D  YDR+   L AL+ Q PE    D P   VG
Sbjct: 8   QINHLRTLLEQHNYNYYVLDTPSIPDAEYDRLLRELSALETQNPEFLSADSPTQKVG 64


>gi|293395040|ref|ZP_06639327.1| DNA ligase [Serratia odorifera DSM 4582]
 gi|291422447|gb|EFE95689.1| DNA ligase [Serratia odorifera DSM 4582]
          Length = 673

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L  L+E  PEL   D P   VG
Sbjct: 17  HHEYLYHVLDAPEIPDAEYDRLMRELRTLEEAHPELITADSPTQRVG 63


>gi|15889366|ref|NP_355047.1| NAD-dependent DNA ligase LigA [Agrobacterium tumefaciens str. C58]
 gi|166215388|sp|A9CIB3|DNLJ_AGRT5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15157212|gb|AAK87832.1| DNA ligase [Agrobacterium tumefaciens str. C58]
          Length = 724

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 34/69 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L++ EA  E+ +L      H   Y+  D P  +D  YD +  R DA++  FP L   
Sbjct: 8   VENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEAAFPALVRA 67

Query: 111 DHPWNTVGY 119
           D P   VG+
Sbjct: 68  DSPSKKVGF 76


>gi|84498237|ref|ZP_00997034.1| DNA ligase [Janibacter sp. HTCC2649]
 gi|84381737|gb|EAP97620.1| DNA ligase [Janibacter sp. HTCC2649]
          Length = 731

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L + A  HQ  Y+  D+P  +DG YD++ +RL+ L++++P L   + P  +VG
Sbjct: 40  LAEQATTHQFAYHVKDSPTVSDGEYDKLMKRLNMLEDEYPSLRTPESPTQSVG 92


>gi|307257368|ref|ZP_07539138.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306864218|gb|EFM96131.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
          Length = 682

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|238919178|ref|YP_002932692.1| NAD-dependent DNA ligase LigA [Edwardsiella ictaluri 93-146]
 gi|238868746|gb|ACR68457.1| DNA ligase, NAD-dependent, putative [Edwardsiella ictaluri 93-146]
          Length = 672

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 60  MIE--VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           MIE  +E L     HH+  YY LD+P  TD  YDR+  +L  L+   P L   D P   V
Sbjct: 1   MIEQQLEQLRDALRHHEYQYYVLDDPQITDAEYDRLMMQLKQLEAVHPALVTVDSPSQRV 60

Query: 118 G 118
           G
Sbjct: 61  G 61


>gi|118590881|ref|ZP_01548281.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
 gi|118436403|gb|EAV43044.1| NAD-dependent DNA ligase LigA [Stappia aggregata IAM 12614]
          Length = 750

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 38/68 (55%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L++ EA +E++ L      H + Y++ D P+ +D  YD +  R  +++ +FP L  +
Sbjct: 44  IDALTQEEAQVELKRLAAEIAEHDRRYHQEDAPVISDADYDALRRRNASIEARFPNLILD 103

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 104 DGPSAQVG 111


>gi|325293451|ref|YP_004279315.1| DNA ligase [Agrobacterium sp. H13-3]
 gi|325061304|gb|ADY64995.1| DNA ligase [Agrobacterium sp. H13-3]
          Length = 724

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 34/69 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L++ EA  E+ +L      H   Y+  D P  +D  YD +  R DA++  FP L   
Sbjct: 8   VENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEAAFPALVRA 67

Query: 111 DHPWNTVGY 119
           D P   VG+
Sbjct: 68  DSPSKKVGF 76


>gi|262042032|ref|ZP_06015211.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040623|gb|EEW41715.1| DNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 671

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELITPDSPTQRVG 63


>gi|152971289|ref|YP_001336398.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166215815|sp|A6TC47|DNLJ_KLEP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150956138|gb|ABR78168.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 671

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELITPDSPTQRVG 63


>gi|330013648|ref|ZP_08307732.1| DNA ligase [Klebsiella sp. MS 92-3]
 gi|328533421|gb|EGF60158.1| DNA ligase [Klebsiella sp. MS 92-3]
          Length = 671

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELITPDSPTQRVG 63


>gi|307248328|ref|ZP_07530352.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306855149|gb|EFM87328.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 682

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|307246220|ref|ZP_07528301.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307255203|ref|ZP_07537019.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259638|ref|ZP_07541362.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306852829|gb|EFM85053.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306861831|gb|EFM93809.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866283|gb|EFM98147.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 682

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|238895883|ref|YP_002920619.1| NAD-dependent DNA ligase LigA [Klebsiella pneumoniae NTUH-K2044]
 gi|238548201|dbj|BAH64552.1| DNA ligase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 671

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRKLRELESQHPELITPDSPTQRVG 63


>gi|190150622|ref|YP_001969147.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263969|ref|ZP_07545570.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|254781246|sp|B3H275|DNLJ_ACTP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189915753|gb|ACE62005.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306870658|gb|EFN02401.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 682

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|165976722|ref|YP_001652315.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190359223|sp|B0BQN6|DNLJ_ACTPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|165876823|gb|ABY69871.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
          Length = 682

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|315187042|gb|EFU20799.1| DNA ligase, NAD-dependent [Spirochaeta thermophila DSM 6578]
          Length = 697

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA  E++ LV++       YY L  P  TD  YD + ERL  L+ +FP L   D P
Sbjct: 1   MTEQEAKREIDRLVELLQRADYEYYVLGRPHLTDQEYDSLFERLKTLETRFPHLRRPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  IQRVG 65


>gi|7673996|sp|O87703|DNLJ_BACST RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|3688229|emb|CAA09732.1| DNA ligase [Geobacillus stearothermophilus]
          Length = 670

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQRIG 65


>gi|307261779|ref|ZP_07543445.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306868597|gb|EFN00408.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 676

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 6   GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 65

Query: 117 VG 118
           VG
Sbjct: 66  VG 67


>gi|307250556|ref|ZP_07532498.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306857372|gb|EFM89486.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 682

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|85374270|ref|YP_458332.1| DNA ligase [Erythrobacter litoralis HTCC2594]
 gi|123409617|sp|Q2N9V6|DNLJ_ERYLH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|84787353|gb|ABC63535.1| DNA ligase [Erythrobacter litoralis HTCC2594]
          Length = 736

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 35/70 (50%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           ++ +LS+ EA  E+  L +    H + Y+  D P  TD  YD +  R   L+  FP L  
Sbjct: 4   ELENLSEAEAANELMRLARQIAKHDRLYHAEDAPEITDQEYDALVRRNAELEAAFPHLVR 63

Query: 110 EDHPWNTVGY 119
           ED P   VG+
Sbjct: 64  EDSPSRKVGH 73


>gi|303250616|ref|ZP_07336813.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252937|ref|ZP_07534825.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302650604|gb|EFL80763.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859575|gb|EFM91600.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 682

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|225181787|ref|ZP_03735225.1| DNA ligase, NAD-dependent [Dethiobacter alkaliphilus AHT 1]
 gi|225167561|gb|EEG76374.1| DNA ligase, NAD-dependent [Dethiobacter alkaliphilus AHT 1]
          Length = 667

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A+  VE L +    H   Y+ LD P  +D  +D + ++L+A++ QFP+L   D P
Sbjct: 1   MDRQQALETVEKLRQEIDDHNYRYHVLDEPQISDAEFDDLMQKLEAMEAQFPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|329770498|ref|ZP_08261876.1| DNA ligase [Gemella sanguinis M325]
 gi|328836247|gb|EGF85916.1| DNA ligase [Gemella sanguinis M325]
          Length = 666

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  LVK+   +   YY  DNP  +D  YD + ++L+ L++++PEL  E+ P   VG
Sbjct: 7   EIYKLVKLLNKYSYDYYVEDNPQISDTEYDTLYKQLEKLEKEYPELIQENSPTQRVG 63


>gi|220920535|ref|YP_002495836.1| DNA ligase, NAD-dependent [Methylobacterium nodulans ORS 2060]
 gi|254781366|sp|B8ICE5|DNLJ_METNO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219945141|gb|ACL55533.1| DNA ligase, NAD-dependent [Methylobacterium nodulans ORS 2060]
          Length = 829

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 34/61 (55%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +A+ V  ++  +A    E L      H + Y+  D P+ +D  YD +  RL+A++E+FPE
Sbjct: 7   RARPVEEMTAAQAREAHESLSAEIAEHDRRYHGEDAPIISDAEYDALRRRLEAIEERFPE 66

Query: 107 L 107
           L
Sbjct: 67  L 67


>gi|108803178|ref|YP_643115.1| DNA ligase, NAD-dependent [Rubrobacter xylanophilus DSM 9941]
 gi|122976160|sp|Q1AZ75|DNLJ_RUBXD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|108764421|gb|ABG03303.1| DNA ligase, NAD-dependent [Rubrobacter xylanophilus DSM 9941]
          Length = 685

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
            EA   VE L +   +H + YY  D P  +D  YD +   L+ L+ +FPEL   D P   
Sbjct: 18  AEARQRVEELREQIRYHNRKYYVEDAPEISDAEYDALYRELEELESRFPELVTPDSPTQR 77

Query: 117 VG 118
           VG
Sbjct: 78  VG 79


>gi|329848744|ref|ZP_08263772.1| DNA ligase, NAD-dependent [Asticcacaulis biprosthecum C19]
 gi|328843807|gb|EGF93376.1| DNA ligase, NAD-dependent [Asticcacaulis biprosthecum C19]
          Length = 714

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 11/74 (14%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           LD A+ + S    E   +V+Y       H+  YYR + P  TD  YD + ++L  L+ QF
Sbjct: 3   LDDARALHS----ELAAQVQY-------HRGLYYREETPELTDADYDALEKQLRDLEAQF 51

Query: 105 PELFDEDHPWNTVG 118
           P+L   + P  TVG
Sbjct: 52  PDLKTSESPTQTVG 65


>gi|1770452|emb|CAA66920.1| ligase-like protein [Homo sapiens]
          Length = 454

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  LS   A  EV  L      +   YY  D PL  D +YD +  RL AL+  FP+   +
Sbjct: 8   IEQLSTSAAQQEVAQLQADLTEYGVAYYEQDAPLVEDHVYDALYARLVALESAFPQFVTQ 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQNVG 75


>gi|126462048|ref|YP_001043162.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17029]
 gi|166216229|sp|A3PJ74|DNLJ_RHOS1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126103712|gb|ABN76390.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17029]
          Length = 704

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 36/74 (48%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +   + V  L++ EA  E+  L +        Y+  D P  +D  YD +  R  A++EQF
Sbjct: 1   MQDERPVDQLTEAEAATELARLAEAIEAANTAYHTHDAPQISDADYDALKLRNRAIEEQF 60

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P + VG
Sbjct: 61  PELRRSDSPSDRVG 74


>gi|260598800|ref|YP_003211371.1| NAD-dependent DNA ligase LigA [Cronobacter turicensis z3032]
 gi|260217977|emb|CBA32625.1| DNA ligase [Cronobacter turicensis z3032]
          Length = 672

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L AL+E  PEL   D P   VG
Sbjct: 17  HHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELVTPDSPTQRVG 63


>gi|156933031|ref|YP_001436947.1| NAD-dependent DNA ligase LigA [Cronobacter sakazakii ATCC BAA-894]
 gi|166215403|sp|A7MKW4|DNLJ_ENTS8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|156531285|gb|ABU76111.1| hypothetical protein ESA_00834 [Cronobacter sakazakii ATCC BAA-894]
          Length = 672

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L AL+E  PEL   D P   VG
Sbjct: 17  HHEFLYHVMDAPEVPDAEYDRLMRELRALEEAHPELVTPDSPTQRVG 63


>gi|239618216|ref|YP_002941538.1| DNA ligase, NAD-dependent [Kosmotoga olearia TBF 19.5.1]
 gi|239507047|gb|ACR80534.1| DNA ligase, NAD-dependent [Kosmotoga olearia TBF 19.5.1]
          Length = 672

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY L++P+ TD  YDR+ + L  L++++PEL   D P   +G
Sbjct: 20  YHAYRYYVLNDPIITDEEYDRMLKELQELEKKYPELITPDSPTQRIG 66


>gi|326693831|ref|ZP_08230836.1| DNA ligase, NAD-dependent [Leuconostoc argentinum KCTC 3773]
          Length = 681

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  LS   A  EV  L      +   YY  D PL  D +YD +  RL AL+  FP+   +
Sbjct: 8   IEQLSTSAAQQEVAQLQADLTEYGVAYYEQDAPLVEDHVYDALYARLVALESAFPQFVTQ 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQNVG 75


>gi|310657889|ref|YP_003935610.1| DNA ligase [Clostridium sticklandii DSM 519]
 gi|308824667|emb|CBH20705.1| DNA ligase, NAD(+)-dependent [Clostridium sticklandii]
          Length = 683

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY  D+P  +D  +D + + L AL+E++PE   ED P   +G
Sbjct: 23  HHSILYYVQDSPEISDADFDMLMKELIALEEKYPEYITEDSPTQRIG 69


>gi|261418603|ref|YP_003252285.1| NAD-dependent DNA ligase LigA [Geobacillus sp. Y412MC61]
 gi|319765418|ref|YP_004130919.1| DNA ligase, NAD-dependent [Geobacillus sp. Y412MC52]
 gi|261375060|gb|ACX77803.1| DNA ligase, NAD-dependent [Geobacillus sp. Y412MC61]
 gi|317110284|gb|ADU92776.1| DNA ligase, NAD-dependent [Geobacillus sp. Y412MC52]
          Length = 670

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELMAIEEQYPELKTSDSPTQRIG 65


>gi|209545276|ref|YP_002277505.1| NAD-dependent DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532953|gb|ACI52890.1| DNA ligase, NAD-dependent [Gluconacetobacter diazotrophicus PAl 5]
          Length = 708

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           + L++ +AM+E+E L +      + YY  D P  TD  YD + +R  A++ +FP+L   D
Sbjct: 17  SELTEPQAMVELERLAQQIRALDRAYYEDDAPTVTDAEYDALRQRNLAIEARFPDLRRAD 76

Query: 112 HP 113
            P
Sbjct: 77  SP 78


>gi|162148970|ref|YP_001603431.1| DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|190359260|sp|A9H0L6|DNLJ_GLUDA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161787547|emb|CAP57143.1| putative DNA ligase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 695

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           + L++ +AM+E+E L +      + YY  D P  TD  YD + +R  A++ +FP+L   D
Sbjct: 4   SELTEPQAMVELERLAQQIRALDRAYYEDDAPTVTDAEYDALRQRNLAIEARFPDLRRAD 63

Query: 112 HP 113
            P
Sbjct: 64  SP 65


>gi|71907364|ref|YP_284951.1| NAD-dependent DNA ligase [Dechloromonas aromatica RCB]
 gi|123746888|sp|Q47FA0|DNLJ_DECAR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71846985|gb|AAZ46481.1| NAD-dependent DNA ligase [Dechloromonas aromatica RCB]
          Length = 683

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD++   L  L++Q+PEL   D P + VG
Sbjct: 21  HSYAYYVLDAPTIPDTEYDKLFRELQELEQQYPELLTADSPTHRVG 66


>gi|56418811|ref|YP_146129.1| NAD-dependent DNA ligase LigA [Geobacillus kaustophilus HTA426]
 gi|81348272|sp|Q5L3B9|DNLJ_GEOKA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56378653|dbj|BAD74561.1| DNA ligase (polydeoxyribonucleotide synthase[NAD+]) [Geobacillus
           kaustophilus HTA426]
          Length = 670

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELMAIEEQYPELKTSDSPTQRIG 65


>gi|15827911|ref|NP_302174.1| NAD-dependent DNA ligase LigA [Mycobacterium leprae TN]
 gi|221230388|ref|YP_002503804.1| NAD-dependent DNA ligase LigA [Mycobacterium leprae Br4923]
 gi|7674013|sp|O33102|DNLJ_MYCLE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781376|sp|B8ZS27|DNLJ_MYCLB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|2414536|emb|CAB16425.1| DNA ligase [Mycobacterium leprae]
 gi|13093464|emb|CAC30658.1| DNA ligase [Mycobacterium leprae]
 gi|219933495|emb|CAR71800.1| DNA ligase [Mycobacterium leprae Br4923]
          Length = 694

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D + +RL  L+EQ PEL   D P   VG
Sbjct: 27  HQFRYYVRDAPIISDAEFDALLDRLTVLEEQHPELCTPDSPTQLVG 72


>gi|258404928|ref|YP_003197670.1| DNA ligase, NAD-dependent [Desulfohalobium retbaense DSM 5692]
 gi|257797155|gb|ACV68092.1| DNA ligase, NAD-dependent [Desulfohalobium retbaense DSM 5692]
          Length = 678

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P  +D  YD + + L AL+ ++PEL D   P   VG
Sbjct: 19  HHDYLYYVLDAPQISDNEYDALFKELQALEHRYPELDDPASPTKRVG 65


>gi|255657267|ref|ZP_05402676.1| DNA ligase [Clostridium difficile QCD-23m63]
          Length = 674

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 6   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 62


>gi|255102476|ref|ZP_05331453.1| DNA ligase [Clostridium difficile QCD-63q42]
          Length = 674

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 6   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 62


>gi|297528690|ref|YP_003669965.1| DNA ligase, NAD-dependent [Geobacillus sp. C56-T3]
 gi|297251942|gb|ADI25388.1| DNA ligase, NAD-dependent [Geobacillus sp. C56-T3]
          Length = 670

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQRIG 65


>gi|71042246|pdb|1ZAU|A Chain A, Adenylation Domain Of Nad+ Dependent Dna Ligase From
           M.Tuberculosis
          Length = 328

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D +  RL+AL+EQ PEL   D P   VG
Sbjct: 27  HQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVG 72


>gi|260426307|ref|ZP_05780286.1| DNA ligase, NAD-dependent [Citreicella sp. SE45]
 gi|260420799|gb|EEX14050.1| DNA ligase, NAD-dependent [Citreicella sp. SE45]
          Length = 754

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 38/69 (55%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           +V +L++ +A  E+  L ++     + Y+  D P  +D  YD +  R  A++E+FPEL  
Sbjct: 10  EVEALTETQARDELARLAEVLAQANRAYHTEDAPEISDADYDALKLRNIAIEERFPELKR 69

Query: 110 EDHPWNTVG 118
           ED P   VG
Sbjct: 70  EDSPSEQVG 78


>gi|328887795|emb|CAJ70206.2| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [Clostridium
           difficile]
          Length = 674

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 6   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 62


>gi|315122567|ref|YP_004063056.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495969|gb|ADR52568.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 739

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE---L 107
           +  LS  +A  E+ +L     +H   YY+   P   D  YD++ ER DA+   FPE   L
Sbjct: 9   IEELSPEQAKKELSFLQHEISYHDDLYYQHSQPKILDFEYDQLKERCDAIARAFPEFASL 68

Query: 108 FDEDHPWNTVG 118
            D + P N +G
Sbjct: 69  ADSNGPLNKIG 79


>gi|296451892|ref|ZP_06893609.1| NAD-dependent DNA ligase LigA [Clostridium difficile NAP08]
 gi|296879713|ref|ZP_06903688.1| NAD-dependent DNA ligase LigA [Clostridium difficile NAP07]
 gi|296259274|gb|EFH06152.1| NAD-dependent DNA ligase LigA [Clostridium difficile NAP08]
 gi|296429302|gb|EFH15174.1| NAD-dependent DNA ligase LigA [Clostridium difficile NAP07]
          Length = 677

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 9   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 65


>gi|260684853|ref|YP_003216138.1| DNA ligase [Clostridium difficile CD196]
 gi|260688511|ref|YP_003219645.1| DNA ligase [Clostridium difficile R20291]
 gi|260211016|emb|CBA66332.1| DNA ligase [Clostridium difficile CD196]
 gi|260214528|emb|CBE07046.1| DNA ligase [Clostridium difficile R20291]
          Length = 677

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 9   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 65


>gi|241889713|ref|ZP_04777011.1| DNA ligase, NAD-dependent [Gemella haemolysans ATCC 10379]
 gi|241863335|gb|EER67719.1| DNA ligase, NAD-dependent [Gemella haemolysans ATCC 10379]
          Length = 663

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  LV +   +   YY  DNP  TD  YD + ++L+ L+E++PEL  E+ P   VG
Sbjct: 7   EILKLVSLLNKYSYEYYVEDNPQITDTEYDTLYKQLEKLEEKYPELILENSPTQRVG 63


>gi|126700928|ref|YP_001089825.1| DNA ligase [Clostridium difficile 630]
 gi|123362868|sp|Q180F3|DNLJ_CLOD6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 677

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 9   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 65


>gi|254976908|ref|ZP_05273380.1| DNA ligase [Clostridium difficile QCD-66c26]
 gi|255308381|ref|ZP_05352552.1| DNA ligase [Clostridium difficile ATCC 43255]
 gi|255316048|ref|ZP_05357631.1| DNA ligase [Clostridium difficile QCD-76w55]
 gi|255518705|ref|ZP_05386381.1| DNA ligase [Clostridium difficile QCD-97b34]
 gi|255651827|ref|ZP_05398729.1| DNA ligase [Clostridium difficile QCD-37x79]
 gi|306521614|ref|ZP_07407961.1| DNA ligase [Clostridium difficile QCD-32g58]
          Length = 674

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L++   +H + YY  D+P  +D  YD++ + L +L+E+ PEL   D P N VG
Sbjct: 6   EINKLIETINYHNERYYNQDSPEISDYEYDKLMKELISLEEEHPELKRIDSPTNRVG 62


>gi|328950509|ref|YP_004367844.1| DNA ligase [Marinithermus hydrothermalis DSM 14884]
 gi|328450833|gb|AEB11734.1| DNA ligase [Marinithermus hydrothermalis DSM 14884]
          Length = 676

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA   V  L +   +H   YY LD+P  +D  YD +   L AL+ ++P+L   D P
Sbjct: 1   MTREEAKKRVLELRQAIRYHNYRYYVLDDPEISDAEYDALMRELKALEARYPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQVVG 65


>gi|256847801|ref|ZP_05553246.1| DNA ligase, NAD-dependent [Lactobacillus coleohominis 101-4-CHN]
 gi|256715490|gb|EEU30466.1| DNA ligase, NAD-dependent [Lactobacillus coleohominis 101-4-CHN]
          Length = 674

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  EA  E+  L +  +   K YY  DNP   D +YDR  +RL  L+ +FPEL   D P
Sbjct: 6   ITLAEAKKEIGPLRQQLIQWGKEYYEQDNPSVEDYVYDRQYQRLVELEARFPELVTPDSP 65

Query: 114 WNTVG 118
              VG
Sbjct: 66  TQRVG 70


>gi|282896837|ref|ZP_06304843.1| NAD-dependent DNA ligase [Raphidiopsis brookii D9]
 gi|281198246|gb|EFA73136.1| NAD-dependent DNA ligase [Raphidiopsis brookii D9]
          Length = 692

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L K+       YY LD+P+  D +YDR+   L  L++++P L   D P   VG
Sbjct: 14  VEELRKLLQQAGYAYYVLDSPIMEDTIYDRLYRELQELEKKYPNLVTSDSPTQRVG 69


>gi|296445905|ref|ZP_06887856.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
 gi|296256573|gb|EFH03649.1| DNA ligase, NAD-dependent [Methylosinus trichosporium OB3b]
          Length = 713

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  LS   A +E   L +    + + YY+ D+P  +D  YD + +R +AL++ FPEL  +
Sbjct: 21  VAELSPRRAKLEHSRLAEEIAEYDRRYYQEDDPAISDAEYDALRQRYEALEKAFPELGGD 80

Query: 111 DHPWNTVG 118
                TVG
Sbjct: 81  ASLTKTVG 88


>gi|182677699|ref|YP_001831845.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|254781257|sp|B2IGH4|DNLJ_BEII9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|182633582|gb|ACB94356.1| DNA ligase, NAD-dependent [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 699

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 34/70 (48%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K + SLS  +A  E   L +    H + YY+ D P  +D  YD +  R +AL+  FPEL 
Sbjct: 5   KPIESLSPAQAKREHRRLGEQITEHDRLYYQEDAPRVSDAEYDALRRRYEALETAFPELV 64

Query: 109 DEDHPWNTVG 118
             +     +G
Sbjct: 65  SAESLTKKIG 74


>gi|327394702|dbj|BAK12124.1| DNA ligase LigA [Pantoea ananatis AJ13355]
          Length = 672

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+EQ P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELEEQHPDLITPDSPTQRVG 63


>gi|291618312|ref|YP_003521054.1| LigA [Pantoea ananatis LMG 20103]
 gi|291153342|gb|ADD77926.1| LigA [Pantoea ananatis LMG 20103]
          Length = 672

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+EQ P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELEEQHPDLITPDSPTQRVG 63


>gi|332525978|ref|ZP_08402119.1| DNA ligase (NAD+) [Rubrivivax benzoatilyticus JA2]
 gi|332109529|gb|EGJ10452.1| DNA ligase (NAD+) [Rubrivivax benzoatilyticus JA2]
          Length = 686

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L +I  HH   YY LD P   D  YDR+ + L A++ + P+L   D P
Sbjct: 13  LRRILSHHAHRYYVLDAPEIPDAEYDRLFQELQAIESEHPDLLTPDSP 60


>gi|33151983|ref|NP_873336.1| NAD-dependent DNA ligase LigA [Haemophilus ducreyi 35000HP]
 gi|81423646|sp|Q7VMX7|DNLJ_HAEDU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33148205|gb|AAP95725.1| DNA ligase [Haemophilus ducreyi 35000HP]
          Length = 686

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ L+NPL  D  YDR+  +L  +++Q+PEL   D P   VG
Sbjct: 32  YHVLNNPLVPDAEYDRLINQLKNIEQQYPELITPDSPTQRVG 73


>gi|192361192|ref|YP_001982383.1| DNA ligase, NAD-dependent [Cellvibrio japonicus Ueda107]
 gi|254781281|sp|B3PGQ8|DNLJ_CELJU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190687357|gb|ACE85035.1| DNA ligase, NAD-dependent [Cellvibrio japonicus Ueda107]
          Length = 680

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L +   +H   YY LD P   D  YDR+ +RL  L+ Q+P     D P   VG
Sbjct: 13  EIAQLREQIRYHNYRYYALDEPQIPDAEYDRLMQRLRELEAQYPASVTPDSPTQRVG 69


>gi|5733399|gb|AAD49562.1|AF126866_1 NAD-dependent DNA ligase [Pseudoalteromonas haloplanktis]
          Length = 672

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +V +L  I   H   YY LD P   D  YDR+   L AL+ + PE    D P   VG
Sbjct: 8   QVNHLRIILEQHNYNYYVLDTPSIPDSEYDRLLRELSALETEHPEFLTADSPTQKVG 64


>gi|300779557|ref|ZP_07089415.1| NAD-dependent DNA ligase LigA [Chryseobacterium gleum ATCC 35910]
 gi|300505067|gb|EFK36207.1| NAD-dependent DNA ligase LigA [Chryseobacterium gleum ATCC 35910]
          Length = 667

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L K    H + YY+LD P  TD  +D + + L  L+ ++PE +DE+ P   VG
Sbjct: 9   IEQLRKELHQHNENYYQLDTPTITDFEFDMLLQELQDLEARYPEFYDENSPTVRVG 64


>gi|89900985|ref|YP_523456.1| DNA ligase [Rhodoferax ferrireducens T118]
 gi|123397178|sp|Q21WC8|DNLJ_RHOFD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|89345722|gb|ABD69925.1| DNA ligase, NAD-dependent [Rhodoferax ferrireducens T118]
          Length = 690

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 70  ALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ALH H   YY  D P   D  YDR+ + L A++ Q PEL   D P   VG
Sbjct: 25  ALHEHAHHYYVEDAPTIPDAEYDRMFQELQAIEAQHPELITPDSPTQRVG 74


>gi|238756322|ref|ZP_04617636.1| DNA ligase [Yersinia ruckeri ATCC 29473]
 gi|238705475|gb|EEP97878.1| DNA ligase [Yersinia ruckeri ATCC 29473]
          Length = 674

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEHQYHVLDAPEIPDAEYDRLMGELRELEAQHPELITADSPTQRVG 63


>gi|83953544|ref|ZP_00962265.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
 gi|83841489|gb|EAP80658.1| DNA ligase, NAD-dependent [Sulfitobacter sp. NAS-14.1]
          Length = 706

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS+ EA  E+  L  +       Y+  D P  +D  YDR+  R  A++E+FP L   D P
Sbjct: 10  LSEEEAKAELARLADLLGRANAAYHTQDAPDLSDAEYDRLKRRNQAIEERFPRLKRADSP 69

Query: 114 WNTVG 118
            + VG
Sbjct: 70  SDKVG 74


>gi|302670775|ref|YP_003830735.1| NAD-dependent DNA ligase LigA1 [Butyrivibrio proteoclasticus B316]
 gi|302395248|gb|ADL34153.1| NAD-dependent DNA ligase LigA1 [Butyrivibrio proteoclasticus B316]
          Length = 675

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV    HH   YY  D P  +D  YD++  RL  ++ ++PEL   D P   VG
Sbjct: 15  LVSEIKHHMDLYYNQDEPEISDYEYDQLMIRLKKMESEYPELVSNDSPSQIVG 67


>gi|289208742|ref|YP_003460808.1| DNA ligase, NAD-dependent [Thioalkalivibrio sp. K90mix]
 gi|288944373|gb|ADC72072.1| DNA ligase, NAD-dependent [Thioalkalivibrio sp. K90mix]
          Length = 697

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           T+ + GE    +E L +   HH   YY LD+P  +D  +D +   L+ L+   P+L   D
Sbjct: 11  TTGAAGEVGERIEQLRRQIEHHNYRYYVLDDPEVSDAEFDALMRELEQLEADHPDLVTPD 70

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 71  SPTQRVG 77


>gi|332638905|ref|ZP_08417768.1| NAD-dependent DNA ligase [Weissella cibaria KACC 11862]
          Length = 678

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 37/74 (50%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +D  + + +++  EA  E++ L +      + YY  D P   D +YDR   RL+AL+  +
Sbjct: 1   MDNFQDIATMTVIEAKAEIDALQQDLKQWAQEYYENDAPSVEDAVYDREYNRLEALEAAY 60

Query: 105 PELFDEDHPWNTVG 118
           PEL   D     VG
Sbjct: 61  PELVTPDSITQQVG 74


>gi|308450080|ref|XP_003088175.1| hypothetical protein CRE_02776 [Caenorhabditis remanei]
 gi|308249279|gb|EFO93231.1| hypothetical protein CRE_02776 [Caenorhabditis remanei]
          Length = 1202

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 30/60 (50%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A +E E L      ++  YY     L +D  YD +  RL+AL+  FPEL  +D P   VG
Sbjct: 179 ARVEAEQLTAEIERYRAAYYSEATSLVSDAQYDELFHRLEALERAFPELAGQDSPTQEVG 238


>gi|329115587|ref|ZP_08244309.1| DNA ligase [Acetobacter pomorum DM001]
 gi|326695015|gb|EGE46734.1| DNA ligase [Acetobacter pomorum DM001]
          Length = 710

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 33/66 (50%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +++  +A  E+E+L     HH   YYR D P  +D  YD +  R DA+  Q P+   E+ 
Sbjct: 25  TMTLQQAREELEHLAAEIAHHNAAYYRNDAPEISDAEYDALRRRYDAIVAQHPQAEPENS 84

Query: 113 PWNTVG 118
               VG
Sbjct: 85  AAQAVG 90


>gi|172036733|ref|YP_001803234.1| DNA ligase [Cyanothece sp. ATCC 51142]
 gi|254781304|sp|B1WZL6|DNLJ_CYAA5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|171698187|gb|ACB51168.1| DNA ligase [Cyanothece sp. ATCC 51142]
          Length = 676

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P+  D +YD++   LD+L+++ P+L   D P   VG
Sbjct: 25  YYVLDDPIMEDAVYDQLYRELDSLEKEHPQLITPDSPTQRVG 66


>gi|270307958|ref|YP_003330016.1| DNA ligase, NAD-dependent [Dehalococcoides sp. VS]
 gi|270153850|gb|ACZ61688.1| DNA ligase, NAD-dependent [Dehalococcoides sp. VS]
          Length = 680

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L +    H + YY  DNP  +D  YD +  RL  L+E  PEL   + P   VG
Sbjct: 10  EIENLRREINRHNQLYYVQDNPEISDSEYDALLRRLKELEEAHPELVTPNSPTQRVG 66


>gi|308050127|ref|YP_003913693.1| DNA ligase, NAD-dependent [Ferrimonas balearica DSM 9799]
 gi|307632317|gb|ADN76619.1| DNA ligase, NAD-dependent [Ferrimonas balearica DSM 9799]
          Length = 685

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 30/61 (49%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A   +E L ++   +   YY LDNP   D  YDR+   L AL+ + P L   D P   V
Sbjct: 12  QAKDRIEQLSQLLNDYNHQYYVLDNPSVPDAEYDRLMRELQALEAEHPALRQPDSPTQRV 71

Query: 118 G 118
           G
Sbjct: 72  G 72


>gi|295107089|emb|CBL04632.1| DNA ligase, NAD-dependent [Gordonibacter pamelaeae 7-10-1-b]
          Length = 731

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 31  EAKFLPNKRAL-ESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGL 89
           E + L ++RAL E+  D A ++ +L +     E+E       HH   YY  D P  +DG 
Sbjct: 27  EQQNLLDERALAEATSDPAARIEALRR-----EIE-------HHTYLYYAQDAPEISDGA 74

Query: 90  YDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +D +   L  L+   PEL D   P   VG
Sbjct: 75  FDSLMRELRELEAAHPELVDPSSPTQRVG 103


>gi|148652285|ref|YP_001279378.1| DNA ligase [Psychrobacter sp. PRwf-1]
 gi|190359276|sp|A5WCN7|DNLJ_PSYWF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148571369|gb|ABQ93428.1| DNA ligase, NAD-dependent [Psychrobacter sp. PRwf-1]
          Length = 686

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + ++  L+     H   YY +D P  +D  YD++   L  L+E++PEL   D P  +V
Sbjct: 16  EVIAKMRTLIAQVRKHNNAYYVMDEPTISDNEYDQLRLSLIELEERYPELTQPDSPTASV 75

Query: 118 G 118
           G
Sbjct: 76  G 76


>gi|326381521|ref|ZP_08203215.1| NAD-dependent DNA ligase LigA [Gordonia neofelifaecis NRRL B-59395]
 gi|326199768|gb|EGD56948.1| NAD-dependent DNA ligase LigA [Gordonia neofelifaecis NRRL B-59395]
          Length = 692

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +DG +D +  RL AL+++ PEL   D P   VG
Sbjct: 25  HQFRYYVQDAPVISDGEFDTLLRRLQALEDEHPELAVADSPTKLVG 70


>gi|218439827|ref|YP_002378156.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 7424]
 gi|254781306|sp|B7K8U0|DNLJ_CYAP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218172555|gb|ACK71288.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 7424]
          Length = 678

 Score = 42.7 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   L  ++ Q+PEL   D P   VG
Sbjct: 26  YYVLDNPIMEDVVYDQLYRELQNIETQYPELITPDSPTQRVG 67


>gi|148243508|ref|YP_001228665.1| NAD-dependent DNA ligase LigA [Synechococcus sp. RCC307]
 gi|166216253|sp|A5GWQ3|DNLJ_SYNR3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147851818|emb|CAK29312.1| NAD-dependent DNA ligase [Synechococcus sp. RCC307]
          Length = 675

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L+  A H    YY LD P F D +YDR+   L  L++Q P+L   D P   VG
Sbjct: 13  ELRQLLNRAAHA---YYVLDAPEFEDAVYDRLYRELLDLEQQHPDLLSADSPTQRVG 66


>gi|317121135|ref|YP_004101138.1| DNA ligase, NAD-dependent [Thermaerobacter marianensis DSM 12885]
 gi|315591115|gb|ADU50411.1| DNA ligase, NAD-dependent [Thermaerobacter marianensis DSM 12885]
          Length = 764

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P   D  YD +   L  L+ +FPE+   D P   VG
Sbjct: 37  HHDYLYYVLDRPEIDDAAYDALMRELRELEARFPEIVTPDSPTQRVG 83


>gi|254448715|ref|ZP_05062173.1| DNA ligase, NAD-dependent [gamma proteobacterium HTCC5015]
 gi|198261723|gb|EDY86010.1| DNA ligase, NAD-dependent [gamma proteobacterium HTCC5015]
          Length = 673

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L +L+ Q+PE   +D P   VG
Sbjct: 20  QHAHAYYVLDEPSIPDAEYDRLFRELQSLEAQYPESHSDDSPTQRVG 66


>gi|73667316|ref|YP_303332.1| NAD-dependent DNA ligase [Ehrlichia canis str. Jake]
 gi|123732189|sp|Q3YRC1|DNLJ_EHRCJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|72394457|gb|AAZ68734.1| NAD-dependent DNA ligase [Ehrlichia canis str. Jake]
          Length = 677

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA +E++ L     HH   YY  DNP  TD  YD +  + + + E FPEL   ++ 
Sbjct: 1   MKQEEAKLELDKLNSQIQHHDFLYYTQDNPQITDAEYDVLCHKRNLILESFPELASNNNY 60

Query: 114 WNTVG 118
            + VG
Sbjct: 61  QDNVG 65


>gi|254411541|ref|ZP_05025318.1| DNA ligase, NAD-dependent [Microcoleus chthonoplastes PCC 7420]
 gi|196182042|gb|EDX77029.1| DNA ligase, NAD-dependent [Microcoleus chthonoplastes PCC 7420]
          Length = 676

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  DNP+  D +YD++   L  L+ Q+PEL   D P   VG
Sbjct: 22  YYVRDNPMMEDAVYDQLYRELQDLESQYPELVTPDSPTQRVG 63


>gi|90410985|ref|ZP_01218999.1| DNA ligase [Photobacterium profundum 3TCK]
 gi|90328198|gb|EAS44509.1| DNA ligase [Photobacterium profundum 3TCK]
          Length = 697

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 38/82 (46%)

Query: 37  NKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSER 96
           N +   S L K   V S    +   +++ L +   +H   YY  DNP   D  YDR+ ++
Sbjct: 9   NGKPKRSILTKTVLVGSEMSTDIQQQLDTLREQLAYHGHRYYVEDNPEIPDAEYDRMMQQ 68

Query: 97  LDALQEQFPELFDEDHPWNTVG 118
           L AL+   PEL   D P   VG
Sbjct: 69  LLALEADHPELMSVDSPSQRVG 90


>gi|294011619|ref|YP_003545079.1| NAD-dependent DNA ligase [Sphingobium japonicum UT26S]
 gi|292674949|dbj|BAI96467.1| NAD-dependent DNA ligase [Sphingobium japonicum UT26S]
          Length = 711

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +TS+++ EA   +  L +    H + Y+  D P  TD  YD +    +AL+  FP L   
Sbjct: 4   LTSMTEAEAANHLMRLAREIARHNRLYHDQDQPEITDAAYDALIRENNALEAAFPHLVRS 63

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 64  DSPNAQVG 71


>gi|329912476|ref|ZP_08275756.1| DNA ligase [Oxalobacteraceae bacterium IMCC9480]
 gi|327545605|gb|EGF30768.1| DNA ligase [Oxalobacteraceae bacterium IMCC9480]
          Length = 679

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP+  D  YD +   L+AL+   PEL   D P   VG
Sbjct: 23  HAHAYYVLDNPVIPDADYDLLFRELEALEASHPELVTADSPTRRVG 68


>gi|163751929|ref|ZP_02159142.1| DNA ligase, NAD-dependent [Shewanella benthica KT99]
 gi|161328212|gb|EDP99377.1| DNA ligase, NAD-dependent [Shewanella benthica KT99]
          Length = 690

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           E+E+L+     H   Y+ LD+P+ TD  YDR+  +L  L+ +FP L
Sbjct: 11  EIEHLISEINEHDHRYHVLDDPIITDSEYDRLKIKLKKLENRFPAL 56


>gi|290508381|ref|ZP_06547752.1| DNA ligase, NAD-dependent [Klebsiella sp. 1_1_55]
 gi|289777775|gb|EFD85772.1| DNA ligase, NAD-dependent [Klebsiella sp. 1_1_55]
          Length = 671

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELESQHPELITPDSPTQRVG 63


>gi|161502427|ref|YP_001569539.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|190359281|sp|A9MIG0|DNLJ_SALAR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160863774|gb|ABX20397.1| hypothetical protein SARI_00461 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 671

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L AL+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRALEAQRPDLITPDSPTQRVG 63


>gi|6573451|pdb|1B04|A Chain A, Structure Of The Adenylation Domain Of An Nad+ Dependent
           Ligase
 gi|6573452|pdb|1B04|B Chain B, Structure Of The Adenylation Domain Of An Nad+ Dependent
           Ligase
          Length = 318

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQRIG 65


>gi|300311482|ref|YP_003775574.1| NAD-dependent DNA ligase [Herbaspirillum seropedicae SmR1]
 gi|300074267|gb|ADJ63666.1| NAD-dependent DNA ligase (contains BRCT domain type II) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 688

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+ + L AL+   PEL   D P   VG
Sbjct: 32  HNYSYYVLDQPSIPDAEYDRLFQELQALETAHPELLTPDSPTQRVG 77


>gi|330722383|gb|EGH00233.1| DNA ligase [gamma proteobacterium IMCC2047]
          Length = 258

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EVE L      H   YY LD P   D  YDR+  +L  ++ Q PEL  +D P   VG
Sbjct: 9   EVEALRAQLNQHNYRYYVLDEPSIPDVEYDRLLRQLQTIEAQHPELISQDSPTQRVG 65


>gi|320102706|ref|YP_004178297.1| NAD-dependent DNA ligase [Isosphaera pallida ATCC 43644]
 gi|319749988|gb|ADV61748.1| DNA ligase, NAD-dependent [Isosphaera pallida ATCC 43644]
          Length = 896

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L +   HH + YY    P+ +D  YDR+ + L+AL+ + P+L   D P   VG
Sbjct: 18  IERLRREIEHHNRLYYVEAAPVISDAEYDRLVKDLEALEAERPDLVTPDSPTQRVG 73


>gi|206579402|ref|YP_002237241.1| DNA ligase, NAD-dependent [Klebsiella pneumoniae 342]
 gi|288934177|ref|YP_003438236.1| DNA ligase, NAD-dependent [Klebsiella variicola At-22]
 gi|254781350|sp|B5XVT4|DNLJ_KLEP3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206568460|gb|ACI10236.1| DNA ligase, NAD-dependent [Klebsiella pneumoniae 342]
 gi|288888906|gb|ADC57224.1| DNA ligase, NAD-dependent [Klebsiella variicola At-22]
          Length = 671

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELESQHPELITPDSPTQRVG 63


>gi|111225216|ref|YP_716010.1| DNA ligase [Frankia alni ACN14a]
 gi|122953782|sp|Q0RDH8|DNLJ_FRAAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|111152748|emb|CAJ64491.1| DNA ligase [Frankia alni ACN14a]
          Length = 771

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P  +D  YDR+   L AL+E  PEL   D P   V 
Sbjct: 73  HAYRYYVLDSPTVSDAEYDRLMRELTALEEHHPELRTPDSPTQKVA 118


>gi|299529801|ref|ZP_07043234.1| DNA ligase, NAD-dependent [Comamonas testosteroni S44]
 gi|298722215|gb|EFI63139.1| DNA ligase, NAD-dependent [Comamonas testosteroni S44]
          Length = 708

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 24/41 (58%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P   DG YDRV ++L+AL+  +P L   D P   V
Sbjct: 47  YYVLDTPTVPDGEYDRVYQQLEALEGAYPALVTPDSPTQRV 87


>gi|268323600|emb|CBH37188.1| DNA ligase [uncultured archaeon]
          Length = 667

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YDR+   L+ L+ ++PEL   D P   +G
Sbjct: 23  YHNYRYYVLDEPEISDAEYDRLFVELEELERKYPELITPDSPTQRIG 69


>gi|264678823|ref|YP_003278730.1| DNA ligase, NAD-dependent [Comamonas testosteroni CNB-2]
 gi|262209336|gb|ACY33434.1| DNA ligase, NAD-dependent [Comamonas testosteroni CNB-2]
          Length = 708

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 24/41 (58%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P   DG YDRV ++L+AL+  +P L   D P   V
Sbjct: 47  YYVLDTPTVPDGEYDRVYQQLEALEGAYPALVTPDSPTQRV 87


>gi|319937197|ref|ZP_08011604.1| DNA ligase [Coprobacillus sp. 29_1]
 gi|319807563|gb|EFW04156.1| DNA ligase [Coprobacillus sp. 29_1]
          Length = 662

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E +IE++ L+     +   YY LDNP  +D  YDR+ + L A++ Q PE    D P   V
Sbjct: 4   ERLIEIKKLLN---EYNYQYYVLDNPSVSDQEYDRLMQELQAIENQHPEWLTADSPSQRV 60

Query: 118 G 118
           G
Sbjct: 61  G 61


>gi|309389839|gb|ADO77719.1| DNA ligase, NAD-dependent [Halanaerobium praevalens DSM 2228]
          Length = 670

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L+K +A  ++  L +    H+  Y+ LD+P  +D  +D++ + L  L+ +FP+L  E
Sbjct: 1   MINLNKEKASKKITALKEKIRKHEYKYFVLDDPSISDAEFDQLMQELIKLESEFPDLITE 60

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 61  DSPTQRVG 68


>gi|240850882|ref|YP_002972282.1| DNA ligase [Bartonella grahamii as4aup]
 gi|240268005|gb|ACS51593.1| DNA ligase [Bartonella grahamii as4aup]
          Length = 719

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 33/66 (50%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +L+  EA  E+E+L K    H   Y R D P  +D  YD +  R   ++  FPEL   D 
Sbjct: 8   NLTAVEAESELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRVDS 67

Query: 113 PWNTVG 118
           P + +G
Sbjct: 68  PSHKIG 73


>gi|160934306|ref|ZP_02081693.1| hypothetical protein CLOLEP_03177 [Clostridium leptum DSM 753]
 gi|156866979|gb|EDO60351.1| hypothetical protein CLOLEP_03177 [Clostridium leptum DSM 753]
          Length = 661

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H K YY  DNP  TD  YD +   L+ ++  +PEL  ED P   VG
Sbjct: 19  YHAKKYYEEDNPEITDYEYDMMLRELEGIELAYPELVTEDSPTQRVG 65


>gi|320105506|ref|YP_004181096.1| NAD-dependent DNA ligase [Terriglobus saanensis SP1PR4]
 gi|319924027|gb|ADV81102.1| DNA ligase, NAD-dependent [Terriglobus saanensis SP1PR4]
          Length = 694

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  YY LD P  +D  YD +   L AL+ + PEL   + P   VG
Sbjct: 16  HHEHAYYVLDKPEISDAQYDALVNLLKALETEHPELVTPESPTQRVG 62


>gi|217979603|ref|YP_002363750.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
 gi|254781370|sp|B8ETN6|DNLJ_METSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|217504979|gb|ACK52388.1| DNA ligase, NAD-dependent [Methylocella silvestris BL2]
          Length = 700

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 48  AKKVTSLSKGEAMIEVEYL-VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           AK + +++  +A  E   L  +IA H  + YYR D P  +D  YDR+  R   L+  FPE
Sbjct: 3   AKPIDAMTLAQARREHSRLGAEIAAHDAR-YYREDAPTVSDAEYDRLRRRYGELESAFPE 61

Query: 107 LFDEDHPWNTVG 118
           L   D     VG
Sbjct: 62  LASPDSLTKKVG 73


>gi|237733138|ref|ZP_04563619.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229383820|gb|EEO33911.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 664

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 71  LHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L+H   YY  DNP  TD  YD + + L  L+++ PE    D P   VG
Sbjct: 15  LYHNDRYYNQDNPEITDYEYDMMMQELKGLEQKHPEYITSDSPTQKVG 62


>gi|167756540|ref|ZP_02428667.1| hypothetical protein CLORAM_02077 [Clostridium ramosum DSM 1402]
 gi|167702715|gb|EDS17294.1| hypothetical protein CLORAM_02077 [Clostridium ramosum DSM 1402]
          Length = 664

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 71  LHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L+H   YY  DNP  TD  YD + + L  L+++ PE    D P   VG
Sbjct: 15  LYHNDRYYNQDNPEITDYEYDMMMQELKGLEQKHPEYITSDSPTQKVG 62


>gi|332532506|ref|ZP_08408384.1| DNA ligase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038149|gb|EGI74596.1| DNA ligase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 672

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L      H   YY LD P   D  YDR+   L AL+ Q PE    D P   VG
Sbjct: 8   QINHLRTTLEQHNYNYYVLDTPSIPDSEYDRLLRELSALEMQHPEFLTADSPTQKVG 64


>gi|118594798|ref|ZP_01552145.1| DNA ligase, NAD-dependent [Methylophilales bacterium HTCC2181]
 gi|118440576|gb|EAV47203.1| DNA ligase, NAD-dependent [Methylophilales bacterium HTCC2181]
          Length = 671

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L K+   H   YY LDNPL +D  +D++   + A+++  PEL   D P   VG
Sbjct: 14  LKKLISEHNYHYYVLDNPLISDAEFDKIFLEIKAIEDLNPELITIDSPTQRVG 66


>gi|54308062|ref|YP_129082.1| NAD-dependent DNA ligase LigA [Photobacterium profundum SS9]
 gi|81615410|sp|Q6LTU5|DNLJ_PHOPR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|46912488|emb|CAG19280.1| putative NAD-dependent DNA ligase [Photobacterium profundum SS9]
          Length = 676

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+ ++L AL+ + PEL   D P   VG
Sbjct: 23  YHGHRYYVEDNPEIPDAEYDRMMQQLLALEAEHPELMSVDSPSQRVG 69


>gi|323140467|ref|ZP_08075395.1| DNA ligase (NAD+) [Phascolarctobacterium sp. YIT 12067]
 gi|322415035|gb|EFY05826.1| DNA ligase (NAD+) [Phascolarctobacterium sp. YIT 12067]
          Length = 679

 Score = 42.7 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 60  MIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + E + L +   H++  YY LD P  TD  YDR+  RL  L+ ++P+    D P   VG
Sbjct: 15  LAEADKLRREIRHNEYLYYVLDAPEITDAEYDRMMVRLRELEARYPDSIPADSPTQRVG 73


>gi|238063192|ref|ZP_04607901.1| DNA ligase, NAD-dependent [Micromonospora sp. ATCC 39149]
 gi|237885003|gb|EEP73831.1| DNA ligase, NAD-dependent [Micromonospora sp. ATCC 39149]
          Length = 702

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +D  +DR    L+AL+ +FP L   D P   +G
Sbjct: 31  HQYRYYVLDAPTVSDAEFDRQLRELEALEAEFPALRTPDSPTQRIG 76


>gi|220906114|ref|YP_002481425.1| NAD-dependent DNA ligase LigA [Cyanothece sp. PCC 7425]
 gi|254781305|sp|B8HV17|DNLJ_CYAP4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219862725|gb|ACL43064.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 7425]
          Length = 738

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           + ++E+  LV+ A +    YY LD P+  D +YD++   L  L+ Q+PEL   D P   V
Sbjct: 22  QRVLELRQLVQRASYA---YYVLDAPILEDVVYDQLYRELQDLETQYPELLTPDSPTQRV 78

Query: 118 G 118
           G
Sbjct: 79  G 79


>gi|163868703|ref|YP_001609915.1| NAD-dependent DNA ligase LigA [Bartonella tribocorum CIP 105476]
 gi|190359235|sp|A9IW95|DNLJ_BART1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161018362|emb|CAK01920.1| DNA ligase [Bartonella tribocorum CIP 105476]
          Length = 719

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +L+  EA  E+E+L K    H   Y R D P  +D  YD +  R   ++  FPEL   
Sbjct: 6   IKNLTVVEAERELEWLAKEIARHDVLYNRDDQPEISDAEYDALRRRNAEIEALFPELIRV 65

Query: 111 DHPWNTVG 118
           D P + +G
Sbjct: 66  DSPSHKIG 73


>gi|283786048|ref|YP_003365913.1| DNA ligase [Citrobacter rodentium ICC168]
 gi|282949502|emb|CBG89116.1| DNA ligase [Citrobacter rodentium ICC168]
          Length = 671

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELITPDSPTQRVG 63


>gi|261340751|ref|ZP_05968609.1| DNA ligase, NAD-dependent [Enterobacter cancerogenus ATCC 35316]
 gi|288317173|gb|EFC56111.1| DNA ligase, NAD-dependent [Enterobacter cancerogenus ATCC 35316]
          Length = 671

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELITPDSPTQRVG 63


>gi|159897339|ref|YP_001543586.1| DNA ligase, NAD-dependent [Herpetosiphon aurantiacus ATCC 23779]
 gi|254781348|sp|A9AXP4|DNLJ_HERA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|159890378|gb|ABX03458.1| DNA ligase, NAD-dependent [Herpetosiphon aurantiacus ATCC 23779]
          Length = 673

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD PL +D  YD +   L A++ ++PEL   D P   VG
Sbjct: 23  HH---YYTLDAPLVSDAQYDSLLNELRAIEAEYPELRTPDSPTQRVG 66


>gi|227535466|ref|ZP_03965515.1| DNA ligase (polydeoxyribonucleotide synthase [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|227186876|gb|EEI66943.1| DNA ligase (polydeoxyribonucleotide synthase [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
          Length = 674

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 32/71 (45%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK     +  EA  EVE L K     +  YY  D P  TD +YD     L AL+  +P+L
Sbjct: 3   AKPAAQFTLEEAQAEVEKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEAAYPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQEVG 73


>gi|257060505|ref|YP_003138393.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 8802]
 gi|256590671|gb|ACV01558.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 8802]
          Length = 674

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   L  L+ Q+P L   D P   VG
Sbjct: 26  YYVLDNPIMEDSVYDQLYRELQDLESQYPILITPDSPTQRVG 67


>gi|163794455|ref|ZP_02188426.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
 gi|159180179|gb|EDP64702.1| NAD-dependent DNA ligase [alpha proteobacterium BAL199]
          Length = 696

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 32/66 (48%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
            K V  LS  EA  E+  L        + Y+  D P+ TD  YD +  R  A++E+FP+L
Sbjct: 9   GKPVEELSDAEAKAELRRLSDAISEADRQYHVEDAPVLTDAEYDALRRRNQAIEERFPDL 68

Query: 108 FDEDHP 113
              D P
Sbjct: 69  KLADSP 74


>gi|148658591|ref|YP_001278796.1| DNA ligase [Roseiflexus sp. RS-1]
 gi|166216236|sp|A5V1U3|DNLJ_ROSS1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148570701|gb|ABQ92846.1| DNA ligase, NAD-dependent [Roseiflexus sp. RS-1]
          Length = 726

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L +   +H   YY LD P+ +D  YD +   L AL+   PEL   D P   VG
Sbjct: 10  VEALREQIRYHNYRYYVLDEPVISDAEYDALMRELRALEAAHPELVTPDSPTQRVG 65


>gi|218248171|ref|YP_002373542.1| NAD-dependent DNA ligase [Cyanothece sp. PCC 8801]
 gi|254781307|sp|B7K0A2|DNLJ_CYAP8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218168649|gb|ACK67386.1| DNA ligase, NAD-dependent [Cyanothece sp. PCC 8801]
          Length = 674

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   L  L+ Q+P L   D P   VG
Sbjct: 26  YYVLDNPIMEDSVYDQLYRELQDLESQYPILITPDSPTQRVG 67


>gi|317180385|dbj|BAJ58171.1| NAD-dependent DNA ligase LigA [Helicobacter pylori F32]
          Length = 656

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD++ + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDKLYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|313673736|ref|YP_004051847.1| DNA ligase, nad-dependent [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940492|gb|ADR19684.1| DNA ligase, NAD-dependent [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 655

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           + + LVK   HH   YY L++P  +D  YD + ++L  ++E+ PE    D P   VG+
Sbjct: 7   DYDRLVKELNHHCIRYYLLNDPAISDAKYDNLYKQLRKIEEEHPEWISPDSPTQRVGF 64


>gi|317153517|ref|YP_004121565.1| DNA ligase, NAD-dependent [Desulfovibrio aespoeensis Aspo-2]
 gi|316943768|gb|ADU62819.1| DNA ligase, NAD-dependent [Desulfovibrio aespoeensis Aspo-2]
          Length = 678

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  E +    +L +   HH   YY LD+P  +D  YD +   L AL+   PEL D + P
Sbjct: 1   MASSEIIDRAAWLRERIEHHNHRYYVLDDPEISDAEYDALFRELAALEAAHPELDDANSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TRRVG 65


>gi|291613759|ref|YP_003523916.1| DNA ligase, NAD-dependent [Sideroxydans lithotrophicus ES-1]
 gi|291583871|gb|ADE11529.1| DNA ligase, NAD-dependent [Sideroxydans lithotrophicus ES-1]
          Length = 701

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 22/43 (51%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           WYY  D P   D  YD++   L AL+ Q PEL   D P   VG
Sbjct: 23  WYYVKDMPRIPDAEYDKLFRELQALEAQHPELLASDSPTQRVG 65


>gi|83942325|ref|ZP_00954786.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
 gi|83846418|gb|EAP84294.1| DNA ligase, NAD-dependent [Sulfitobacter sp. EE-36]
          Length = 706

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS+ EA  E+  L  +       Y+  D P  +D  YDR+  R  A++E+FP L   D P
Sbjct: 10  LSEEEAKAELARLADLLGRANTAYHTQDAPDLSDAEYDRLKRRNQAIEERFPGLKRADSP 69

Query: 114 WNTVG 118
            + VG
Sbjct: 70  SDKVG 74


>gi|83647417|ref|YP_435852.1| DNA ligase, NAD-dependent [Hahella chejuensis KCTC 2396]
 gi|123767368|sp|Q2SD47|DNLJ_HAHCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83635460|gb|ABC31427.1| DNA ligase, NAD-dependent [Hahella chejuensis KCTC 2396]
          Length = 683

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P   D  YDR+  RL  ++ +FP+    D P   VG
Sbjct: 22  HNYRYYTLDDPSIPDAEYDRLMRRLREIEAEFPQTITPDSPTQRVG 67


>gi|257784913|ref|YP_003180130.1| DNA ligase, NAD-dependent [Atopobium parvulum DSM 20469]
 gi|257473420|gb|ACV51539.1| DNA ligase, NAD-dependent [Atopobium parvulum DSM 20469]
          Length = 705

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + +LS  E     E L +I  H    YY LDNP  TD  +DR+   L  L+  +PEL  E
Sbjct: 1   MAALSPKETARAAE-LNRILNHAAYAYYALDNPELTDAEFDRLLIELQQLEAAYPELITE 59

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 60  DSYTQRVG 67


>gi|94984803|ref|YP_604167.1| DNA ligase, NAD-dependent [Deinococcus geothermalis DSM 11300]
 gi|122986680|sp|Q1J0I6|DNLJ_DEIGD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|94555084|gb|ABF44998.1| DNA ligase, NAD-dependent [Deinococcus geothermalis DSM 11300]
          Length = 684

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY LD P   D  YDR+   L AL+   PE   E+ P  TVG
Sbjct: 34  HNRAYYELDAPEIPDDEYDRLVRELRALEAAHPEWVAENSPAQTVG 79


>gi|307546309|ref|YP_003898788.1| DNA ligase, NAD-dependent [Halomonas elongata DSM 2581]
 gi|307218333|emb|CBV43603.1| DNA ligase, NAD-dependent [Halomonas elongata DSM 2581]
          Length = 700

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  TD  YDR   RL  ++ ++PEL   D P   VG
Sbjct: 44  YYVLDEPRMTDADYDRKLRRLQEIETEYPELVRPDSPTQRVG 85


>gi|134094553|ref|YP_001099628.1| DNA ligase [Herminiimonas arsenicoxydans]
 gi|166215813|sp|A4G4R4|DNLJ_HERAR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|133738456|emb|CAL61501.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [Herminiimonas
           arsenicoxydans]
          Length = 696

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP+  D  YD++   L AL+   PEL   D P   VG
Sbjct: 41  HNYAYYVLDNPIVPDAEYDQLFRELQALEASHPELLVFDSPTQRVG 86


>gi|261838144|gb|ACX97910.1| DNA ligase [Helicobacter pylori 51]
          Length = 656

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D LYD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDALYDELYQELKAYEEKNPNGIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|315223456|ref|ZP_07865313.1| NAD-dependent DNA ligase LigA [Capnocytophaga ochracea F0287]
 gi|314946629|gb|EFS98620.1| NAD-dependent DNA ligase LigA [Capnocytophaga ochracea F0287]
          Length = 662

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP  +D  +D+  + L AL++ +PE +DE+ P   VG
Sbjct: 15  HNYNYYVLDNPTISDYEFDQKLKELQALEQAYPEFYDENSPTVRVG 60


>gi|300173629|ref|YP_003772795.1| DNA ligase, NAD-dependent [Leuconostoc gasicomitatum LMG 18811]
 gi|299888008|emb|CBL91976.1| DNA ligase, NAD-dependent [Leuconostoc gasicomitatum LMG 18811]
          Length = 681

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 35/74 (47%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L + K +  LS+  A  E+  L      +   YY  D P+  D +YD +  RL AL+  F
Sbjct: 2   LPELKPIEKLSREAAQHEIAKLQDDLRQYGIAYYEQDAPIVEDYIYDALYARLVALETVF 61

Query: 105 PELFDEDHPWNTVG 118
           P+  + D P   VG
Sbjct: 62  PQFINPDSPTQNVG 75


>gi|87199755|ref|YP_497012.1| DNA ligase, NAD-dependent [Novosphingobium aromaticivorans DSM
           12444]
 gi|123763512|sp|Q2G7J5|DNLJ_NOVAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|87135436|gb|ABD26178.1| DNA ligase, NAD-dependent [Novosphingobium aromaticivorans DSM
           12444]
          Length = 721

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           ++L++ EA  E+  L +    H + Y+  D+P  TD  YD +  R   L+  FP L   D
Sbjct: 4   SALTEAEAANELMRLARQIAKHNRLYHAEDSPEITDAEYDALVRRNAELEAAFPHLIRPD 63

Query: 112 HPWNTVGY 119
            P   +G+
Sbjct: 64  SPSAQIGH 71


>gi|297616809|ref|YP_003701968.1| DNA ligase, NAD-dependent [Syntrophothermus lipocalidus DSM 12680]
 gi|297144646|gb|ADI01403.1| DNA ligase, NAD-dependent [Syntrophothermus lipocalidus DSM 12680]
          Length = 668

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD PL +D  YDR+   L  L++ +P+L   D P   VG
Sbjct: 18  HDYHYYVLDQPLISDAEYDRLFRELVELEQAYPDLVTPDSPTQRVG 63


>gi|256820386|ref|YP_003141665.1| DNA ligase, NAD-dependent [Capnocytophaga ochracea DSM 7271]
 gi|256581969|gb|ACU93104.1| DNA ligase, NAD-dependent [Capnocytophaga ochracea DSM 7271]
          Length = 662

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP  +D  +D+  + L AL++ +PE +DE+ P   VG
Sbjct: 15  HNYNYYVLDNPTISDYEFDQKLKELQALEQAYPEFYDENSPTVRVG 60


>gi|310768269|gb|ADP13219.1| NAD-dependent DNA ligase LigA [Erwinia sp. Ejp617]
          Length = 670

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +  H++  Y+ LD P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 7   KITHLRTLLRHYEYQYHVLDAPAVPDAEYDRLMGELRELEAQHPELLTSDSPTQRVG 63


>gi|260576789|ref|ZP_05844774.1| DNA ligase, NAD-dependent [Rhodobacter sp. SW2]
 gi|259021041|gb|EEW24352.1| DNA ligase, NAD-dependent [Rhodobacter sp. SW2]
          Length = 705

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K +  L++ EA +E + L +        Y++ D P  TD  YD +  RL A++  FP+L 
Sbjct: 5   KAIEQLTEAEAAVEWQELARAVAQANIDYHQNDAPKLTDATYDAMKRRLAAIEVLFPQL- 63

Query: 109 DEDHPWNTVG 118
             D P + VG
Sbjct: 64  ATDSPTSKVG 73


>gi|149173204|ref|ZP_01851835.1| DNA ligase [Planctomyces maris DSM 8797]
 gi|148848010|gb|EDL62342.1| DNA ligase [Planctomyces maris DSM 8797]
          Length = 671

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L K   HH + YY    P  TD  YDR+ +RL+ L+   PE    + P   VG
Sbjct: 6   EIEELRKQLEHHNRLYYLDAKPEITDREYDRLMKRLEQLETDHPEYDSPESPTKKVG 62


>gi|119476275|ref|ZP_01616626.1| DNA ligase [marine gamma proteobacterium HTCC2143]
 gi|119450139|gb|EAW31374.1| DNA ligase [marine gamma proteobacterium HTCC2143]
          Length = 781

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +T +S  +  IE E    + LH+ + Y+ LD P   D  YDR+  +L  L+ +FP+    
Sbjct: 1   MTEISDPKQQIE-ELRSTVNLHNYR-YHALDEPTVPDAEYDRLIRQLQVLEAKFPQFITN 58

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 59  DSPTQRVG 66


>gi|146312580|ref|YP_001177654.1| NAD-dependent DNA ligase LigA [Enterobacter sp. 638]
 gi|190359255|sp|A4WD23|DNLJ_ENT38 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145319456|gb|ABP61603.1| DNA ligase, NAD-dependent [Enterobacter sp. 638]
          Length = 671

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRELEAQHPELVTPDSPTQRVG 63


>gi|121604718|ref|YP_982047.1| DNA ligase [Polaromonas naphthalenivorans CJ2]
 gi|166216226|sp|A1VN98|DNLJ_POLNA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120593687|gb|ABM37126.1| DNA ligase, NAD-dependent [Polaromonas naphthalenivorans CJ2]
          Length = 707

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+ + L AL+   PEL   D P   VG
Sbjct: 34  HAHRYYVLDEPSIPDAEYDRLFKELQALEAAHPELLTPDSPTQRVG 79


>gi|94986686|ref|YP_594619.1| NAD-dependent DNA ligase [Lawsonia intracellularis PHE/MN1-00]
 gi|123385090|sp|Q1MRS8|DNLJ_LAWIP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|94730935|emb|CAJ54298.1| NAD-dependent DNA ligase (contains BRCT domain type II) [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 682

 Score = 42.4 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 30/66 (45%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SL   +    V  L K   HH   YY LD+P  +D  YD+  + L  L+  FP L   + 
Sbjct: 9   SLPSKKEKQRVRELRKFINHHNYLYYTLDDPEISDSEYDKAFQELLTLENTFPSLKTNNS 68

Query: 113 PWNTVG 118
           P   VG
Sbjct: 69  PTQKVG 74


>gi|269127766|ref|YP_003301136.1| DNA ligase, NAD-dependent [Thermomonospora curvata DSM 43183]
 gi|268312724|gb|ACY99098.1| DNA ligase, NAD-dependent [Thermomonospora curvata DSM 43183]
          Length = 722

 Score = 42.4 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YDR+   L  L+E+ PEL   D P   VG
Sbjct: 29  YYVLDRPTLSDAEYDRLMRELRELEERHPELVTPDSPTQRVG 70


>gi|157371681|ref|YP_001479670.1| NAD-dependent DNA ligase LigA [Serratia proteamaculans 568]
 gi|190359284|sp|A8GHF2|DNLJ_SERP5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157323445|gb|ABV42542.1| DNA ligase, NAD-dependent [Serratia proteamaculans 568]
          Length = 673

 Score = 42.0 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L AL+   PEL   D P   VG
Sbjct: 17  HHEYQYHVLDAPEVPDAEYDRLMGELRALESAHPELITADSPTQRVG 63


>gi|56751245|ref|YP_171946.1| NAD-dependent DNA ligase LigA [Synechococcus elongatus PCC 6301]
 gi|81299088|ref|YP_399296.1| NAD-dependent DNA ligase LigA [Synechococcus elongatus PCC 7942]
 gi|81596046|sp|Q5N2P4|DNLJ_SYNP6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123728245|sp|Q31RL0|DNLJ_SYNE7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56686204|dbj|BAD79426.1| DNA ligase [Synechococcus elongatus PCC 6301]
 gi|81167969|gb|ABB56309.1| DNA ligase, NAD-dependent [Synechococcus elongatus PCC 7942]
          Length = 679

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YDR+   L  L++Q P L   D P   VG
Sbjct: 31  YYVLDQPVMEDAVYDRLYRELQDLEQQHPSLITPDSPTQRVG 72


>gi|296104078|ref|YP_003614224.1| NAD-dependent DNA ligase LigA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058537|gb|ADF63275.1| NAD-dependent DNA ligase LigA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 671

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRDLEAQHPELITPDSPTQRVG 63


>gi|225873424|ref|YP_002754883.1| DNA ligase, NAD-dependent [Acidobacterium capsulatum ATCC 51196]
 gi|254781243|sp|C1F7S7|DNLJ_ACIC5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225792636|gb|ACO32726.1| DNA ligase, NAD-dependent [Acidobacterium capsulatum ATCC 51196]
          Length = 677

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +S   A  ++E L +   HH+  YY  D P   D  +D +  +L  L+ + PEL   D P
Sbjct: 1   MSHASAAQQIESLRESIRHHEYLYYVQDQPEIDDLAFDELMRKLQRLEAEHPELITPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|328542977|ref|YP_004303086.1| DNA ligase, NAD(+)-dependent [polymorphum gilvum SL003B-26A1]
 gi|326412723|gb|ADZ69786.1| DNA ligase, NAD(+)-dependent [Polymorphum gilvum SL003B-26A1]
          Length = 721

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           IA H Q+ Y+  D P  +D  YD +  R  A++E+FP+L  ED P   +G
Sbjct: 29  IAAHDQR-YFAEDAPTVSDAEYDALRRRNAAIEERFPDLVREDSPSARIG 77


>gi|294661389|ref|YP_003573265.1| hypothetical protein Aasi_1926 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|254781251|sp|C3L496|DNLJ_AMOA5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|227336540|gb|ACP21137.1| hypothetical protein Aasi_1926 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 671

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +A  E++ L  +  +H K YY    P  +D  +D++ E+L AL+ QFP+L   + P
Sbjct: 1   MDKEQARKEIKRLTALVAYHNKLYYEEAQPEISDYEFDQLLEKLIALENQFPDLRLPNSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|116748867|ref|YP_845554.1| DNA ligase, NAD-dependent [Syntrophobacter fumaroxidans MPOB]
 gi|116697931|gb|ABK17119.1| DNA ligase, NAD-dependent [Syntrophobacter fumaroxidans MPOB]
          Length = 694

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 29/61 (47%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A   +E L +   HH   YY LD P  +D  YD +   L  L+E +P L   D P   V
Sbjct: 25  KAHARIEALREEIRHHNYLYYVLDRPEISDEAYDGLFRELVRLEESYPALITPDSPTQRV 84

Query: 118 G 118
           G
Sbjct: 85  G 85


>gi|166216279|sp|A0LI67|DNLJ_SYNFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 675

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 29/61 (47%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A   +E L +   HH   YY LD P  +D  YD +   L  L+E +P L   D P   V
Sbjct: 6   KAHARIEALREEIRHHNYLYYVLDRPEISDEAYDGLFRELVRLEESYPALITPDSPTQRV 65

Query: 118 G 118
           G
Sbjct: 66  G 66


>gi|323136604|ref|ZP_08071685.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
 gi|322397921|gb|EFY00442.1| DNA ligase, NAD-dependent [Methylocystis sp. ATCC 49242]
          Length = 705

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 32/68 (47%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  LS  EA  E   L +    + + YYR D PL  D  YD    R +AL++ FPEL   
Sbjct: 12  VDELSPAEARAEHARLGEDIARYDEAYYREDAPLVPDAEYDAARRRYEALEKAFPELVTP 71

Query: 111 DHPWNTVG 118
           +     VG
Sbjct: 72  ESLTRKVG 79


>gi|328885211|emb|CCA58450.1| DNA ligase [Streptomyces venezuelae ATCC 10712]
          Length = 726

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +DG +D++   L+AL+E++PEL   D P   V 
Sbjct: 26  HRFRYYVKDQPVISDGEFDKLLRALEALEEEYPELRTPDSPTQKVA 71


>gi|258645494|ref|ZP_05732963.1| DNA ligase, NAD-dependent [Dialister invisus DSM 15470]
 gi|260402847|gb|EEW96394.1| DNA ligase, NAD-dependent [Dialister invisus DSM 15470]
          Length = 669

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
            E + + E L K   +H   YY LD P  TD  +DR+   L  L++++PE+   D P   
Sbjct: 4   AEIIKKAEELRKKLRYHSYLYYVLDKPEITDFEFDRLYRSLVDLEKEYPEIVTPDSPTQR 63

Query: 117 VG 118
           VG
Sbjct: 64  VG 65


>gi|167770441|ref|ZP_02442494.1| hypothetical protein ANACOL_01786 [Anaerotruncus colihominis DSM
           17241]
 gi|167667036|gb|EDS11166.1| hypothetical protein ANACOL_01786 [Anaerotruncus colihominis DSM
           17241]
          Length = 664

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           V+ L  +   H   YY LD P  +D  YDR+   L  L+E FPEL  +  P   VG
Sbjct: 14  VQELRTVIEKHNHSYYVLDRPTVSDYEYDRLLHELIDLEEAFPELASDHSPTRRVG 69


>gi|21673293|ref|NP_661358.1| DNA ligase, NAD-dependent [Chlorobium tepidum TLS]
 gi|81791793|sp|Q8KF74|DNLJ_CHLTE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|21646383|gb|AAM71700.1| DNA ligase, NAD-dependent [Chlorobium tepidum TLS]
          Length = 674

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +DKAK    + K  A IE          H + YY    P  +D  +D++ +RL  L+++F
Sbjct: 1   MDKAKAQQEIGKLRAEIE---------RHNRLYYLEAKPEISDFEFDKLLKRLIMLEKEF 51

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   VG
Sbjct: 52  PELVTPDSPSQRVG 65


>gi|169335238|ref|ZP_02862431.1| hypothetical protein ANASTE_01646 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257976|gb|EDS71942.1| hypothetical protein ANASTE_01646 [Anaerofustis stercorihominis DSM
           17244]
          Length = 659

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L +  L H + YY  DNP  +D  YD +  +L  L+E++P+   E  P + VG
Sbjct: 7   EIEKLTEELLEHNRKYYEEDNPSISDYDYDMLIRKLTKLEEEYPQYKKEYSPTDRVG 63


>gi|91788454|ref|YP_549406.1| DNA ligase [Polaromonas sp. JS666]
 gi|123164833|sp|Q12AD4|DNLJ_POLSJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91697679|gb|ABE44508.1| DNA ligase, NAD-dependent [Polaromonas sp. JS666]
          Length = 706

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  LH H   YY LD P   D  YDR+ + L  L+  +PEL   D P   VG
Sbjct: 26  LRAELHAHAHRYYVLDEPTIPDSEYDRLFKELQDLEAAYPELLTPDSPTQRVG 78


>gi|74316642|ref|YP_314382.1| NAD-dependent DNA ligase [Thiobacillus denitrificans ATCC 25259]
 gi|123745545|sp|Q3SL40|DNLJ_THIDA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|74056137|gb|AAZ96577.1| NAD-dependent DNA ligase [Thiobacillus denitrificans ATCC 25259]
          Length = 686

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 20  HNYAYYVLDAPTIPDAEYDRLYHELEALEAAHPELVAADSPTRRVG 65


>gi|134102614|ref|YP_001108275.1| NAD-dependent DNA ligase LigA [Saccharopolyspora erythraea NRRL
           2338]
 gi|291004701|ref|ZP_06562674.1| NAD-dependent DNA ligase LigA [Saccharopolyspora erythraea NRRL
           2338]
 gi|166216238|sp|A4FMS5|DNLJ_SACEN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|133915237|emb|CAM05350.1| DNA ligase, NAD-dependent [Saccharopolyspora erythraea NRRL 2338]
          Length = 727

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV+    HQ  YY LD+P  +DG +D +   L  L+   P L D D P   VG
Sbjct: 50  LVEQVRAHQFRYYVLDSPTISDGEFDELFTELQTLESDHPALRDPDSPTQVVG 102


>gi|300717845|ref|YP_003742648.1| DNA ligase [Erwinia billingiae Eb661]
 gi|299063681|emb|CAX60801.1| DNA ligase [Erwinia billingiae Eb661]
          Length = 672

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D+P   D  YDR+   L  L++  PEL   D P   VG
Sbjct: 17  HHEYQYHVMDDPEVPDAEYDRLMRELRELEQAHPELVTADSPTQRVG 63


>gi|120554094|ref|YP_958445.1| DNA ligase, NAD-dependent [Marinobacter aquaeolei VT8]
 gi|166215819|sp|A1TZT9|DNLJ_MARAV RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120323943|gb|ABM18258.1| DNA ligase, NAD-dependent [Marinobacter aquaeolei VT8]
          Length = 678

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H  +YY  D+P   D  YDR+   L  L+ + PEL  ED P   VG
Sbjct: 22  HNYYYYVQDDPRIPDAEYDRLFRELQKLEAEHPELATEDSPTRRVG 67


>gi|189499438|ref|YP_001958908.1| DNA ligase, NAD-dependent [Chlorobium phaeobacteroides BS1]
 gi|254781285|sp|B3EM49|DNLJ_CHLPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189494879|gb|ACE03427.1| DNA ligase, NAD-dependent [Chlorobium phaeobacteroides BS1]
          Length = 684

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +A+ E+  L +    H   YY L  P  +D  YD + E+L AL+ +FPEL   D P
Sbjct: 1   MDKKQAVAEIIRLREEIDRHNYRYYVLARPEISDFQYDAMLEKLVALEGEFPELKTSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|308187689|ref|YP_003931820.1| DNA ligase [Pantoea vagans C9-1]
 gi|308058199|gb|ADO10371.1| DNA ligase [Pantoea vagans C9-1]
          Length = 672

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+E+ P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRQLEEEHPDLITPDSPTQRVG 63


>gi|301633469|gb|ADK87023.1| DNA ligase (NAD(+)) [Mycoplasma pneumoniae FH]
          Length = 658

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+PL +D  YD++ ++L AL++  PEL   D P   VG
Sbjct: 21  YYVLDDPLVSDFEYDQLYKQLQALEQAHPELIQPDSPTQRVG 62


>gi|13508096|ref|NP_110045.1| DNA ligase [Mycoplasma pneumoniae M129]
 gi|2494169|sp|P78021|DNLJ_MYCPN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|1674170|gb|AAB96127.1| DNA ligase [Mycoplasma pneumoniae M129]
          Length = 658

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+PL +D  YD++ ++L AL++  PEL   D P   VG
Sbjct: 21  YYVLDDPLVSDFEYDQLYKQLQALEQAHPELIQPDSPTQRVG 62


>gi|304398312|ref|ZP_07380186.1| DNA ligase, NAD-dependent [Pantoea sp. aB]
 gi|304354178|gb|EFM18551.1| DNA ligase, NAD-dependent [Pantoea sp. aB]
          Length = 672

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+E+ P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEVPDAEYDRLMRELRQLEEEHPDLITPDSPTQRVG 63


>gi|253999028|ref|YP_003051091.1| DNA ligase, NAD-dependent [Methylovorus sp. SIP3-4]
 gi|253985707|gb|ACT50564.1| DNA ligase, NAD-dependent [Methylovorus sp. SIP3-4]
          Length = 699

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           P++ AL    D A    + +  E  I  +   +I L++ + YY LD+P   D  YDR+  
Sbjct: 6   PSQGAL---FDNAPATVTFATPEVQIR-QLREQINLYNYQ-YYVLDDPSVPDSEYDRLFR 60

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L AL+   PEL   D P   VG
Sbjct: 61  ELQALEHAHPELLTPDSPTQRVG 83


>gi|183599716|ref|ZP_02961209.1| hypothetical protein PROSTU_03219 [Providencia stuartii ATCC 25827]
 gi|188021975|gb|EDU60015.1| hypothetical protein PROSTU_03219 [Providencia stuartii ATCC 25827]
          Length = 671

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YD++ E L A++ + PE    D P   VG
Sbjct: 16  HHEYQYHVLDAPEIPDAEYDKLMEELKAIEAEHPEWITSDSPTQRVG 62


>gi|259907817|ref|YP_002648173.1| NAD-dependent DNA ligase LigA [Erwinia pyrifoliae Ep1/96]
 gi|224963439|emb|CAX54927.1| DNA ligase [Erwinia pyrifoliae Ep1/96]
 gi|283477688|emb|CAY73604.1| DNA ligase [Erwinia pyrifoliae DSM 12163]
          Length = 678

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +  H++  Y+ LD P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 7   KITHLRTLLRHYEYQYHVLDAPAVPDAEYDRLMGELRDLEAQHPELLTSDSPTQRVG 63


>gi|116669859|ref|YP_830792.1| DNA ligase, NAD-dependent [Arthrobacter sp. FB24]
 gi|166215392|sp|A0JUH2|DNLJ_ARTS2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116609968|gb|ABK02692.1| DNA ligase, NAD-dependent [Arthrobacter sp. FB24]
          Length = 790

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E LV+    H+  YY+ D P+ +D  +D +  RL+ ++   PEL   D P   VG
Sbjct: 54  EYENLVEEVRKHRFAYYQEDAPIISDAEFDELFRRLETIEAMHPELVANDSPTQEVG 110


>gi|326387612|ref|ZP_08209218.1| DNA ligase, NAD-dependent [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207658|gb|EGD58469.1| DNA ligase, NAD-dependent [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 687

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 34/69 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + ++++ +A  E+  L +   +H + Y+ LD P   D  YD +  R   ++  FP L   
Sbjct: 3   IDAMTEADAANELMRLARQIAYHDRLYHTLDTPEIADAEYDALVRRNAEIEAAFPHLIRA 62

Query: 111 DHPWNTVGY 119
           D P   VG+
Sbjct: 63  DSPSRKVGH 71


>gi|91793866|ref|YP_563517.1| DNA ligase, NAD-dependent [Shewanella denitrificans OS217]
 gi|123165936|sp|Q12L82|DNLJ_SHEDO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91715868|gb|ABE55794.1| DNA ligase, NAD-dependent [Shewanella denitrificans OS217]
          Length = 670

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++  LV     H   YY  D P  TD  YD++ ++L AL+ + PEL   D P   VG
Sbjct: 6   LQIANLVNELNQHNIKYYVDDAPSVTDAYYDKLMQQLLALEAEHPELIQSDSPSRRVG 63


>gi|196250518|ref|ZP_03149209.1| DNA ligase, NAD-dependent [Geobacillus sp. G11MC16]
 gi|196210008|gb|EDY04776.1| DNA ligase, NAD-dependent [Geobacillus sp. G11MC16]
          Length = 670

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A+++Q+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELIAIEKQYPELKTSDSPTQRIG 65


>gi|138893932|ref|YP_001124385.1| NAD-dependent DNA ligase LigA [Geobacillus thermodenitrificans
           NG80-2]
 gi|166215760|sp|A4IJY6|DNLJ_GEOTN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|134265445|gb|ABO65640.1| DNA ligase [Geobacillus thermodenitrificans NG80-2]
          Length = 670

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A+++Q+PEL   D P   +G
Sbjct: 24  YYVLDRPSVPDAEYDRLMQELIAIEKQYPELKTSDSPTQRIG 65


>gi|325982988|ref|YP_004295390.1| DNA ligase, NAD-dependent [Nitrosomonas sp. AL212]
 gi|325532507|gb|ADZ27228.1| DNA ligase, NAD-dependent [Nitrosomonas sp. AL212]
          Length = 677

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +I LH+ + YY LD P   D  YDR+   L  +++ +P+L   D P   VG
Sbjct: 18  EIELHNYR-YYVLDTPTIPDAEYDRLLRELQHIEQDYPQLITADSPTQRVG 67


>gi|114565926|ref|YP_753080.1| DNA ligase (NAD(+)) [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122318951|sp|Q0AZZ5|DNLJ_SYNWW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114336861|gb|ABI67709.1| DNA ligase (NAD(+)) [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 661

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD PL +D  YDR+ + L  L+E++P+    D P   V 
Sbjct: 17  HDYHYYILDAPLISDSGYDRLMQELKKLEEEYPQYITADSPTQRVA 62


>gi|317179023|dbj|BAJ56811.1| NAD-dependent DNA ligase LigA [Helicobacter pylori F30]
          Length = 657

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAIYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|212710592|ref|ZP_03318720.1| hypothetical protein PROVALCAL_01658 [Providencia alcalifaciens DSM
           30120]
 gi|212686673|gb|EEB46201.1| hypothetical protein PROVALCAL_01658 [Providencia alcalifaciens DSM
           30120]
          Length = 678

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YD++ + L AL+ + PEL   D P   VG
Sbjct: 23  HHEYLYHVMDAPEIPDVEYDKLMQELKALEAEHPELITTDSPTQRVG 69


>gi|319408814|emb|CBI82471.1| DNA ligase [Bartonella schoenbuchensis R1]
          Length = 718

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +DK   V +L+  EA  E+E+L K    H   Y   D P  +D  YD +  R   ++  F
Sbjct: 1   MDK-NAVKNLTALEAASELEWLAKEIARHDVLYNNNDQPEISDAQYDALRRRNTEIEALF 59

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   +G
Sbjct: 60  PELIRTDSPSYKIG 73


>gi|227530245|ref|ZP_03960294.1| DNA ligase (NAD(+)) [Lactobacillus vaginalis ATCC 49540]
 gi|227349834|gb|EEJ40125.1| DNA ligase (NAD(+)) [Lactobacillus vaginalis ATCC 49540]
          Length = 680

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L+  +A  E+  L K      K YY  D+P   D +YDR  +RL  ++++FPEL   
Sbjct: 8   VAQLTLDQAKEEIGPLRKQIAQWGKEYYEQDSPTVEDYVYDRQYQRLVQIEQRFPELQTP 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQQVG 75


>gi|315502322|ref|YP_004081209.1| DNA ligase, nad-dependent [Micromonospora sp. L5]
 gi|315408941|gb|ADU07058.1| DNA ligase, NAD-dependent [Micromonospora sp. L5]
          Length = 717

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  TD  +D+    L+AL+ ++P L   D P   VG
Sbjct: 46  HQYRYYVLDAPTVTDAEFDKQLRELEALEAEYPALRTPDSPTQRVG 91


>gi|241896133|ref|ZP_04783429.1| NAD-dependent DNA ligase [Weissella paramesenteroides ATCC 33313]
 gi|241870647|gb|EER74398.1| NAD-dependent DNA ligase [Weissella paramesenteroides ATCC 33313]
          Length = 675

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 68  KIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           K+ L  Q+W   YY  D+P   D  YD+V +RL  L+  FPEL + D     VG
Sbjct: 18  KLQLQLQQWAKEYYENDSPTVEDAEYDKVYKRLQELEAAFPELVNPDSITQQVG 71


>gi|262203140|ref|YP_003274348.1| DNA ligase, NAD-dependent [Gordonia bronchialis DSM 43247]
 gi|262086487|gb|ACY22455.1| DNA ligase, NAD-dependent [Gordonia bronchialis DSM 43247]
          Length = 691

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D+P+ TDG +D +  RL  L++  PEL   D P   VG
Sbjct: 28  HQFRYYVKDSPVITDGEFDALLRRLQDLEDAHPELAAPDSPTKLVG 73


>gi|223986795|ref|ZP_03636777.1| hypothetical protein HOLDEFILI_04100 [Holdemania filiformis DSM
           12042]
 gi|223961228|gb|EEF65758.1| hypothetical protein HOLDEFILI_04100 [Holdemania filiformis DSM
           12042]
          Length = 663

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD+P  +D  YD++   L  L++Q PELFD + P   VG
Sbjct: 20  YHVLDHPTVSDAEYDQLMRELITLEQQHPELFDPNSPTQRVG 61


>gi|154148661|ref|YP_001406577.1| NAD-dependent DNA ligase LigA [Campylobacter hominis ATCC BAA-381]
 gi|166215571|sp|A7I236|DNLJ_CAMHC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|153804670|gb|ABS51677.1| DNA ligase, NAD-dependent [Campylobacter hominis ATCC BAA-381]
          Length = 645

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 60  MIEVEYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           M E EYL  + + +   K YY  DNPL TD  YD + ++++  + +FP+L     P N V
Sbjct: 1   MSEAEYLKAVEMLNIWAKAYYTQDNPLATDIEYDVLYKKVETFENEFPDLKVSYSPTNRV 60

Query: 118 G 118
           G
Sbjct: 61  G 61


>gi|317181928|dbj|BAJ59712.1| NAD-dependent DNA ligase LigA [Helicobacter pylori F57]
          Length = 656

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQSNSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|302865766|ref|YP_003834403.1| DNA ligase, NAD-dependent [Micromonospora aurantiaca ATCC 27029]
 gi|302568625|gb|ADL44827.1| DNA ligase, NAD-dependent [Micromonospora aurantiaca ATCC 27029]
          Length = 717

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  TD  +D+    L+AL+ ++P L   D P   VG
Sbjct: 46  HQYRYYVLDAPTVTDAEFDKQLRELEALEAEYPALRTPDSPTQRVG 91


>gi|126661836|ref|ZP_01732835.1| DNA ligase [Flavobacteria bacterium BAL38]
 gi|126625215|gb|EAZ95904.1| DNA ligase [Flavobacteria bacterium BAL38]
          Length = 663

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LDNP+ +D  +D+  ++L  L+ Q P+ FDE+ P   VG
Sbjct: 16  QHNYNYYVLDNPIISDFEFDQKLKQLQDLEIQNPDFFDENSPTQRVG 62


>gi|254489942|ref|ZP_05103137.1| DNA ligase, NAD-dependent [Methylophaga thiooxidans DMS010]
 gi|224465027|gb|EEF81281.1| DNA ligase, NAD-dependent [Methylophaga thiooxydans DMS010]
          Length = 673

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+   YY  DNP   D  YDR+   L  L++  PEL   D P   VG
Sbjct: 20  HYNYLYYVTDNPEVPDAEYDRLFSELQQLEQTHPELLTADSPTQRVG 66


>gi|220915846|ref|YP_002491150.1| DNA ligase, NAD-dependent [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254781252|sp|B8JD56|DNLJ_ANAD2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219953700|gb|ACL64084.1| DNA ligase, NAD-dependent [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 687

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 22/41 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR+   L AL+ + PEL   D P   V
Sbjct: 24  YYVLDQPLLADAEYDRLMHELQALEAEHPELVTADSPTQRV 64


>gi|284006788|emb|CBA72055.1| DNA ligase [Arsenophonus nasoniae]
          Length = 670

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+ + L  L+ + PE    D P   VG
Sbjct: 17  HHEYLYHVLDTPEIPDAEYDRLMQELKKLEAEHPEWITADSPTQRVG 63


>gi|126659779|ref|ZP_01730906.1| NAD-dependent DNA ligase LigA [Cyanothece sp. CCY0110]
 gi|126618931|gb|EAZ89673.1| NAD-dependent DNA ligase LigA [Cyanothece sp. CCY0110]
          Length = 677

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P+  D +YD++   LD L+++ P+L   D P   VG
Sbjct: 26  YYVLDDPIMEDAVYDQLYRELDNLEKEHPQLITPDSPTQRVG 67


>gi|302542307|ref|ZP_07294649.1| DNA ligase, NAD-dependent [Streptomyces hygroscopicus ATCC 53653]
 gi|302459925|gb|EFL23018.1| DNA ligase, NAD-dependent [Streptomyces himastatinicus ATCC 53653]
          Length = 740

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA  E   L +    H+  YY  D P+ +D  +DR+  RL+AL+E  PEL   D P   V
Sbjct: 12  EARDEHAKLAEQVEEHRFRYYVKDAPIVSDAEFDRLLRRLEALEEDHPELRTPDSPTQKV 71

Query: 118 G 118
            
Sbjct: 72  A 72


>gi|332673586|gb|AEE70403.1| NAD-dependent DNA ligase LigA [Helicobacter pylori 83]
          Length = 656

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|261822799|ref|YP_003260905.1| NAD-dependent DNA ligase LigA [Pectobacterium wasabiae WPP163]
 gi|261606812|gb|ACX89298.1| DNA ligase, NAD-dependent [Pectobacterium wasabiae WPP163]
          Length = 681

 Score = 41.6 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + V  L ++  HH+  Y+  D P   D  YD++ + L AL+   PEL   D P   VG
Sbjct: 13  LRVAELRRVLRHHEYKYHVEDAPEIPDSEYDKLMQELKALEADHPELVTSDSPTQRVG 70


>gi|153872826|ref|ZP_02001606.1| NAD-dependent DNA ligase [Beggiatoa sp. PS]
 gi|152070708|gb|EDN68394.1| NAD-dependent DNA ligase [Beggiatoa sp. PS]
          Length = 670

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +YY LD P   D  YD++   L AL+E +P L   D P   VG
Sbjct: 24  YYYVLDEPRIPDSEYDKLMRELHALEENYPALITADSPTQRVG 66


>gi|320160951|ref|YP_004174175.1| DNA ligase [Anaerolinea thermophila UNI-1]
 gi|319994804|dbj|BAJ63575.1| DNA ligase [Anaerolinea thermophila UNI-1]
          Length = 674

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E L K   +H   YY LD+P+ +D  YDR+  RL  ++   PE    D P   VG
Sbjct: 9   EYENLKKQIHYHDYRYYVLDDPVISDAEYDRLILRLKQIEFAHPEWITPDSPSQRVG 65


>gi|315586702|gb|ADU41083.1| NAD-dependent DNA ligase LigA [Helicobacter pylori 35A]
          Length = 656

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|261839558|gb|ACX99323.1| NAD-dependent DNA ligase LigA [Helicobacter pylori 52]
          Length = 657

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|255281707|ref|ZP_05346262.1| DNA ligase, NAD-dependent [Bryantella formatexigens DSM 14469]
 gi|255267774|gb|EET60979.1| DNA ligase, NAD-dependent [Bryantella formatexigens DSM 14469]
          Length = 674

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L K   +H   YY  DNP  +D  YD++   L +L+++ PEL   + P   VG
Sbjct: 11  KIEELRKTLEYHSDRYYNQDNPEISDYEYDQMMLELKSLEKEHPELITPESPTQHVG 67


>gi|325576592|ref|ZP_08147310.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
 gi|325161155|gb|EGC73270.1| NAD-dependent DNA ligase LigA [Haemophilus parainfluenzae ATCC
           33392]
          Length = 675

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP   D  YDR+  +L AL+   PEL   D P   VG
Sbjct: 29  YHVLDNPTIPDAEYDRLFHQLKALEAAHPELITADSPTQRVG 70


>gi|301155433|emb|CBW14899.1| DNA ligase, NAD(+)-dependent [Haemophilus parainfluenzae T3T1]
          Length = 667

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP   D  YDR+  +L AL+   PEL   D P   VG
Sbjct: 21  YHVLDNPTIPDAEYDRLFHQLKALEAAHPELITADSPTQRVG 62


>gi|291557760|emb|CBL34877.1| DNA ligase, NAD-dependent [Eubacterium siraeum V10Sc8a]
          Length = 660

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +   E E L +    H   YY LD+P   D  YDR+  R+  ++ + PE+  E  P
Sbjct: 1   MDKEQIKSEYEQLCREVEQHNFNYYVLDDPTIEDDEYDRLMRRIKEIEAENPEIVSESSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQHVG 65


>gi|149374973|ref|ZP_01892746.1| DNA ligase, NAD-dependent [Marinobacter algicola DG893]
 gi|149360862|gb|EDM49313.1| DNA ligase, NAD-dependent [Marinobacter algicola DG893]
          Length = 676

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L  I   H   YY LD+P   D  YDR+   L  L+ Q+P++   D P   VG
Sbjct: 15  LRDIITEHNYQYYVLDDPRVPDAEYDRLFRELQDLETQYPDIVTPDTPTRRVG 67


>gi|317177554|dbj|BAJ55343.1| NAD-dependent DNA ligase LigA [Helicobacter pylori F16]
          Length = 656

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|257095174|ref|YP_003168815.1| NAD-dependent DNA ligase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047698|gb|ACV36886.1| DNA ligase, NAD-dependent [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 675

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L AL+ + PEL   D P   VG
Sbjct: 21  YYVLDAPSIADADYDRLFRELQALEAEHPELVSRDSPTQRVG 62


>gi|78223924|ref|YP_385671.1| NAD-dependent DNA ligase C4-type [Geobacter metallireducens GS-15]
 gi|123756373|sp|Q39S28|DNLJ_GEOMG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78195179|gb|ABB32946.1| NAD-dependent DNA ligase C4-type [Geobacter metallireducens GS-15]
          Length = 671

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  TD  YD +   L  L+E+ PEL   D P   VG
Sbjct: 20  HDHLYYVLDRPELTDAEYDALYRELLKLEEEHPELVTPDSPSRRVG 65


>gi|297379814|gb|ADI34701.1| DNA ligase, NAD-dependent [Helicobacter pylori v225d]
          Length = 656

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|145633173|ref|ZP_01788905.1| DNA ligase [Haemophilus influenzae 3655]
 gi|144986399|gb|EDJ92978.1| DNA ligase [Haemophilus influenzae 3655]
          Length = 670

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPTVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|295697355|ref|YP_003590593.1| DNA ligase, NAD-dependent [Bacillus tusciae DSM 2912]
 gi|295412957|gb|ADG07449.1| DNA ligase, NAD-dependent [Bacillus tusciae DSM 2912]
          Length = 677

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 30/62 (48%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           +G+A   +E L  +   +   YY LD+PL  D  YDR    L  L+ + PEL   D P  
Sbjct: 4   QGDAARRIEELRALIRRYDYHYYVLDDPLVDDAEYDRCMRELVELEARHPELVTPDSPTQ 63

Query: 116 TV 117
            V
Sbjct: 64  RV 65


>gi|293376177|ref|ZP_06622422.1| DNA ligase (NAD(+)) [Turicibacter sanguinis PC909]
 gi|292645164|gb|EFF63229.1| DNA ligase (NAD(+)) [Turicibacter sanguinis PC909]
          Length = 669

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + +E L K+   +   YY LD P  +D  YDR+ + L  L+E+ PEL     P   VG
Sbjct: 11  LRIEELTKLLTQYNHEYYVLDKPSVSDREYDRLMQELMELEEKHPELKSNTSPTVRVG 68


>gi|159028322|emb|CAO87220.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 669

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P  +D +YD++   L+ +++++P+L   D P   VG
Sbjct: 25  YYVLDDPFISDSVYDQLYRELEDIEKRYPQLITPDSPTQRVG 66


>gi|322418721|ref|YP_004197944.1| NAD-dependent DNA ligase [Geobacter sp. M18]
 gi|320125108|gb|ADW12668.1| DNA ligase, NAD-dependent [Geobacter sp. M18]
          Length = 668

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + +L K    H + YY  D P  TD  YD +   L  L+++FPEL   D P   VG
Sbjct: 10  IAWLSKEIERHNRLYYEQDMPEITDAEYDALFRELQELEKKFPELALPDSPTGRVG 65


>gi|73541575|ref|YP_296095.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
 gi|123732913|sp|Q470D2|DNLJ_RALEJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|72118988|gb|AAZ61251.1| NAD-dependent DNA ligase [Ralstonia eutropha JMP134]
          Length = 711

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 30/73 (41%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D +     L    A   V++L      H   YY LD P   D  YD +   L AL+ + P
Sbjct: 11  DASAPAGGLPPATAAERVQWLRDELDRHNYQYYVLDAPTIPDAEYDALFTELQALEAEHP 70

Query: 106 ELFDEDHPWNTVG 118
           EL   D P   VG
Sbjct: 71  ELLTPDSPTQRVG 83


>gi|325838923|ref|ZP_08166729.1| DNA ligase (NAD+) [Turicibacter sp. HGF1]
 gi|325490664|gb|EGC92975.1| DNA ligase (NAD+) [Turicibacter sp. HGF1]
          Length = 662

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + +E L K+   +   YY LD P  +D  YDR+ + L  L+E+ PEL     P   VG
Sbjct: 4   LRIEELTKLLTQYNHEYYVLDKPSVSDREYDRLMQELMELEEKHPELKSNTSPTVRVG 61


>gi|227114832|ref|ZP_03828488.1| NAD-dependent DNA ligase LigA [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 684

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A + V  L ++  HH+  Y+  D P   D  YD++ + L AL+   PEL   D P   VG
Sbjct: 14  AALRVAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEADHPELVTSDSPTQRVG 73


>gi|238855396|ref|ZP_04645707.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 269-3]
 gi|260665363|ref|ZP_05866211.1| DNA ligase, NAD-dependent [Lactobacillus jensenii SJ-7A-US]
 gi|282932093|ref|ZP_06337550.1| DNA ligase (NAD(+)) [Lactobacillus jensenii 208-1]
 gi|238831994|gb|EEQ24320.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 269-3]
 gi|260560867|gb|EEX26843.1| DNA ligase, NAD-dependent [Lactobacillus jensenii SJ-7A-US]
 gi|281303772|gb|EFA95917.1| DNA ligase (NAD(+)) [Lactobacillus jensenii 208-1]
          Length = 669

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  L+K  A  E+E L K      + YY  D P   D +YD+  +RL  L++QFPEL   
Sbjct: 1   MAKLNKKAAQEEIENLRKKLNTWAEQYYAQDAPSVEDAVYDQNYQRLVELEKQFPELVTS 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|87301433|ref|ZP_01084273.1| DNA ligase [Synechococcus sp. WH 5701]
 gi|87283650|gb|EAQ75604.1| DNA ligase [Synechococcus sp. WH 5701]
          Length = 698

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L+  A H    YY LD+P   D +YDR+   L+ L+   PEL   D P   VG
Sbjct: 7   ELRRLLNRAAHA---YYVLDSPEMEDAVYDRLYRELEQLERLHPELISPDSPTRRVG 60


>gi|319787332|ref|YP_004146807.1| DNA ligase, NAD-dependent [Pseudoxanthomonas suwonensis 11-1]
 gi|317465844|gb|ADV27576.1| DNA ligase, NAD-dependent [Pseudoxanthomonas suwonensis 11-1]
          Length = 788

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P  TD  YD +   L+AL+ + PEL  ED P   VG
Sbjct: 25  YHELDAPDITDAQYDALVRELEALEREHPELAAEDSPTRRVG 66


>gi|311278661|ref|YP_003940892.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
 gi|308747856|gb|ADO47608.1| DNA ligase, NAD-dependent [Enterobacter cloacae SCF1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPELPDAEYDRLMRELRELEAKHPELITPDSPTQRVG 63


>gi|15807063|ref|NP_295792.1| DNA ligase [Deinococcus radiodurans R1]
 gi|81550876|sp|Q9RSQ5|DNLJ_DEIRA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|6459863|gb|AAF11619.1|AE002043_4 DNA ligase [Deinococcus radiodurans R1]
          Length = 700

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ALH++  YY  D P   D  YDR++  L  L+   PE  D+  P  TVG
Sbjct: 24  EVALHNRA-YYEQDAPTIPDDEYDRLARELRELEAAHPEFADDHSPVQTVG 73


>gi|237732406|ref|ZP_04562887.1| NAD-dependent DNA ligase LigA [Citrobacter sp. 30_2]
 gi|226907945|gb|EEH93863.1| NAD-dependent DNA ligase LigA [Citrobacter sp. 30_2]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMCELRELEAQHPELITPDSPTQRVG 63


>gi|217033559|ref|ZP_03438988.1| hypothetical protein HP9810_905g78 [Helicobacter pylori 98-10]
 gi|216944084|gb|EEC23515.1| hypothetical protein HP9810_905g78 [Helicobacter pylori 98-10]
          Length = 656

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNGIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|164686703|ref|ZP_02210731.1| hypothetical protein CLOBAR_00298 [Clostridium bartlettii DSM
           16795]
 gi|164604093|gb|EDQ97558.1| hypothetical protein CLOBAR_00298 [Clostridium bartlettii DSM
           16795]
          Length = 674

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L+ +  +H + YY  D+P   D  YD + + L  L+E+ PEL   D P N VG
Sbjct: 7   IEELINLINYHNEKYYNQDSPEIEDFEYDNLMKELIKLEEENPELKRNDSPSNRVG 62


>gi|114776845|ref|ZP_01451888.1| DNA ligase, NAD-dependent [Mariprofundus ferrooxydans PV-1]
 gi|114552931|gb|EAU55362.1| DNA ligase, NAD-dependent [Mariprofundus ferrooxydans PV-1]
          Length = 670

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 30/63 (47%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K      +E+L      H   YY LD P+ +D  YDR+   L++L+ +  E    D P  
Sbjct: 4   KATLTARIEHLRSQLREHNYRYYILDAPVISDAEYDRLLRELESLEAELGEPVPADSPTR 63

Query: 116 TVG 118
           TVG
Sbjct: 64  TVG 66


>gi|113475951|ref|YP_722012.1| NAD-dependent DNA ligase LigA [Trichodesmium erythraeum IMS101]
 gi|123160812|sp|Q112N5|DNLJ_TRIEI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110166999|gb|ABG51539.1| DNA ligase, NAD-dependent [Trichodesmium erythraeum IMS101]
          Length = 774

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD +   L  L+ Q+P+L   D P   VG
Sbjct: 26  YYVLDQPIMEDAVYDHLLRELQELESQYPQLIVSDSPTQRVG 67


>gi|239906999|ref|YP_002953740.1| NAD-dependent DNA ligase [Desulfovibrio magneticus RS-1]
 gi|239796865|dbj|BAH75854.1| NAD-dependent DNA ligase [Desulfovibrio magneticus RS-1]
          Length = 704

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D  YD +   L AL+E  PEL D + P   VG
Sbjct: 27  YYVLDDPTVEDAAYDALYRELKALEEAHPELADPNSPTRRVG 68


>gi|23098215|ref|NP_691681.1| NAD-dependent DNA ligase LigA [Oceanobacillus iheyensis HTE831]
 gi|81741485|sp|Q8CXK6|DNLJ_OCEIH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|22776440|dbj|BAC12716.1| DNA ligase (polydeoxyribonucleotide synthase[NAD+]) [Oceanobacillus
           iheyensis HTE831]
          Length = 667

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++K +   ++E L+++   +   YY LDNP   D  YD+    L  L++ FP+L  E+ P
Sbjct: 1   MNKEQVSKKIESLIELLNQYGYEYYVLDNPTVPDAEYDQKLRELQQLEQDFPDLVMENSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|315127017|ref|YP_004069020.1| NAD-dependent DNA ligase [Pseudoalteromonas sp. SM9913]
 gi|315015531|gb|ADT68869.1| NAD-dependent DNA ligase [Pseudoalteromonas sp. SM9913]
          Length = 673

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 25/57 (43%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L      H   YY LD P   D  YDR+   L  L+ Q PE    D P   VG
Sbjct: 8   QINHLRTTLEQHNYSYYVLDTPSIPDAEYDRLLRTLSELETQHPEFLTADSPTQKVG 64


>gi|226226196|ref|YP_002760302.1| NAD(+)-dependent DNA ligase [Gemmatimonas aurantiaca T-27]
 gi|254781336|sp|C1A6H2|DNLJ_GEMAT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226089387|dbj|BAH37832.1| NAD(+)-dependent DNA ligase [Gemmatimonas aurantiaca T-27]
          Length = 689

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 74  QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Q  YY LD P  +D  YDR+   L  ++ ++P L  ED P   VG
Sbjct: 27  QHEYYVLDRPTLSDQEYDRLFRELQGIEAEYPTLCTEDSPTRRVG 71


>gi|158334366|ref|YP_001515538.1| NAD-dependent DNA ligase LigA [Acaryochloris marina MBIC11017]
 gi|190359221|sp|B0C308|DNLJ_ACAM1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158304607|gb|ABW26224.1| DNA ligase, NAD-dependent [Acaryochloris marina MBIC11017]
          Length = 675

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL  D +YD++   L  L+ Q+P+L   D P   VG
Sbjct: 26  YYGLDAPLMEDAVYDQLYHELVDLEAQYPQLITPDSPTQRVG 67


>gi|319951546|ref|ZP_08025350.1| NAD-dependent DNA ligase LigA [Dietzia cinnamea P4]
 gi|319434794|gb|EFV90110.1| NAD-dependent DNA ligase LigA [Dietzia cinnamea P4]
          Length = 726

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +    HQ  YY  D P+ +D  +DR+   L AL+E++P L   D P   VG
Sbjct: 27  LAETVRDHQFRYYVKDAPIVSDAEFDRLFGELQALEEKYPALRTADSPTQLVG 79


>gi|194307280|gb|ACF42137.1| DNA ligase [Mycobacterium lepromatosis]
          Length = 686

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D +  RL  L+EQ PEL   D P   +G
Sbjct: 19  HQFRYYVRDAPIISDAEFDALLGRLTVLEEQHPELRTPDSPTQLIG 64


>gi|157144662|ref|YP_001451981.1| NAD-dependent DNA ligase LigA [Citrobacter koseri ATCC BAA-895]
 gi|166215574|sp|A8ADI2|DNLJ_CITK8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157081867|gb|ABV11545.1| hypothetical protein CKO_00382 [Citrobacter koseri ATCC BAA-895]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQHPDLITPDSPSQRVG 63


>gi|313890529|ref|ZP_07824157.1| DNA ligase (NAD+) [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121046|gb|EFR44157.1| DNA ligase (NAD+) [Streptococcus pseudoporcinus SPIN 20026]
          Length = 652

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            +++ YY  DNP  +D  YD++   L AL+ ++PEL  +D P   VG
Sbjct: 14  QYRQEYYTNDNPTVSDQEYDKLYHELLALETEYPELIQKDSPTQGVG 60


>gi|121602535|ref|YP_989218.1| NAD-dependent DNA ligase LigA [Bartonella bacilliformis KC583]
 gi|166215397|sp|A1UTB5|DNLJ_BARBK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120614712|gb|ABM45313.1| DNA ligase, NAD-dependent [Bartonella bacilliformis KC583]
          Length = 717

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 45  LDK-AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQ 103
           +DK AK +T+L   EA  E+E+L K    H   Y   D P  +D  YD +  R   ++  
Sbjct: 1   MDKDAKNLTAL---EAERELEWLAKEIARHDVLYNNHDQPEISDARYDALRRRNIEIETL 57

Query: 104 FPELFDEDHPWNTVG 118
           FPEL   D P   VG
Sbjct: 58  FPELVRADSPSYKVG 72


>gi|288919113|ref|ZP_06413452.1| DNA ligase, NAD-dependent [Frankia sp. EUN1f]
 gi|288349457|gb|EFC83695.1| DNA ligase, NAD-dependent [Frankia sp. EUN1f]
          Length = 715

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD +   LD +++Q+PEL   D P   V 
Sbjct: 52  HAHRYYVLDAPTIADAEYDALLRELDQIEQQYPELRTADSPTQKVA 97


>gi|94971682|ref|YP_593730.1| DNA ligase, NAD-dependent [Candidatus Koribacter versatilis
           Ellin345]
 gi|122986011|sp|Q1IHJ4|DNLJ_ACIBL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|94553732|gb|ABF43656.1| DNA ligase, NAD-dependent [Candidatus Koribacter versatilis
           Ellin345]
          Length = 673

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H+  YY LD+P  +D  YD +   L AL+ + PEL   D P   VG
Sbjct: 20  YHEHRYYVLDDPEISDADYDVMMNELKALEAKHPELLTPDSPTQRVG 66


>gi|170016835|ref|YP_001727754.1| DNA ligase, NAD-dependent [Leuconostoc citreum KM20]
 gi|254781358|sp|B1MXQ8|DNLJ_LEUCK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169803692|gb|ACA82310.1| DNA ligase, NAD-dependent [Leuconostoc citreum KM20]
          Length = 681

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +L+   A  E+  L K    +   YY  D PL  D +YD    RL  L+ QFP+    
Sbjct: 8   VNNLTTQMAQQEIATLQKRLTDYGVAYYEEDAPLVEDYIYDAFYARLVLLEAQFPQFVTP 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQNVG 75


>gi|317010835|gb|ADU84582.1| NAD-dependent DNA ligase LigA [Helicobacter pylori SouthAfrica7]
          Length = 657

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDEPIVSDAVYDELYQELKAYEEENPSYIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|288572809|ref|ZP_06391166.1| DNA ligase, NAD-dependent [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568550|gb|EFC90107.1| DNA ligase, NAD-dependent [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 674

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E L K    H + YY LD+P   D  YDR+   L  L+ + P L  +D P   VG
Sbjct: 11  ESLKKEIARHDRLYYVLDSPEIDDSSYDRMMRELLELEREHPTLVSDDSPSRRVG 65


>gi|86742328|ref|YP_482728.1| DNA ligase, NAD-dependent [Frankia sp. CcI3]
 gi|123750794|sp|Q2J6U3|DNLJ_FRASC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86569190|gb|ABD12999.1| DNA ligase, NAD-dependent [Frankia sp. CcI3]
          Length = 706

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P  +D  YDR+   L AL+E+ P+L   D P   V 
Sbjct: 36  HAYRYYVLDSPTISDAEYDRLMAELAALEERHPDLRTPDSPTQKVA 81


>gi|238897965|ref|YP_002923645.1| DNA ligase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|257096312|sp|C4K4K4|DNLJ_HAMD5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|229465723|gb|ACQ67497.1| DNA ligase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 702

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 58  EAMIE-VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           ++M+E +  L  +  HH+  Y+  D P  TD  YD + E+L   + Q+PEL + D P   
Sbjct: 2   KSMLEKINQLRDVLKHHEYLYHVNDAPEITDAEYDALLEKLREWESQYPELMNPDSPTQK 61

Query: 117 VG 118
           VG
Sbjct: 62  VG 63


>gi|169350953|ref|ZP_02867891.1| hypothetical protein CLOSPI_01730 [Clostridium spiroforme DSM 1552]
 gi|169292015|gb|EDS74148.1| hypothetical protein CLOSPI_01730 [Clostridium spiroforme DSM 1552]
          Length = 682

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 71  LHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++H   YY  D+P  +D  YD + + L AL+++ PE   ED P   VG
Sbjct: 33  MYHNDRYYNQDDPEISDYEYDMMMQELKALEKKHPEYITEDSPTQKVG 80


>gi|150397271|ref|YP_001327738.1| NAD-dependent DNA ligase LigA [Sinorhizobium medicae WSM419]
 gi|166216245|sp|A6UB73|DNLJ_SINMW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150028786|gb|ABR60903.1| DNA ligase, NAD-dependent [Sinorhizobium medicae WSM419]
          Length = 717

 Score = 41.2 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+  D+P  +D  YD +  R D ++E+FP L  ED P   VG
Sbjct: 30  HDMLYHGKDDPEISDADYDALKRRNDLIEERFPALIREDSPSQKVG 75


>gi|313679715|ref|YP_004057454.1| DNA ligase, nad-dependent [Oceanithermus profundus DSM 14977]
 gi|313152430|gb|ADR36281.1| DNA ligase, NAD-dependent [Oceanithermus profundus DSM 14977]
          Length = 670

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 29/65 (44%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA   V  L      H   YY LD P  +D  YD +   L  L+  FPEL     P
Sbjct: 1   MTREEAARRVAELTWAIRRHNHLYYVLDRPEISDAEYDALVRELAELEAAFPELRSPASP 60

Query: 114 WNTVG 118
            N VG
Sbjct: 61  TNQVG 65


>gi|333016518|gb|EGK35849.1| DNA ligase, NAD-dependent [Shigella flexneri K-304]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|333001543|gb|EGK21111.1| DNA ligase, NAD-dependent [Shigella flexneri VA-6]
 gi|333002206|gb|EGK21770.1| DNA ligase, NAD-dependent [Shigella flexneri K-272]
 gi|333016032|gb|EGK35364.1| DNA ligase, NAD-dependent [Shigella flexneri K-227]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|332089820|gb|EGI94921.1| DNA ligase, NAD-dependent [Shigella dysenteriae 155-74]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|332088205|gb|EGI93327.1| DNA ligase, NAD-dependent [Shigella boydii 5216-82]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|325496534|gb|EGC94393.1| NAD-dependent DNA ligase LigA [Escherichia fergusonii ECD227]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|324112923|gb|EGC06899.1| DNA ligase [Escherichia fergusonii B253]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|324009590|gb|EGB78809.1| DNA ligase, NAD-dependent [Escherichia coli MS 57-2]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|323967844|gb|EGB63256.1| DNA ligase [Escherichia coli M863]
 gi|327252066|gb|EGE63738.1| DNA ligase, NAD-dependent [Escherichia coli STEC_7v]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAKHPELITPDSPTQRVG 63


>gi|323188282|gb|EFZ73575.1| DNA ligase, NAD-dependent [Escherichia coli RN587/1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|331673883|ref|ZP_08374646.1| DNA ligase, NAD-dependent [Escherichia coli TA280]
 gi|331069156|gb|EGI40548.1| DNA ligase, NAD-dependent [Escherichia coli TA280]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|331653837|ref|ZP_08354838.1| DNA ligase, NAD-dependent [Escherichia coli M718]
 gi|331048686|gb|EGI20762.1| DNA ligase, NAD-dependent [Escherichia coli M718]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|300940348|ref|ZP_07154941.1| DNA ligase, NAD-dependent [Escherichia coli MS 21-1]
 gi|300454839|gb|EFK18332.1| DNA ligase, NAD-dependent [Escherichia coli MS 21-1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|301022290|ref|ZP_07186186.1| DNA ligase, NAD-dependent [Escherichia coli MS 69-1]
 gi|300397609|gb|EFJ81147.1| DNA ligase, NAD-dependent [Escherichia coli MS 69-1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|293410811|ref|ZP_06654387.1| DNA ligase [Escherichia coli B354]
 gi|291471279|gb|EFF13763.1| DNA ligase [Escherichia coli B354]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|293415682|ref|ZP_06658325.1| DNA ligase [Escherichia coli B185]
 gi|291433330|gb|EFF06309.1| DNA ligase [Escherichia coli B185]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|281179485|dbj|BAI55815.1| DNA ligase [Escherichia coli SE15]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|218690549|ref|YP_002398761.1| NAD-dependent DNA ligase LigA [Escherichia coli ED1a]
 gi|254781322|sp|B7MY64|DNLJ_ECO81 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218428113|emb|CAR09030.2| DNA ligase, NAD(+)-dependent [Escherichia coli ED1a]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|218700877|ref|YP_002408506.1| NAD-dependent DNA ligase LigA [Escherichia coli IAI39]
 gi|254781321|sp|B7NPU7|DNLJ_ECO7I RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218370863|emb|CAR18680.1| DNA ligase, NAD(+)-dependent [Escherichia coli IAI39]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|218548148|ref|YP_002381939.1| NAD-dependent DNA ligase LigA [Escherichia fergusonii ATCC 35469]
 gi|331684067|ref|ZP_08384663.1| DNA ligase, NAD-dependent [Escherichia coli H299]
 gi|254781331|sp|B7LL73|DNLJ_ESCF3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218355689|emb|CAQ88301.1| DNA ligase, NAD(+)-dependent [Escherichia fergusonii ATCC 35469]
 gi|315298233|gb|EFU57493.1| DNA ligase, NAD-dependent [Escherichia coli MS 16-3]
 gi|331079019|gb|EGI50221.1| DNA ligase, NAD-dependent [Escherichia coli H299]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|215487666|ref|YP_002330097.1| NAD-dependent DNA ligase LigA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312967700|ref|ZP_07781915.1| DNA ligase, NAD-dependent [Escherichia coli 2362-75]
 gi|254781317|sp|B7UGB2|DNLJ_ECO27 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|215265738|emb|CAS10145.1| DNA ligase, NAD(+)-dependent [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312287897|gb|EFR15802.1| DNA ligase, NAD-dependent [Escherichia coli 2362-75]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|159044058|ref|YP_001532852.1| DNA ligase [Dinoroseobacter shibae DFL 12]
 gi|190359252|sp|A8LK52|DNLJ_DINSH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157911818|gb|ABV93251.1| DNA ligase [Dinoroseobacter shibae DFL 12]
          Length = 741

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 37/73 (50%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           D    V +LS+  A  E+  L ++       Y+R D P  +D  YD + +R  A++ +FP
Sbjct: 37  DTYVAVEALSEAAARKELARLSELLARANAEYHRDDAPSLSDADYDALKQRNAAIEARFP 96

Query: 106 ELFDEDHPWNTVG 118
           +L   D P + VG
Sbjct: 97  DLKRGDSPSDQVG 109


>gi|91211748|ref|YP_541734.1| NAD-dependent DNA ligase LigA [Escherichia coli UTI89]
 gi|117624619|ref|YP_853532.1| NAD-dependent DNA ligase LigA [Escherichia coli APEC O1]
 gi|218559359|ref|YP_002392272.1| NAD-dependent DNA ligase LigA [Escherichia coli S88]
 gi|237704934|ref|ZP_04535415.1| NAD-dependent DNA ligase LigA [Escherichia sp. 3_2_53FAA]
 gi|331658566|ref|ZP_08359510.1| DNA ligase, NAD-dependent [Escherichia coli TA206]
 gi|123084405|sp|Q1R8W1|DNLJ_ECOUT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215402|sp|A1ADS8|DNLJ_ECOK1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781318|sp|B7MHR5|DNLJ_ECO45 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91073322|gb|ABE08203.1| DNA ligase [Escherichia coli UTI89]
 gi|115513743|gb|ABJ01818.1| NAD-dependent DNA ligase LigA [Escherichia coli APEC O1]
 gi|218366128|emb|CAR03873.1| DNA ligase, NAD(+)-dependent [Escherichia coli S88]
 gi|226901300|gb|EEH87559.1| NAD-dependent DNA ligase LigA [Escherichia sp. 3_2_53FAA]
 gi|294491726|gb|ADE90482.1| DNA ligase, NAD-dependent [Escherichia coli IHE3034]
 gi|307626016|gb|ADN70320.1| NAD-dependent DNA ligase LigA [Escherichia coli UM146]
 gi|315288164|gb|EFU47564.1| DNA ligase, NAD-dependent [Escherichia coli MS 110-3]
 gi|323949546|gb|EGB45434.1| DNA ligase [Escherichia coli H252]
 gi|323955668|gb|EGB51426.1| DNA ligase [Escherichia coli H263]
 gi|331054231|gb|EGI26258.1| DNA ligase, NAD-dependent [Escherichia coli TA206]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|24113756|ref|NP_708266.1| NAD-dependent DNA ligase LigA [Shigella flexneri 2a str. 301]
 gi|30063805|ref|NP_837976.1| NAD-dependent DNA ligase LigA [Shigella flexneri 2a str. 2457T]
 gi|110806352|ref|YP_689872.1| NAD-dependent DNA ligase LigA [Shigella flexneri 5 str. 8401]
 gi|81723177|sp|Q83K81|DNLJ_SHIFL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|122366427|sp|Q0T298|DNLJ_SHIF8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24052834|gb|AAN43973.1| DNA ligase [Shigella flexneri 2a str. 301]
 gi|30042060|gb|AAP17786.1| DNA ligase [Shigella flexneri 2a str. 2457T]
 gi|110615900|gb|ABF04567.1| DNA ligase [Shigella flexneri 5 str. 8401]
 gi|281601828|gb|ADA74812.1| DNA ligase, NAD-dependent [Shigella flexneri 2002017]
 gi|313650866|gb|EFS15266.1| DNA ligase, NAD-dependent [Shigella flexneri 2a str. 2457T]
 gi|332755453|gb|EGJ85817.1| DNA ligase, NAD-dependent [Shigella flexneri K-671]
 gi|332756263|gb|EGJ86614.1| DNA ligase, NAD-dependent [Shigella flexneri 2747-71]
 gi|333002064|gb|EGK21630.1| DNA ligase, NAD-dependent [Shigella flexneri K-218]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|51893963|ref|YP_076654.1| NAD-dependent DNA ligase [Symbiobacterium thermophilum IAM 14863]
 gi|81388077|sp|Q67KI8|DNLJ_SYMTH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|51857652|dbj|BAD41810.1| NAD-dependent DNA ligase [Symbiobacterium thermophilum IAM 14863]
          Length = 673

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L++   HH+  YY  + P  +D  +D + + L  L+E FP+L   D P   VG
Sbjct: 13  LIETIRHHEYLYYVKNEPEISDAAFDELMQELKQLEEAFPDLRRPDSPTQRVG 65


>gi|157161876|ref|YP_001459194.1| NAD-dependent DNA ligase LigA [Escherichia coli HS]
 gi|253772690|ref|YP_003035521.1| NAD-dependent DNA ligase LigA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162394|ref|YP_003045502.1| NAD-dependent DNA ligase LigA [Escherichia coli B str. REL606]
 gi|297517308|ref|ZP_06935694.1| NAD-dependent DNA ligase LigA [Escherichia coli OP50]
 gi|300928569|ref|ZP_07144093.1| DNA ligase, NAD-dependent [Escherichia coli MS 187-1]
 gi|190359254|sp|A8A2Q7|DNLJ_ECOHS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157067556|gb|ABV06811.1| DNA ligase, NAD-dependent [Escherichia coli HS]
 gi|242378018|emb|CAQ32789.1| DNA ligase [Escherichia coli BL21(DE3)]
 gi|253323734|gb|ACT28336.1| DNA ligase, NAD-dependent [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974295|gb|ACT39966.1| NAD-dependent DNA ligase LigA [Escherichia coli B str. REL606]
 gi|253978462|gb|ACT44132.1| NAD-dependent DNA ligase LigA [Escherichia coli BL21(DE3)]
 gi|300463441|gb|EFK26934.1| DNA ligase, NAD-dependent [Escherichia coli MS 187-1]
 gi|323961212|gb|EGB56824.1| DNA ligase [Escherichia coli H489]
 gi|323970900|gb|EGB66151.1| DNA ligase [Escherichia coli TA007]
 gi|332344237|gb|AEE57571.1| DNA ligase, NAD-dependent LigA [Escherichia coli UMNK88]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|16130337|ref|NP_416906.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109225|ref|AP_003005.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           W3110]
 gi|170019306|ref|YP_001724260.1| NAD-dependent DNA ligase LigA [Escherichia coli ATCC 8739]
 gi|170082020|ref|YP_001731340.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188495579|ref|ZP_03002849.1| DNA ligase, NAD-dependent [Escherichia coli 53638]
 gi|238901574|ref|YP_002927370.1| DNA ligase, NAD(+)-dependent [Escherichia coli BW2952]
 gi|256021895|ref|ZP_05435760.1| NAD-dependent DNA ligase LigA [Escherichia sp. 4_1_40B]
 gi|300951893|ref|ZP_07165701.1| DNA ligase, NAD-dependent [Escherichia coli MS 116-1]
 gi|300957240|ref|ZP_07169472.1| DNA ligase, NAD-dependent [Escherichia coli MS 175-1]
 gi|301023745|ref|ZP_07187485.1| DNA ligase, NAD-dependent [Escherichia coli MS 196-1]
 gi|312973347|ref|ZP_07787519.1| DNA ligase, NAD-dependent [Escherichia coli 1827-70]
 gi|2506362|sp|P15042|DNLJ_ECOLI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781324|sp|B1XA82|DNLJ_ECODH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781325|sp|B1IX60|DNLJ_ECOLC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|149242732|pdb|2OWO|A Chain A, Last Stop On The Road To Repair: Structure Of E.Coli Dna
           Ligase Bound To Nicked Dna-Adenylate
 gi|146613|gb|AAA24070.1| DNA ligase (EC 6.5.1.2) [Escherichia coli]
 gi|1788750|gb|AAC75464.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85675396|dbj|BAA16282.2| DNA ligase, NAD(+)-dependent [Escherichia coli str. K12 substr.
           W3110]
 gi|169754234|gb|ACA76933.1| DNA ligase, NAD-dependent [Escherichia coli ATCC 8739]
 gi|169889855|gb|ACB03562.1| DNA ligase, NAD(+)-dependent [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188490778|gb|EDU65881.1| DNA ligase, NAD-dependent [Escherichia coli 53638]
 gi|238860822|gb|ACR62820.1| DNA ligase, NAD(+)-dependent [Escherichia coli BW2952]
 gi|260448502|gb|ACX38924.1| DNA ligase, NAD-dependent [Escherichia coli DH1]
 gi|299880716|gb|EFI88927.1| DNA ligase, NAD-dependent [Escherichia coli MS 196-1]
 gi|300315993|gb|EFJ65777.1| DNA ligase, NAD-dependent [Escherichia coli MS 175-1]
 gi|300448878|gb|EFK12498.1| DNA ligase, NAD-dependent [Escherichia coli MS 116-1]
 gi|309702699|emb|CBJ02028.1| DNA ligase [Escherichia coli ETEC H10407]
 gi|310331942|gb|EFP99177.1| DNA ligase, NAD-dependent [Escherichia coli 1827-70]
 gi|315137042|dbj|BAJ44201.1| NAD-dependent DNA ligase LigA [Escherichia coli DH1]
 gi|315615662|gb|EFU96294.1| DNA ligase, NAD-dependent [Escherichia coli 3431]
 gi|323936436|gb|EGB32725.1| DNA ligase [Escherichia coli E1520]
 gi|323941344|gb|EGB37529.1| DNA ligase [Escherichia coli E482]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|325962711|ref|YP_004240617.1| DNA ligase, NAD-dependent [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468798|gb|ADX72483.1| DNA ligase, NAD-dependent [Arthrobacter phenanthrenivorans Sphe3]
          Length = 767

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E LV +   ++  YY+ D PL +D  +D +  RL+ ++   PEL   D P   VG
Sbjct: 32  EYENLVDLVRKYRFAYYQEDAPLVSDAEFDELFRRLEEIEALHPELVSNDSPTQEVG 88


>gi|157363572|ref|YP_001470339.1| DNA ligase, NAD-dependent [Thermotoga lettingae TMO]
 gi|190359296|sp|A8F541|DNLJ_THELT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157314176|gb|ABV33275.1| DNA ligase, NAD-dependent [Thermotoga lettingae TMO]
          Length = 678

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY L +P+ +D  YDR+ + L  L++++PEL   D P   VG
Sbjct: 20  YHNYRYYVLADPIISDEEYDRLMQELIELEKKYPELVTPDSPSQRVG 66


>gi|90408119|ref|ZP_01216289.1| DNA ligase [Psychromonas sp. CNPT3]
 gi|90310805|gb|EAS38920.1| DNA ligase [Psychromonas sp. CNPT3]
          Length = 667

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++V+ L +    +   YY LD P  +D  YD V ++L A++ + P L  E+ P   VG
Sbjct: 5   LQVKKLTEQLEEYNYQYYVLDEPSISDAQYDAVFQQLKAIESEHPHLLHENSPTQKVG 62


>gi|186680717|ref|YP_001863913.1| NAD-dependent DNA ligase LigA [Nostoc punctiforme PCC 73102]
 gi|254781381|sp|B2J3P0|DNLJ_NOSP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|186463169|gb|ACC78970.1| DNA ligase, NAD-dependent [Nostoc punctiforme PCC 73102]
          Length = 678

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L  L+ Q+PEL   D P   VG
Sbjct: 25  YYVLDTPIMEDSVYDQLYRELQQLEIQYPELTAPDSPTQRVG 66


>gi|332977611|gb|EGK14379.1| NAD-dependent DNA ligase LigA [Psychrobacter sp. 1501(2011)]
          Length = 695

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 42  ESWLDKAKKVTSLSKGEAMI--EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDA 99
           +S   K   + SL++ +  I  ++  L+     H   YY +D P  +D  YD++   L  
Sbjct: 8   QSQTTKMNAIKSLNQEQQDIVAKMRTLITEVRKHNNAYYVMDEPTISDNEYDQLRLSLIE 67

Query: 100 LQEQFPELFDEDHPWNTVG 118
           L+E++P+L   D P  +VG
Sbjct: 68  LEERYPDLTQSDSPTASVG 86


>gi|323341293|ref|ZP_08081538.1| NAD-dependent DNA ligase LigA [Lactobacillus ruminis ATCC 25644]
 gi|323091287|gb|EFZ33914.1| NAD-dependent DNA ligase LigA [Lactobacillus ruminis ATCC 25644]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K EA  E+E L +      + YY LD P   D +YD   +RL  L+ +FPEL  +D P
Sbjct: 1   MDKEEAKKELESLREKLTKWSREYYVLDAPTVEDHVYDENYKRLLELEAKFPELVTKDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|323170330|gb|EFZ55983.1| DNA ligase, NAD-dependent [Escherichia coli LT-68]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|320196260|gb|EFW70884.1| DNA ligase [Escherichia coli WV_060327]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|320185101|gb|EFW59881.1| DNA ligase [Shigella flexneri CDC 796-83]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|331648073|ref|ZP_08349163.1| DNA ligase, NAD-dependent [Escherichia coli M605]
 gi|331042933|gb|EGI15073.1| DNA ligase, NAD-dependent [Escherichia coli M605]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|301648064|ref|ZP_07247828.1| DNA ligase, NAD-dependent [Escherichia coli MS 146-1]
 gi|307139053|ref|ZP_07498409.1| NAD-dependent DNA ligase LigA [Escherichia coli H736]
 gi|331643032|ref|ZP_08344167.1| DNA ligase, NAD-dependent [Escherichia coli H736]
 gi|301073835|gb|EFK88641.1| DNA ligase, NAD-dependent [Escherichia coli MS 146-1]
 gi|331039830|gb|EGI12050.1| DNA ligase, NAD-dependent [Escherichia coli H736]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|300923365|ref|ZP_07139409.1| DNA ligase, NAD-dependent [Escherichia coli MS 182-1]
 gi|300420362|gb|EFK03673.1| DNA ligase, NAD-dependent [Escherichia coli MS 182-1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|209764254|gb|ACI80439.1| DNA ligase [Escherichia coli]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|220935192|ref|YP_002514091.1| DNA ligase (NAD(+)) [Thioalkalivibrio sp. HL-EbGR7]
 gi|254781444|sp|B8GTL0|DNLJ_THISH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219996502|gb|ACL73104.1| DNA ligase (NAD(+)) [Thioalkalivibrio sp. HL-EbGR7]
          Length = 675

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD+P   D  YD +   L  L+ ++PEL   D P   VG
Sbjct: 21  YHNHRYYVLDDPEIPDAAYDALMRELQDLEAKYPELVTPDSPTQRVG 67


>gi|170767420|ref|ZP_02901873.1| DNA ligase, NAD-dependent [Escherichia albertii TW07627]
 gi|170123754|gb|EDS92685.1| DNA ligase, NAD-dependent [Escherichia albertii TW07627]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAKHPELITPDSPTQRVG 63


>gi|109947386|ref|YP_664614.1| NAD-dependent DNA ligase LigA [Helicobacter acinonychis str.
           Sheeba]
 gi|123362647|sp|Q17XL1|DNLJ_HELAH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|109714607|emb|CAJ99615.1| DNA ligase [Helicobacter acinonychis str. Sheeba]
          Length = 654

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDEPIVSDAVYDELYQELKAYEEKNPSQIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|146615|gb|AAA24071.1| lig peptide [Escherichia coli]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|82777805|ref|YP_404154.1| NAD-dependent DNA ligase LigA [Shigella dysenteriae Sd197]
 gi|309784866|ref|ZP_07679499.1| DNA ligase, NAD-dependent [Shigella dysenteriae 1617]
 gi|123728534|sp|Q32DE2|DNLJ_SHIDS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81241953|gb|ABB62663.1| DNA ligase [Shigella dysenteriae Sd197]
 gi|308927236|gb|EFP72710.1| DNA ligase, NAD-dependent [Shigella dysenteriae 1617]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|74312947|ref|YP_311366.1| NAD-dependent DNA ligase LigA [Shigella sonnei Ss046]
 gi|123732314|sp|Q3YZD1|DNLJ_SHISS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|73856424|gb|AAZ89131.1| DNA ligase [Shigella sonnei Ss046]
 gi|323169148|gb|EFZ54825.1| DNA ligase, NAD-dependent [Shigella sonnei 53G]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|26248787|ref|NP_754827.1| NAD-dependent DNA ligase LigA [Escherichia coli CFT073]
 gi|170680446|ref|YP_001744602.1| NAD-dependent DNA ligase LigA [Escherichia coli SMS-3-5]
 gi|227887457|ref|ZP_04005262.1| NAD-dependent DNA ligase LigA [Escherichia coli 83972]
 gi|300981618|ref|ZP_07175608.1| DNA ligase, NAD-dependent [Escherichia coli MS 45-1]
 gi|301046300|ref|ZP_07193464.1| DNA ligase, NAD-dependent [Escherichia coli MS 185-1]
 gi|81475373|sp|Q8FFC1|DNLJ_ECOL6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781328|sp|B1LMK5|DNLJ_ECOSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|26109193|gb|AAN81395.1|AE016764_77 DNA ligase [Escherichia coli CFT073]
 gi|170518164|gb|ACB16342.1| DNA ligase, NAD-dependent [Escherichia coli SMS-3-5]
 gi|227835807|gb|EEJ46273.1| NAD-dependent DNA ligase LigA [Escherichia coli 83972]
 gi|300301715|gb|EFJ58100.1| DNA ligase, NAD-dependent [Escherichia coli MS 185-1]
 gi|300408962|gb|EFJ92500.1| DNA ligase, NAD-dependent [Escherichia coli MS 45-1]
 gi|307554453|gb|ADN47228.1| DNA ligase [Escherichia coli ABU 83972]
 gi|315293473|gb|EFU52825.1| DNA ligase, NAD-dependent [Escherichia coli MS 153-1]
 gi|323977408|gb|EGB72494.1| DNA ligase [Escherichia coli TW10509]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|15802944|ref|NP_288973.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 EDL933]
 gi|12516784|gb|AAG57530.1|AE005471_7 DNA ligase [Escherichia coli O157:H7 str. EDL933]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|15832537|ref|NP_311310.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str. Sakai]
 gi|168768500|ref|ZP_02793507.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4486]
 gi|168778374|ref|ZP_02803381.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4076]
 gi|208813694|ref|ZP_03255023.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4045]
 gi|208821178|ref|ZP_03261498.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4042]
 gi|209399429|ref|YP_002271890.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4115]
 gi|217326968|ref|ZP_03443051.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. TW14588]
 gi|254794365|ref|YP_003079202.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223146|ref|ZP_05937427.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259301|ref|ZP_05951834.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283640|ref|YP_003500458.1| DNA ligase [Escherichia coli O55:H7 str. CB9615]
 gi|166215595|sp|Q8XBL5|DNLJ_ECO57 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781320|sp|B5YZV8|DNLJ_ECO5E RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|13362753|dbj|BAB36706.1| DNA ligase [Escherichia coli O157:H7 str. Sakai]
 gi|189003243|gb|EDU72229.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4076]
 gi|189362250|gb|EDU80669.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4486]
 gi|208734971|gb|EDZ83658.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4045]
 gi|208741301|gb|EDZ88983.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4042]
 gi|209160829|gb|ACI38262.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. EC4115]
 gi|209764248|gb|ACI80436.1| DNA ligase [Escherichia coli]
 gi|209764250|gb|ACI80437.1| DNA ligase [Escherichia coli]
 gi|209764252|gb|ACI80438.1| DNA ligase [Escherichia coli]
 gi|209764256|gb|ACI80440.1| DNA ligase [Escherichia coli]
 gi|217319335|gb|EEC27760.1| DNA ligase, NAD-dependent [Escherichia coli O157:H7 str. TW14588]
 gi|254593765|gb|ACT73126.1| DNA ligase, NAD(+)-dependent [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763513|gb|ADD57474.1| DNA ligase [Escherichia coli O55:H7 str. CB9615]
 gi|320188751|gb|EFW63410.1| DNA ligase [Escherichia coli O157:H7 str. EC1212]
 gi|320640925|gb|EFX10409.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str. G5101]
 gi|320646206|gb|EFX15133.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H- str.
           493-89]
 gi|320651712|gb|EFX20092.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H- str. H
           2687]
 gi|320657097|gb|EFX24906.1| NAD-dependent DNA ligase LigA [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320662857|gb|EFX30185.1| NAD-dependent DNA ligase LigA [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667743|gb|EFX34654.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326340214|gb|EGD64018.1| DNA ligase [Escherichia coli O157:H7 str. 1125]
 gi|326344216|gb|EGD67977.1| DNA ligase [Escherichia coli O157:H7 str. 1044]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|110642595|ref|YP_670325.1| NAD-dependent DNA ligase LigA [Escherichia coli 536]
 gi|191174600|ref|ZP_03036093.1| DNA ligase, NAD-dependent [Escherichia coli F11]
 gi|300997757|ref|ZP_07181842.1| DNA ligase, NAD-dependent [Escherichia coli MS 200-1]
 gi|306814500|ref|ZP_07448662.1| NAD-dependent DNA ligase LigA [Escherichia coli NC101]
 gi|122958158|sp|Q0TF55|DNLJ_ECOL5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110344187|gb|ABG70424.1| DNA ligase [Escherichia coli 536]
 gi|190905126|gb|EDV64772.1| DNA ligase, NAD-dependent [Escherichia coli F11]
 gi|222034142|emb|CAP76883.1| DNA ligase [Escherichia coli LF82]
 gi|300304141|gb|EFJ58661.1| DNA ligase, NAD-dependent [Escherichia coli MS 200-1]
 gi|305851894|gb|EFM52346.1| NAD-dependent DNA ligase LigA [Escherichia coli NC101]
 gi|312947007|gb|ADR27834.1| NAD-dependent DNA ligase LigA [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324011127|gb|EGB80346.1| DNA ligase, NAD-dependent [Escherichia coli MS 60-1]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|157156100|ref|YP_001463741.1| NAD-dependent DNA ligase LigA [Escherichia coli E24377A]
 gi|193066723|ref|ZP_03047750.1| DNA ligase, NAD-dependent [Escherichia coli E22]
 gi|194430461|ref|ZP_03062941.1| DNA ligase, NAD-dependent [Escherichia coli B171]
 gi|209919893|ref|YP_002293977.1| NAD-dependent DNA ligase LigA [Escherichia coli SE11]
 gi|218554944|ref|YP_002387857.1| NAD-dependent DNA ligase LigA [Escherichia coli IAI1]
 gi|218696047|ref|YP_002403714.1| NAD-dependent DNA ligase LigA [Escherichia coli 55989]
 gi|256017438|ref|ZP_05431303.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
 gi|260845052|ref|YP_003222830.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O103:H2 str.
           12009]
 gi|260856513|ref|YP_003230404.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O26:H11 str.
           11368]
 gi|260869108|ref|YP_003235510.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O111:H- str.
           11128]
 gi|293446772|ref|ZP_06663194.1| DNA ligase [Escherichia coli B088]
 gi|300817349|ref|ZP_07097566.1| DNA ligase, NAD-dependent [Escherichia coli MS 107-1]
 gi|300820921|ref|ZP_07101071.1| DNA ligase, NAD-dependent [Escherichia coli MS 119-7]
 gi|300903139|ref|ZP_07121073.1| DNA ligase, NAD-dependent [Escherichia coli MS 84-1]
 gi|300921341|ref|ZP_07137704.1| DNA ligase, NAD-dependent [Escherichia coli MS 115-1]
 gi|301306250|ref|ZP_07212323.1| DNA ligase, NAD-dependent [Escherichia coli MS 124-1]
 gi|301328910|ref|ZP_07221944.1| DNA ligase, NAD-dependent [Escherichia coli MS 78-1]
 gi|307312589|ref|ZP_07592222.1| DNA ligase, NAD-dependent [Escherichia coli W]
 gi|309794543|ref|ZP_07688966.1| DNA ligase, NAD-dependent [Escherichia coli MS 145-7]
 gi|331669152|ref|ZP_08370000.1| DNA ligase, NAD-dependent [Escherichia coli TA271]
 gi|331678399|ref|ZP_08379074.1| DNA ligase, NAD-dependent [Escherichia coli H591]
 gi|332278439|ref|ZP_08390852.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
 gi|190359253|sp|A7ZPL2|DNLJ_ECO24 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781319|sp|B7LCF6|DNLJ_ECO55 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781323|sp|B7M6S1|DNLJ_ECO8A RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781327|sp|B6I4Y8|DNLJ_ECOSE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157078130|gb|ABV17838.1| DNA ligase, NAD-dependent [Escherichia coli E24377A]
 gi|192925627|gb|EDV80294.1| DNA ligase, NAD-dependent [Escherichia coli E22]
 gi|194411494|gb|EDX27836.1| DNA ligase, NAD-dependent [Escherichia coli B171]
 gi|209913152|dbj|BAG78226.1| DNA ligase [Escherichia coli SE11]
 gi|218352779|emb|CAU98567.1| DNA ligase, NAD(+)-dependent [Escherichia coli 55989]
 gi|218361712|emb|CAQ99309.1| DNA ligase, NAD(+)-dependent [Escherichia coli IAI1]
 gi|257755162|dbj|BAI26664.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O26:H11 str.
           11368]
 gi|257760199|dbj|BAI31696.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O103:H2 str.
           12009]
 gi|257765464|dbj|BAI36959.1| DNA ligase LigA, NAD(+)-dependent [Escherichia coli O111:H- str.
           11128]
 gi|291323602|gb|EFE63030.1| DNA ligase [Escherichia coli B088]
 gi|300404835|gb|EFJ88373.1| DNA ligase, NAD-dependent [Escherichia coli MS 84-1]
 gi|300411729|gb|EFJ95039.1| DNA ligase, NAD-dependent [Escherichia coli MS 115-1]
 gi|300526674|gb|EFK47743.1| DNA ligase, NAD-dependent [Escherichia coli MS 119-7]
 gi|300529975|gb|EFK51037.1| DNA ligase, NAD-dependent [Escherichia coli MS 107-1]
 gi|300838493|gb|EFK66253.1| DNA ligase, NAD-dependent [Escherichia coli MS 124-1]
 gi|300844712|gb|EFK72472.1| DNA ligase, NAD-dependent [Escherichia coli MS 78-1]
 gi|306907512|gb|EFN38016.1| DNA ligase, NAD-dependent [Escherichia coli W]
 gi|308121999|gb|EFO59261.1| DNA ligase, NAD-dependent [Escherichia coli MS 145-7]
 gi|315061736|gb|ADT76063.1| DNA ligase, NAD(+)-dependent [Escherichia coli W]
 gi|315256427|gb|EFU36395.1| DNA ligase, NAD-dependent [Escherichia coli MS 85-1]
 gi|320199974|gb|EFW74563.1| DNA ligase [Escherichia coli EC4100B]
 gi|323156318|gb|EFZ42476.1| DNA ligase, NAD-dependent [Escherichia coli EPECa14]
 gi|323159458|gb|EFZ45441.1| DNA ligase, NAD-dependent [Escherichia coli E128010]
 gi|323177463|gb|EFZ63051.1| DNA ligase, NAD-dependent [Escherichia coli 1180]
 gi|323184284|gb|EFZ69660.1| DNA ligase, NAD-dependent [Escherichia coli 1357]
 gi|323377683|gb|ADX49951.1| DNA ligase, NAD-dependent [Escherichia coli KO11]
 gi|323944634|gb|EGB40701.1| DNA ligase [Escherichia coli H120]
 gi|324020175|gb|EGB89394.1| DNA ligase, NAD-dependent [Escherichia coli MS 117-3]
 gi|324118125|gb|EGC12023.1| DNA ligase [Escherichia coli E1167]
 gi|331064346|gb|EGI36257.1| DNA ligase, NAD-dependent [Escherichia coli TA271]
 gi|331074859|gb|EGI46179.1| DNA ligase, NAD-dependent [Escherichia coli H591]
 gi|332100791|gb|EGJ04137.1| NAD-dependent DNA ligase LigA [Shigella sp. D9]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|330912204|gb|EGH40714.1| DNA ligase [Escherichia coli AA86]
          Length = 671

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|294631529|ref|ZP_06710089.1| DNA ligase, NAD-dependent [Streptomyces sp. e14]
 gi|292834862|gb|EFF93211.1| DNA ligase, NAD-dependent [Streptomyces sp. e14]
          Length = 732

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
            EA  E   L +    H+  YY  D P+ +D  +DR+   L+AL+E++PEL   D P   
Sbjct: 3   AEAREEHARLAEQVEEHRFRYYVKDAPVISDADFDRLLRSLEALEERYPELRTPDSPTQK 62

Query: 117 VG 118
           V 
Sbjct: 63  VA 64


>gi|313106533|ref|ZP_07792762.1| DNA ligase [Pseudomonas aeruginosa 39016]
 gi|310879264|gb|EFQ37858.1| DNA ligase [Pseudomonas aeruginosa 39016]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALETEYPQLLTPDSPTQRV 65


>gi|296390104|ref|ZP_06879579.1| NAD-dependent DNA ligase LigA [Pseudomonas aeruginosa PAb1]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALETEYPQLLTPDSPTQRV 65


>gi|254360665|ref|ZP_04976814.1| DNA ligase (NAD(+)) [Mannheimia haemolytica PHL213]
 gi|153091205|gb|EDN73210.1| DNA ligase (NAD(+)) [Mannheimia haemolytica PHL213]
          Length = 685

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + ++E + +    ++  Y+ LDNP   D  YDR+   L  L+ Q PEL   D P   V
Sbjct: 17  ELVEKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPTQRV 76

Query: 118 G 118
           G
Sbjct: 77  G 77


>gi|15596726|ref|NP_250220.1| NAD-dependent DNA ligase LigA [Pseudomonas aeruginosa PAO1]
 gi|107100960|ref|ZP_01364878.1| hypothetical protein PaerPA_01001990 [Pseudomonas aeruginosa PACS2]
 gi|218892513|ref|YP_002441382.1| NAD-dependent DNA ligase LigA [Pseudomonas aeruginosa LESB58]
 gi|81541359|sp|Q9I3I4|DNLJ_PSEAE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781394|sp|B7UVJ3|DNLJ_PSEA8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|9947487|gb|AAG04918.1|AE004581_5 DNA ligase [Pseudomonas aeruginosa PAO1]
 gi|218772741|emb|CAW28526.1| DNA ligase [Pseudomonas aeruginosa LESB58]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALEAEYPQLLTPDSPTQRV 65


>gi|254239878|ref|ZP_04933200.1| DNA ligase [Pseudomonas aeruginosa 2192]
 gi|126193256|gb|EAZ57319.1| DNA ligase [Pseudomonas aeruginosa 2192]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALEAEYPQLLTPDSPTQRV 65


>gi|254234624|ref|ZP_04927947.1| DNA ligase [Pseudomonas aeruginosa C3719]
 gi|126166555|gb|EAZ52066.1| DNA ligase [Pseudomonas aeruginosa C3719]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALEAEYPQLLTPDSPTQRV 65


>gi|116049473|ref|YP_791724.1| NAD-dependent DNA ligase LigA [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122258581|sp|Q02K12|DNLJ_PSEAB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115584694|gb|ABJ10709.1| DNA ligase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 794

 Score = 41.2 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ ++P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALETEYPQLLTPDSPTQRV 65


>gi|261493319|ref|ZP_05989845.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261310963|gb|EEY12140.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 685

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + ++E + +    ++  Y+ LDNP   D  YDR+   L  L+ Q PEL   D P   V
Sbjct: 17  ELVEKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPTQRV 76

Query: 118 G 118
           G
Sbjct: 77  G 77


>gi|261496584|ref|ZP_05992964.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307787|gb|EEY09110.1| NAD-dependent DNA ligase LigA [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 685

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + ++E + +    ++  Y+ LDNP   D  YDR+   L  L+ Q PEL   D P   V
Sbjct: 17  ELVEKIETIRQTLRQYEYEYHVLDNPSVPDAEYDRLMNELKNLEWQHPELISADSPTQRV 76

Query: 118 G 118
           G
Sbjct: 77  G 77


>gi|317014035|gb|ADU81471.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Gambia94/24]
          Length = 656

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDEPIVSDAVYDELYQELKAYEEENPNRIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|332519658|ref|ZP_08396122.1| DNA ligase, NAD-dependent [Lacinutrix algicola 5H-3-7-4]
 gi|332044217|gb|EGI80411.1| DNA ligase, NAD-dependent [Lacinutrix algicola 5H-3-7-4]
          Length = 665

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L +    H   YY LDNP  +D  +D   + L AL+E  PE FD + P   VG
Sbjct: 6   EIEQLRQELREHNYNYYVLDNPTISDYDFDIKLKELQALEEAHPEFFDANSPTLRVG 62


>gi|189425977|ref|YP_001953154.1| DNA ligase, NAD-dependent [Geobacter lovleyi SZ]
 gi|254781338|sp|B3E8F8|DNLJ_GEOLS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189422236|gb|ACD96634.1| DNA ligase, NAD-dependent [Geobacter lovleyi SZ]
          Length = 683

 Score = 40.8 bits (94), Expect = 0.056,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A +    L ++  HH + YY LD+P  +D  YD +   L  ++   P+L   D P   VG
Sbjct: 16  AQLRAAELRRLLEHHNRCYYELDSPEISDAEYDALFRELQVIEAARPDLLTPDSPTLRVG 75


>gi|108798849|ref|YP_639046.1| NAD-dependent DNA ligase LigA [Mycobacterium sp. MCS]
 gi|119867964|ref|YP_937916.1| NAD-dependent DNA ligase LigA [Mycobacterium sp. KMS]
 gi|126434449|ref|YP_001070140.1| NAD-dependent DNA ligase LigA [Mycobacterium sp. JLS]
 gi|123369452|sp|Q1BAU4|DNLJ_MYCSS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166216212|sp|A3PXM2|DNLJ_MYCSJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166216213|sp|A1UE68|DNLJ_MYCSK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|108769268|gb|ABG07990.1| DNA ligase, NAD-dependent [Mycobacterium sp. MCS]
 gi|119694053|gb|ABL91126.1| DNA ligase, NAD-dependent [Mycobacterium sp. KMS]
 gi|126234249|gb|ABN97649.1| DNA ligase, NAD-dependent [Mycobacterium sp. JLS]
          Length = 701

 Score = 40.8 bits (94), Expect = 0.056,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D++ ++L+AL+ + PEL   D P   VG
Sbjct: 36  HQFRYYVRDAPVISDADFDKLFQQLEALEAEHPELRAPDSPTQLVG 81


>gi|260581847|ref|ZP_05849643.1| DNA ligase, NAD-dependent [Haemophilus influenzae NT127]
 gi|260095040|gb|EEW78932.1| DNA ligase, NAD-dependent [Haemophilus influenzae NT127]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 16  QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 72


>gi|229846132|ref|ZP_04466244.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 7P49H1]
 gi|229811136|gb|EEP46853.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 7P49H1]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|30995424|ref|NP_439257.2| NAD-dependent DNA ligase LigA [Haemophilus influenzae Rd KW20]
 gi|145638086|ref|ZP_01793696.1| DNA ligase [Haemophilus influenzae PittII]
 gi|166214918|sp|P43813|DNLJ_HAEIN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145272415|gb|EDK12322.1| DNA ligase [Haemophilus influenzae PittII]
 gi|309751252|gb|ADO81236.1| NAD-dependent DNA ligase [Haemophilus influenzae R2866]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|319776649|ref|YP_004139137.1| DNA ligase, NAD(+)-dependent [Haemophilus influenzae F3047]
 gi|329124164|ref|ZP_08252711.1| NAD-dependent DNA ligase LigA [Haemophilus aegyptius ATCC 11116]
 gi|317451240|emb|CBY87473.1| DNA ligase, NAD(+)-dependent [Haemophilus influenzae F3047]
 gi|327467589|gb|EGF13087.1| NAD-dependent DNA ligase LigA [Haemophilus aegyptius ATCC 11116]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|319897423|ref|YP_004135620.1| DNA ligase, nad(+)-dependent [Haemophilus influenzae F3031]
 gi|317432929|emb|CBY81295.1| DNA ligase, NAD(+)-dependent [Haemophilus influenzae F3031]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 16  QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 72


>gi|148828262|ref|YP_001293015.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae PittGG]
 gi|166215779|sp|A5UIM6|DNLJ_HAEIG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148719504|gb|ABR00632.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae PittGG]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|145636448|ref|ZP_01792116.1| DNA ligase [Haemophilus influenzae PittHH]
 gi|145270273|gb|EDK10208.1| DNA ligase [Haemophilus influenzae PittHH]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|161761269|ref|YP_248767.2| NAD-dependent DNA ligase LigA [Haemophilus influenzae 86-028NP]
 gi|166215835|sp|Q4QLJ0|DNLJ_HAEI8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|309973429|gb|ADO96630.1| NAD-dependent DNA ligase [Haemophilus influenzae R2846]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|148826285|ref|YP_001291038.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae PittEE]
 gi|166215778|sp|A5UD04|DNLJ_HAEIE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148716445|gb|ABQ98655.1| DNA ligase [Haemophilus influenzae PittEE]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|34499358|ref|NP_903573.1| DNA ligase [Chromobacterium violaceum ATCC 12472]
 gi|81654398|sp|Q7NR81|DNLJ_CHRVO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|34105208|gb|AAQ61564.1| DNA ligase [Chromobacterium violaceum ATCC 12472]
          Length = 821

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L AL+E  PEL   D P   VG
Sbjct: 40  YYVLDAPTVPDAEYDRLFRELQALEEAHPELAVSDSPTRRVG 81


>gi|104780921|ref|YP_607419.1| NAD-dependent DNA ligase LigA [Pseudomonas entomophila L48]
 gi|122985912|sp|Q1ICK0|DNLJ_PSEE4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|95109908|emb|CAK14613.1| NAD-dependent DNA ligase [Pseudomonas entomophila L48]
          Length = 784

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P+L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPQLVTADSPTQRVG 62


>gi|270262950|ref|ZP_06191221.1| DNA ligase, NAD-dependent [Serratia odorifera 4Rx13]
 gi|270043634|gb|EFA16727.1| DNA ligase, NAD-dependent [Serratia odorifera 4Rx13]
          Length = 673

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 17  HHEYQYHVLDAPEVPDAEYDRLMNELRELENAHPELITADSPTQRVG 63


>gi|254556107|ref|YP_003062524.1| DNA ligase (NAD+) [Lactobacillus plantarum JDM1]
 gi|300766626|ref|ZP_07076543.1| NAD-dependent DNA ligase LigA [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308180104|ref|YP_003924232.1| DNA ligase (NAD+) [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|254045034|gb|ACT61827.1| DNA ligase (NAD+) [Lactobacillus plantarum JDM1]
 gi|300495726|gb|EFK30877.1| NAD-dependent DNA ligase LigA [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308045595|gb|ADN98138.1| DNA ligase (NAD+) [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 35/71 (49%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A K  +++  +A  E   L +     ++ YY  D P   D +YD+  ERL  L++ FP+L
Sbjct: 2   ADKPNTMTVEQAADEAAALRQTLNEWRRQYYDEDAPNVEDSVYDQKYERLVELEQTFPQL 61

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 62  VTPDSPTQLVG 72


>gi|28377923|ref|NP_784815.1| DNA ligase (NAD+) [Lactobacillus plantarum WCFS1]
 gi|81631729|sp|Q88XQ0|DNLJ_LACPL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|28270757|emb|CAD63662.1| DNA ligase (NAD+) [Lactobacillus plantarum WCFS1]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 35/71 (49%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A K  +++  +A  E   L +     ++ YY  D P   D +YD+  ERL  L++ FP+L
Sbjct: 2   ADKPNTMTVEQAADEAAALRQTLNEWRRQYYDEDAPNVEDSVYDQKYERLVELEQTFPQL 61

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 62  VTPDSPTQLVG 72


>gi|15611625|ref|NP_223276.1| NAD-dependent DNA ligase LigA [Helicobacter pylori J99]
 gi|7674020|sp|Q9ZLM1|DNLJ_HELPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|4155109|gb|AAD06141.1| DNA LIGASE [Helicobacter pylori J99]
          Length = 656

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD P+ +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDEPIVSDAVYDELYQELKAYEEENPNRIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|300867541|ref|ZP_07112191.1| DNA ligase [Oscillatoria sp. PCC 6506]
 gi|300334429|emb|CBN57361.1| DNA ligase [Oscillatoria sp. PCC 6506]
          Length = 690

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YDR+   L  L+ Q PEL   + P   VG
Sbjct: 23  YYVLDTPIMPDEVYDRLYRELQELETQHPELISLESPTQRVG 64


>gi|94499335|ref|ZP_01305873.1| DNA ligase, NAD-dependent [Oceanobacter sp. RED65]
 gi|94428967|gb|EAT13939.1| DNA ligase, NAD-dependent [Oceanobacter sp. RED65]
          Length = 694

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D  YDR+   L  L+ + PEL  +D P   VG
Sbjct: 40  YYVLDDPSIPDAEYDRLFHELKGLESKHPELLTKDSPTQRVG 81


>gi|171059186|ref|YP_001791535.1| DNA ligase, NAD-dependent [Leptothrix cholodnii SP-6]
 gi|254781357|sp|B1Y6D4|DNLJ_LEPCP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|170776631|gb|ACB34770.1| DNA ligase, NAD-dependent [Leptothrix cholodnii SP-6]
          Length = 768

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           HH   YY LD P   D  YDR+ + L A++  +P L   D P   V
Sbjct: 47  HHAHLYYVLDAPELPDAEYDRLFQELQAIEAMYPALRTADSPTQRV 92


>gi|16125769|ref|NP_420333.1| DNA ligase, NAD-dependent [Caulobacter crescentus CB15]
 gi|221234527|ref|YP_002516963.1| NAD-dependent DNA ligase [Caulobacter crescentus NA1000]
 gi|81535469|sp|Q9A842|DNLJ_CAUCR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781280|sp|B8H5Y7|DNLJ_CAUCN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|13422903|gb|AAK23501.1| DNA ligase, NAD-dependent [Caulobacter crescentus CB15]
 gi|220963699|gb|ACL95055.1| NAD-dependent DNA ligase [Caulobacter crescentus NA1000]
          Length = 783

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ +A+ ++E L  +   H   Y++ DNP  +D  YD +  R   ++ +FP L  +
Sbjct: 6   VADLTEAQAVEDLERLADLLATHDIAYHQEDNPTVSDAEYDALKRRNLDIETRFPHLVRD 65

Query: 111 DHPWNTVG 118
           + P   VG
Sbjct: 66  NSPSMRVG 73


>gi|322373465|ref|ZP_08048001.1| DNA ligase, NAD-dependent [Streptococcus sp. C150]
 gi|321278507|gb|EFX55576.1| DNA ligase, NAD-dependent [Streptococcus sp. C150]
          Length = 652

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L AL+ + PEL   D P + VG
Sbjct: 14  QYAKEYYTEDNPSVSDAEYDKLYRELVALEAEHPELVQADSPTHRVG 60


>gi|297571016|ref|YP_003696790.1| DNA ligase, NAD-dependent [Arcanobacterium haemolyticum DSM 20595]
 gi|296931363|gb|ADH92171.1| DNA ligase, NAD-dependent [Arcanobacterium haemolyticum DSM 20595]
          Length = 843

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A +  + L    L  Q+ YY   + +  D  YD +   L AL+E+FP+L+  D P   V
Sbjct: 11  DAQVRWQELAPQLLDAQETYYSTGDQVMVDATYDALMRELRALEEEFPQLWSPDSPSTKV 70

Query: 118 G 118
           G
Sbjct: 71  G 71


>gi|254502790|ref|ZP_05114941.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
 gi|222438861|gb|EEE45540.1| DNA ligase, NAD-dependent [Labrenzia alexandrii DFL-11]
          Length = 725

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L+   A  E+E L      H + Y++ D P  +D  YD +  R  A++ +FP+L   
Sbjct: 18  VLDLTPEAAKAELERLASEIAEHDRRYHQEDAPTISDADYDALRRRNSAIEARFPDLILA 77

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 78  DGPSAQVG 85


>gi|145630192|ref|ZP_01785974.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae R3021]
 gi|144984473|gb|EDJ91896.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae R3021]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|260580185|ref|ZP_05848015.1| DNA ligase, NAD-dependent [Haemophilus influenzae RdAW]
 gi|1574651|gb|AAC22753.1| DNA ligase (lig) [Haemophilus influenzae Rd KW20]
 gi|260093469|gb|EEW77402.1| DNA ligase, NAD-dependent [Haemophilus influenzae RdAW]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 16  QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 72


>gi|68057854|gb|AAX88107.1| DNA ligase [Haemophilus influenzae 86-028NP]
          Length = 679

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 16  QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 72


>gi|197121145|ref|YP_002133096.1| DNA ligase, NAD-dependent [Anaeromyxobacter sp. K]
 gi|254781542|sp|B4UDH6|DNLJ_ANASK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|196170994|gb|ACG71967.1| DNA ligase, NAD-dependent [Anaeromyxobacter sp. K]
          Length = 687

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR+   L AL+   PEL   D P   V
Sbjct: 24  YYVLDQPLLADAEYDRLMHELQALEADHPELVTADSPTQRV 64


>gi|307293327|ref|ZP_07573173.1| DNA ligase, NAD-dependent [Sphingobium chlorophenolicum L-1]
 gi|306881393|gb|EFN12609.1| DNA ligase, NAD-dependent [Sphingobium chlorophenolicum L-1]
          Length = 711

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 31/67 (46%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           T +++ EA   +  L +    H + Y+  D P  TD  YD +    +AL+  FP L   D
Sbjct: 5   TPMTEAEAANRLMRLAREIARHNRLYHDQDQPEITDAAYDALIRENNALEAAFPHLIRSD 64

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 65  SPNAQVG 71


>gi|166216286|sp|A0KVI4|DNLJ_SHESA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 689

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 37  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 82


>gi|126668324|ref|ZP_01739283.1| DNA ligase, NAD-dependent [Marinobacter sp. ELB17]
 gi|126627241|gb|EAZ97879.1| DNA ligase, NAD-dependent [Marinobacter sp. ELB17]
          Length = 703

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P   D  YDR+   L AL+ ++PEL     P   VG
Sbjct: 22  HNHHYYVLDDPQVPDAEYDRLFRGLQALEAEYPELATATSPTQRVG 67


>gi|117920017|ref|YP_869209.1| DNA ligase, NAD-dependent [Shewanella sp. ANA-3]
 gi|117612349|gb|ABK47803.1| DNA ligase, NAD-dependent [Shewanella sp. ANA-3]
          Length = 691

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 39  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 84


>gi|288958932|ref|YP_003449273.1| DNA ligase (NAD+) [Azospirillum sp. B510]
 gi|288911240|dbj|BAI72729.1| DNA ligase (NAD+) [Azospirillum sp. B510]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH + Y++ D P  TD  YD +  R  A++ +FPEL   D P   VG
Sbjct: 37  HHDRLYHQQDQPEITDADYDALVRRNLAIEARFPELRRADSPSLRVG 83


>gi|207109554|ref|ZP_03243716.1| NAD-dependent DNA ligase LigA [Helicobacter pylori HPKX_438_CA4C1]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPTQKVG 63


>gi|149911742|ref|ZP_01900348.1| NAD-dependent DNA ligase [Moritella sp. PE36]
 gi|149805167|gb|EDM65187.1| NAD-dependent DNA ligase [Moritella sp. PE36]
          Length = 482

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +HQ  YY LDNP   D  YDR+   L  L+ +FPEL     P   VG
Sbjct: 19  NHQ--YYVLDNPTVPDAEYDRLLRELKQLETEFPELALATSPTQKVG 63


>gi|295688860|ref|YP_003592553.1| DNA ligase, NAD-dependent [Caulobacter segnis ATCC 21756]
 gi|295430763|gb|ADG09935.1| DNA ligase, NAD-dependent [Caulobacter segnis ATCC 21756]
          Length = 783

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ +A+ E+E L      H   Y++ DNP  +D  YD +  R   ++ +FP L  +
Sbjct: 6   VADLTEAQAVEELERLADELTRHDLAYHQQDNPTISDADYDALKRRNLDIETRFPHLVRD 65

Query: 111 DHPWNTVG 118
           + P   VG
Sbjct: 66  NSPSMRVG 73


>gi|70729275|ref|YP_259012.1| NAD-dependent DNA ligase LigA [Pseudomonas fluorescens Pf-5]
 gi|123734866|sp|Q4KFH1|DNLJ_PSEF5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|68343574|gb|AAY91180.1| DNA ligase, NAD-dependent [Pseudomonas fluorescens Pf-5]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + PEL   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFRELKALEAEHPELVTSDSPTQRVG 63


>gi|312962450|ref|ZP_07776941.1| DNA ligase [Pseudomonas fluorescens WH6]
 gi|311283377|gb|EFQ61967.1| DNA ligase [Pseudomonas fluorescens WH6]
          Length = 789

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + PEL   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAEHPELVTRDSPTQRVG 63


>gi|58426627|gb|AAW75664.1| DNA ligase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 961

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 39  RALESWLDKAKKVTSLSKG--EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSER 96
           RA+E  +   + V ++ +G  E   E+   ++ A H    YY L +P  TD  YD++   
Sbjct: 106 RAIELKILSGQLVETMEQGVIERARELRRRIENADHR---YYDLADPEITDAQYDQLFRE 162

Query: 97  LDALQEQFPELFDEDHPWNTVG 118
           L  L++++PEL   D P   VG
Sbjct: 163 LQELEQKYPELVTADSPSMRVG 184


>gi|302524940|ref|ZP_07277282.1| DNA ligase, NAD-dependent [Streptomyces sp. AA4]
 gi|302433835|gb|EFL05651.1| DNA ligase, NAD-dependent [Streptomyces sp. AA4]
          Length = 707

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD+P+ +DG +D +   L  +++++P L   D P   VG
Sbjct: 28  HQFRYYVLDSPIISDGQFDALLGDLQKIEDEYPALVTPDSPTQNVG 73


>gi|166216288|sp|Q0HWD2|DNLJ_SHESR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 688

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 37  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 82


>gi|114047080|ref|YP_737630.1| DNA ligase, NAD-dependent [Shewanella sp. MR-7]
 gi|113888522|gb|ABI42573.1| DNA ligase, NAD-dependent [Shewanella sp. MR-7]
          Length = 690

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 39  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 84


>gi|322652148|gb|EFY48510.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
          Length = 571

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|322613832|gb|EFY10771.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617441|gb|EFY14340.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624929|gb|EFY21758.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629628|gb|EFY26404.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633942|gb|EFY30679.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635621|gb|EFY32332.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639981|gb|EFY36651.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644326|gb|EFY40867.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322655311|gb|EFY51620.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658357|gb|EFY54623.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664357|gb|EFY60554.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668412|gb|EFY64568.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673252|gb|EFY69358.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676644|gb|EFY72712.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683394|gb|EFY79408.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685720|gb|EFY81713.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192602|gb|EFZ77831.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196835|gb|EFZ81978.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202141|gb|EFZ87199.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208024|gb|EFZ92969.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212850|gb|EFZ97659.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217119|gb|EGA01841.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219619|gb|EGA04102.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323229192|gb|EGA13316.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235493|gb|EGA19577.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237321|gb|EGA21384.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245552|gb|EGA29550.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248968|gb|EGA32891.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253065|gb|EGA36897.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255865|gb|EGA39610.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261411|gb|EGA44996.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266454|gb|EGA49942.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269716|gb|EGA53166.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|300087757|ref|YP_003758279.1| DNA ligase, NAD-dependent [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527490|gb|ADJ25958.1| DNA ligase, NAD-dependent [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 687

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   ++ L K   HH   YY  D P  +D  YD +   L  L+ +FPEL  ++ P   V
Sbjct: 3   EAKKRIDTLRKQITHHNYLYYVKDEPEISDQEYDILFRELQILENEFPELASDESPTKIV 62

Query: 118 G 118
           G
Sbjct: 63  G 63


>gi|238912842|ref|ZP_04656679.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|224583040|ref|YP_002636838.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|254781413|sp|C0PZB4|DNLJ_SALPC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|224467567|gb|ACN45397.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|207857840|ref|YP_002244491.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|254781409|sp|B5R3V4|DNLJ_SALEP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206709643|emb|CAR33993.1| DNA ligase [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|205353534|ref|YP_002227335.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|254781410|sp|B5RCP9|DNLJ_SALG2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|205273315|emb|CAR38285.1| DNA ligase [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326628629|gb|EGE34972.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168817829|ref|ZP_02829829.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205345161|gb|EDZ31925.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086917|emb|CBY96687.1| DNA ligase [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|200388789|ref|ZP_03215401.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605887|gb|EDZ04432.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168466836|ref|ZP_02700690.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630762|gb|EDX49354.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168261543|ref|ZP_02683516.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205349337|gb|EDZ35968.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|194444893|ref|YP_002041687.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|254781412|sp|B4SZU5|DNLJ_SALNS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194403556|gb|ACF63778.1| DNA ligase [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168243193|ref|ZP_02668125.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449589|ref|YP_002046491.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|254781411|sp|B4TCF6|DNLJ_SALHS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194407893|gb|ACF68112.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205337689|gb|EDZ24453.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|204929538|ref|ZP_03220612.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204321257|gb|EDZ06457.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|197247622|ref|YP_002147380.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|254781407|sp|B5F0F5|DNLJ_SALA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197211325|gb|ACH48722.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168238909|ref|ZP_02663967.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734182|ref|YP_002115493.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|254781415|sp|B4TQF8|DNLJ_SALSV RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194709684|gb|ACF88905.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288317|gb|EDY27698.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|168231967|ref|ZP_02657025.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194471791|ref|ZP_03077775.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194458155|gb|EDX46994.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333574|gb|EDZ20338.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|198243638|ref|YP_002216496.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|254781408|sp|B5FQB9|DNLJ_SALDC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197938154|gb|ACH75487.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624250|gb|EGE30595.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|167549563|ref|ZP_02343322.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205325268|gb|EDZ13107.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|161612830|ref|YP_001586795.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|190359282|sp|A9N362|DNLJ_SALPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161362194|gb|ABX65962.1| hypothetical protein SPAB_00529 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|82701780|ref|YP_411346.1| DNA ligase, NAD-dependent [Nitrosospira multiformis ATCC 25196]
 gi|123754406|sp|Q2YBB7|DNLJ_NITMU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|82409845|gb|ABB73954.1| DNA ligase, NAD-dependent [Nitrosospira multiformis ATCC 25196]
          Length = 707

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           I LH+ + YY LD P   D  +D++   L+ L+++ PEL   D P   VG
Sbjct: 19  IELHNIR-YYELDTPTIPDADFDKLFRELEELEQRHPELITPDSPTQRVG 67


>gi|62180995|ref|YP_217412.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|75481868|sp|Q57LT1|DNLJ_SALCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|62128628|gb|AAX66331.1| DNA ligase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715476|gb|EFZ07047.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|56412686|ref|YP_149761.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361620|ref|YP_002141256.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81362021|sp|Q5PNE2|DNLJ_SALPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781414|sp|B5BB72|DNLJ_SALPK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56126943|gb|AAV76449.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197093096|emb|CAR58535.1| DNA ligase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|16765747|ref|NP_461362.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167991721|ref|ZP_02572820.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197262860|ref|ZP_03162934.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|81522316|sp|Q8ZN89|DNLJ_SALTY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|16420966|gb|AAL21321.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|197241115|gb|EDY23735.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205329843|gb|EDZ16607.1| DNA ligase, NAD-dependent [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247627|emb|CBG25454.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267994529|gb|ACY89414.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158979|emb|CBW18492.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312913414|dbj|BAJ37388.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222873|gb|EFX47944.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323130756|gb|ADX18186.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989355|gb|AEF08338.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|317049042|ref|YP_004116690.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
 gi|316950659|gb|ADU70134.1| DNA ligase, NAD-dependent [Pantoea sp. At-9b]
          Length = 672

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+  +L  L+   PEL   D P   VG
Sbjct: 17  HHEYLYHVMDTPEVPDAEYDRLMAQLRELESAHPELVTPDSPTQRVG 63


>gi|213962174|ref|ZP_03390438.1| DNA ligase, NAD-dependent [Capnocytophaga sputigena Capno]
 gi|213955180|gb|EEB66498.1| DNA ligase, NAD-dependent [Capnocytophaga sputigena Capno]
          Length = 663

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LDNP  +D  +D+  + L AL++  PE +DE+ P   VG
Sbjct: 14  QHNYNYYILDNPTISDYEFDQKLKELQALEQAHPEFYDENSPTVRVG 60


>gi|154685157|ref|YP_001420318.1| NAD-dependent DNA ligase LigA [Bacillus amyloliquefaciens FZB42]
 gi|166215394|sp|A7Z261|DNLJ_BACA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|154351008|gb|ABS73087.1| LigA [Bacillus amyloliquefaciens FZB42]
          Length = 669

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A    E L +    +   YY LD P   D  YDR+ + L A++E+ PEL   D P
Sbjct: 2   MDKETAKHRAEELRRTIDQYSYEYYTLDEPSVPDSEYDRLMQELIAIEEEHPELRTPDSP 61

Query: 114 WNTVG 118
              VG
Sbjct: 62  TQRVG 66


>gi|166216287|sp|Q0HK31|DNLJ_SHESM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 688

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 37  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 82


>gi|113969850|ref|YP_733643.1| DNA ligase, NAD-dependent [Shewanella sp. MR-4]
 gi|113884534|gb|ABI38586.1| DNA ligase, NAD-dependent [Shewanella sp. MR-4]
          Length = 690

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+ ++P+    D P   VG
Sbjct: 39  HNIRYYVDDAPSITDSEYDRLMQRLKQLEAEYPQFVAADSPTQRVG 84


>gi|319939188|ref|ZP_08013551.1| DNA ligase [Streptococcus anginosus 1_2_62CV]
 gi|319811584|gb|EFW07860.1| DNA ligase [Streptococcus anginosus 1_2_62CV]
          Length = 652

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LVK+   +   YY  DNP  +D  YD++   L  L++Q+PE    D P + VG
Sbjct: 8   LVKLLNQYAHEYYTTDNPSVSDSEYDKLYHELLDLEKQYPEFVQPDSPTHRVG 60


>gi|124302218|gb|ABN05294.1| DNA ligase [Geobacillus sp. g]
          Length = 670

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY L  P   D  YDR+ + L A++EQ+PEL   D P   +G
Sbjct: 24  YYVLGRPSVPDAEYDRLMQELMAIEEQYPELKTSDSPTQRIG 65


>gi|29140957|ref|NP_804299.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213160907|ref|ZP_03346617.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424270|ref|ZP_03357114.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213583650|ref|ZP_03365476.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213650852|ref|ZP_03380905.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|29136582|gb|AAO68148.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|16761347|ref|NP_456964.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|81513487|sp|Q8Z4W4|DNLJ_SALTI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|25294013|pir||AI0809 DNA ligase (NAD) (EC 6.5.1.2) - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503646|emb|CAD07659.1| DNA ligase [Salmonella enterica subsp. enterica serovar Typhi]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|289581750|ref|YP_003480216.1| DNA ligase, NAD-dependent [Natrialba magadii ATCC 43099]
 gi|289531303|gb|ADD05654.1| DNA ligase, NAD-dependent [Natrialba magadii ATCC 43099]
          Length = 699

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS  EA  +VE L      H + YY  ++PL  D  YD + ERL  L+  F +L   D P
Sbjct: 27  LSDDEAEQQVEQLRDAIREHDRRYYVENDPLIADRTYDTLFERLQVLESTF-DLSHPDSP 85

Query: 114 WNTVG 118
             +VG
Sbjct: 86  TRSVG 90


>gi|254468809|ref|ZP_05082215.1| DNA ligase, NAD-dependent [beta proteobacterium KB13]
 gi|207087619|gb|EDZ64902.1| DNA ligase, NAD-dependent [beta proteobacterium KB13]
          Length = 669

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ YL  +   H   YY LD+P  +D  YD +   L  +++  PEL   D P   VG
Sbjct: 8   KISYLKSVIQEHDHCYYVLDDPQISDHEYDSLLRELKNIEDSNPELITPDSPTQRVG 64


>gi|52313150|emb|CAH55605.1| DNA ligase (NAD dependent) [Bacillus amyloliquefaciens FZB42]
          Length = 668

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A    E L +    +   YY LD P   D  YDR+ + L A++E+ PEL   D P
Sbjct: 1   MDKETAKHRAEELRRTIDQYSYEYYTLDEPSVPDSEYDRLMQELIAIEEEHPELRTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|257069044|ref|YP_003155299.1| DNA ligase, NAD-dependent [Brachybacterium faecium DSM 4810]
 gi|256559862|gb|ACU85709.1| DNA ligase, NAD-dependent [Brachybacterium faecium DSM 4810]
          Length = 871

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D  YD + + L AL+E  P+L  ED P  TVG
Sbjct: 39  YYEHDAPTMADAEYDELEKELRALEEANPQLAAEDSPTRTVG 80


>gi|311233982|gb|ADP86836.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris RCH1]
          Length = 818

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY LD P  +D  YD +   L  L+ ++P L DE  P   VG
Sbjct: 72  HNRLYYELDTPEISDAEYDALYRELVGLETRWPALRDEASPTQRVG 117


>gi|258510685|ref|YP_003184119.1| DNA ligase, NAD-dependent [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477411|gb|ACV57730.1| DNA ligase, NAD-dependent [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 684

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 34/67 (50%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           ++LS  EA    + L +   +H + YY  DNP  +D  +D +   L  L+ ++PEL D  
Sbjct: 8   SALSLEEARARAKVLREQIEYHNRKYYLEDNPEISDAEWDALMRDLIELERKYPELVDPA 67

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 68  SPTQRVG 74


>gi|46580019|ref|YP_010827.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|81404693|sp|Q72BM7|DNLJ_DESVH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|46449435|gb|AAS96086.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 799

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY LD P  +D  YD +   L  L+ ++P L DE  P   VG
Sbjct: 53  HNRLYYELDTPEISDAEYDALYRELVGLETRWPALRDEASPTQRVG 98


>gi|225851368|ref|YP_002731602.1| DNA ligase, NAD-dependent [Persephonella marina EX-H1]
 gi|254781385|sp|C0QSF6|DNLJ_PERMH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225645574|gb|ACO03760.1| DNA ligase, NAD-dependent [Persephonella marina EX-H1]
          Length = 714

 Score = 40.4 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 37/73 (50%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L K KK    +K +A   +E L  +  +H   YY L NP+ +D  YD++   L  ++ +F
Sbjct: 17  LLKIKKEHIKTKEDAEAIIEDLRDVIRYHDWRYYVLANPVISDYEYDQLFHLLKDIESRF 76

Query: 105 PELFDEDHPWNTV 117
           PEL   D P   V
Sbjct: 77  PELITPDSPTQRV 89


>gi|33241290|ref|NP_876232.1| NAD-dependent DNA ligase LigA [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|81663882|sp|Q7V9J2|DNLJ_PROMA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33238820|gb|AAQ00885.1| NAD-dependent DNA ligase [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 685

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+PL  D ++DR+   L  L++Q+P L   D P   +G
Sbjct: 24  YYILDSPLIEDAVFDRLYRELIELEKQYPSLVTPDSPSQRLG 65


>gi|254292786|ref|YP_003058809.1| DNA ligase, NAD-dependent [Hirschia baltica ATCC 49814]
 gi|254041317|gb|ACT58112.1| DNA ligase, NAD-dependent [Hirschia baltica ATCC 49814]
          Length = 792

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 33/66 (50%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SL+  +A    E L +        YY  D P  +D  YD + + L AL+ +FP+L  +D 
Sbjct: 15  SLTLDQARERWEELAETIRQADSAYYEHDAPHLSDADYDALRQDLLALESEFPQLVAQDS 74

Query: 113 PWNTVG 118
           P  +VG
Sbjct: 75  PSQSVG 80


>gi|120602570|ref|YP_966970.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris DP4]
 gi|166215379|sp|A1VDM7|DNLJ2_DESVV RecName: Full=DNA ligase 2; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 2
 gi|120562799|gb|ABM28543.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris DP4]
          Length = 797

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALH-----HQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           + A +VTS ++ +A+ E        L      H + YY LD P  +D  YD +   L  L
Sbjct: 21  NDAAEVTSPARHDAIPEEARQRAAQLRADLERHNRLYYELDTPEISDAEYDVLYRELVGL 80

Query: 101 QEQFPELFDEDHPWNTVG 118
           + ++P L DE  P   VG
Sbjct: 81  ERRWPALRDEASPTQRVG 98


>gi|332529208|ref|ZP_08405172.1| DNA ligase [Hylemonella gracilis ATCC 19624]
 gi|332041431|gb|EGI77793.1| DNA ligase [Hylemonella gracilis ATCC 19624]
          Length = 738

 Score = 40.4 bits (93), Expect = 0.074,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           HH   YY LD P   D  YDR+ + L A++   PEL   D P   V
Sbjct: 34  HHAHRYYVLDAPEIPDAEYDRLFQELQAIEAAHPELRTPDSPTQRV 79


>gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040849|gb|ACT57645.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 731

 Score = 40.4 bits (93), Expect = 0.074,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF-- 108
           + +LS  +A  E+  L +   +H   YY+   P+  D  YD +  R DA+   FP+L   
Sbjct: 9   IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68

Query: 109 -DEDHPWNTVG 118
            D + P N +G
Sbjct: 69  EDPNGPLNKIG 79


>gi|270159993|ref|ZP_06188649.1| DNA ligase [Legionella longbeachae D-4968]
 gi|269988332|gb|EEZ94587.1| DNA ligase [Legionella longbeachae D-4968]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL  D  YDR    L  L+ Q PEL   D P   VG
Sbjct: 24  YYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSPTQRVG 65


>gi|317507336|ref|ZP_07965075.1| DNA ligase [Segniliparus rugosus ATCC BAA-974]
 gi|316254381|gb|EFV13712.1| DNA ligase [Segniliparus rugosus ATCC BAA-974]
          Length = 712

 Score = 40.4 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD+P  TD  +D +   L AL+++ PEL     P   VG
Sbjct: 25  HQFRYYVLDSPTVTDAEFDALLRELQALEDEHPELASASSPTKLVG 70


>gi|229843861|ref|ZP_04464002.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 6P18H1]
 gi|229812855|gb|EEP48543.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 6P18H1]
          Length = 670

 Score = 40.4 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   KINNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|228476991|ref|ZP_04061629.1| DNA ligase, NAD-dependent [Streptococcus salivarius SK126]
 gi|228251010|gb|EEK10181.1| DNA ligase, NAD-dependent [Streptococcus salivarius SK126]
          Length = 652

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E +VK+   + K YY  DNP  +D  YD++   L AL+ ++PE    D P + VG
Sbjct: 7   ELVVKLN-QYAKEYYTEDNPSVSDAEYDKLYRELVALEAEYPEYVQADSPTHRVG 60


>gi|328552313|gb|AEB22805.1| NAD-dependent DNA ligase LigA [Bacillus amyloliquefaciens TA208]
          Length = 668

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ PEL   D P   VG
Sbjct: 24  YYTLDEPSVPDSEYDRLMQELIAIEEEHPELRTPDSPTQRVG 65


>gi|308172548|ref|YP_003919253.1| DNA ligase [Bacillus amyloliquefaciens DSM 7]
 gi|307605412|emb|CBI41783.1| DNA ligase [Bacillus amyloliquefaciens DSM 7]
 gi|328910657|gb|AEB62253.1| DNA ligase [Bacillus amyloliquefaciens LL3]
          Length = 669

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ PEL   D P   VG
Sbjct: 25  YYTLDEPSVPDSEYDRLMQELIAIEEEHPELRTPDSPTQRVG 66


>gi|218289368|ref|ZP_03493602.1| DNA ligase, NAD-dependent [Alicyclobacillus acidocaldarius LAA1]
 gi|218240474|gb|EED07655.1| DNA ligase, NAD-dependent [Alicyclobacillus acidocaldarius LAA1]
          Length = 684

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 34/67 (50%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           ++LS  EA    + L +   +H + YY  DNP  +D  +D +   L  L+ ++PEL D  
Sbjct: 8   SALSLEEARARAKVLREQIEYHNRKYYLEDNPEISDAEWDALMRDLIELERKYPELVDPA 67

Query: 112 HPWNTVG 118
            P   VG
Sbjct: 68  SPTQRVG 74


>gi|9107768|gb|AAF85353.1|AE004063_2 DNA ligase [Xylella fastidiosa 9a5c]
          Length = 837

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 30  YHVLDQPRIPDADYDRMLRELDALEAAYPDLATPDSPTQRVGH 72


>gi|77747612|ref|NP_299833.2| NAD-dependent DNA ligase LigA [Xylella fastidiosa 9a5c]
 gi|166216281|sp|Q9PAG2|DNLJ_XYLFA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 831

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 24  YHVLDQPRIPDADYDRMLRELDALEAAYPDLATPDSPTQRVGH 66


>gi|289165264|ref|YP_003455402.1| DNA ligase [Legionella longbeachae NSW150]
 gi|288858437|emb|CBJ12315.1| DNA ligase [Legionella longbeachae NSW150]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL  D  YDR    L  L+ Q PEL   D P   VG
Sbjct: 24  YYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSPTQRVG 65


>gi|188995252|ref|YP_001929504.1| DNA ligase [Porphyromonas gingivalis ATCC 33277]
 gi|254781390|sp|B2RKL2|DNLJ_PORG3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|188594932|dbj|BAG33907.1| DNA ligase [Porphyromonas gingivalis ATCC 33277]
          Length = 669

 Score = 40.4 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 32/58 (55%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + +E L +I   H+  YY L +P   D  YD + ++L+ L+ ++PE    D P + VG
Sbjct: 9   VRIEELRRILREHEYRYYVLSSPTIDDFEYDAMMKQLEELEREYPEWDSPDSPTHRVG 66


>gi|34540958|ref|NP_905437.1| DNA ligase, NAD-dependent [Porphyromonas gingivalis W83]
 gi|81417286|sp|Q7MV47|DNLJ_PORGI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|34397273|gb|AAQ66336.1| DNA ligase, NAD-dependent [Porphyromonas gingivalis W83]
          Length = 669

 Score = 40.4 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 32/58 (55%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + +E L +I   H+  YY L +P   D  YD + ++L+ L+ ++PE    D P + VG
Sbjct: 9   VRIEELRRILREHEYRYYVLSSPTIDDFEYDAMMKQLEELEREYPEWDSPDSPTHRVG 66


>gi|207092489|ref|ZP_03240276.1| NAD-dependent DNA ligase LigA [Helicobacter pylori HPKX_438_AG0C1]
          Length = 656

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPTQKVG 63


>gi|297626017|ref|YP_003687780.1| DNA ligase (NAD+) [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921782|emb|CBL56340.1| DNA ligase (NAD+) [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 764

 Score = 40.4 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LVK     Q+ YY  D P  TD LYD +   L  L+ ++P L   D P   VG
Sbjct: 35  LVKEIDDAQEAYYGRDKPFITDALYDELMLELQKLEAEYPSLRTPDSPTQRVG 87


>gi|28199807|ref|NP_780121.1| NAD-dependent DNA ligase LigA [Xylella fastidiosa Temecula1]
 gi|182682559|ref|YP_001830719.1| NAD-dependent DNA ligase LigA [Xylella fastidiosa M23]
 gi|81438262|sp|Q87A88|DNLJ_XYLFT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254782314|sp|B2I9S4|DNLJ_XYLF2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|28057928|gb|AAO29770.1| DNA ligase [Xylella fastidiosa Temecula1]
 gi|182632669|gb|ACB93445.1| DNA ligase, NAD-dependent [Xylella fastidiosa M23]
 gi|307578838|gb|ADN62807.1| NAD-dependent DNA ligase LigA [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 831

 Score = 40.4 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 24  YHVLDQPRIPDADYDRMLRELDALEATYPDLATPDSPTQRVGH 66


>gi|71898271|ref|ZP_00680445.1| NAD-dependent DNA ligase [Xylella fastidiosa Ann-1]
 gi|71732010|gb|EAO34067.1| NAD-dependent DNA ligase [Xylella fastidiosa Ann-1]
          Length = 831

 Score = 40.4 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 24  YHVLDQPRIPDADYDRMLRELDALEATYPDLATPDSPTQRVGH 66


>gi|71899829|ref|ZP_00681979.1| NAD-dependent DNA ligase [Xylella fastidiosa Ann-1]
 gi|254782317|sp|B0U5G7|DNLJ_XYLFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71730420|gb|EAO32501.1| NAD-dependent DNA ligase [Xylella fastidiosa Ann-1]
          Length = 831

 Score = 40.4 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 24  YHVLDQPRIPDADYDRMLRELDALEATYPDLATPDSPTQRVGH 66


>gi|71275191|ref|ZP_00651478.1| NAD-dependent DNA ligase [Xylella fastidiosa Dixon]
 gi|170731182|ref|YP_001776615.1| NAD-dependent DNA ligase LigA [Xylella fastidiosa M12]
 gi|71164000|gb|EAO13715.1| NAD-dependent DNA ligase [Xylella fastidiosa Dixon]
 gi|167965975|gb|ACA12985.1| DNA ligase (NAD(+)) [Xylella fastidiosa M12]
          Length = 837

 Score = 40.4 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   LDAL+  +P+L   D P   VG+
Sbjct: 30  YHVLDQPRIPDADYDRMLRELDALEATYPDLATPDSPTQRVGH 72


>gi|254422498|ref|ZP_05036216.1| DNA ligase, NAD-dependent [Synechococcus sp. PCC 7335]
 gi|196189987|gb|EDX84951.1| DNA ligase, NAD-dependent [Synechococcus sp. PCC 7335]
          Length = 694

 Score = 40.4 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YDR+   L  L++Q+P L   D P   VG
Sbjct: 40  YYVLDAPELPDSVYDRLYRELQTLEDQYPGLQTSDSPTQRVG 81


>gi|322513636|ref|ZP_08066733.1| NAD-dependent DNA ligase LigA [Actinobacillus ureae ATCC 25976]
 gi|322120561|gb|EFX92462.1| NAD-dependent DNA ligase LigA [Actinobacillus ureae ATCC 25976]
          Length = 681

 Score = 40.4 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L +    ++  Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   VG
Sbjct: 17  QLEALRQKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQRVG 73


>gi|145634259|ref|ZP_01789970.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae PittAA]
 gi|145268703|gb|EDK08696.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae PittAA]
          Length = 670

 Score = 40.4 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEFEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|331702040|ref|YP_004398999.1| DNA ligase [Lactobacillus buchneri NRRL B-30929]
 gi|329129383|gb|AEB73936.1| DNA ligase [Lactobacillus buchneri NRRL B-30929]
          Length = 675

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YD+  ++L AL+ QFP++   D P   VG
Sbjct: 29  YYTYDAPSVEDAVYDQTYQQLVALENQFPQIVTPDSPTQKVG 70


>gi|322831833|ref|YP_004211860.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
 gi|321167034|gb|ADW72733.1| DNA ligase, NAD-dependent [Rahnella sp. Y9602]
          Length = 673

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 17  HHEYQYHVLDAPEVPDAEYDRLMRELRELETAHPELVTADSPTQRVG 63


>gi|332523413|ref|ZP_08399665.1| DNA ligase (NAD+) [Streptococcus porcinus str. Jelinkova 176]
 gi|332314677|gb|EGJ27662.1| DNA ligase (NAD+) [Streptococcus porcinus str. Jelinkova 176]
          Length = 652

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L  +   +++ YY  DNP  +D  YD++   L AL+ ++PE   +D P   VG
Sbjct: 8   LTNLLNQYRQEYYTNDNPTVSDQEYDKLYHELLALETEYPEFIQKDSPTQGVG 60


>gi|309792382|ref|ZP_07686850.1| DNA ligase, NAD-dependent [Oscillochloris trichoides DG6]
 gi|308225603|gb|EFO79363.1| DNA ligase, NAD-dependent [Oscillochloris trichoides DG6]
          Length = 674

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ E +  +E L  +   H   YY LD+P  +D  YD +   L  L+   PEL   D P
Sbjct: 1   MAESELVQRIERLRALLREHNYRYYVLDDPNVSDAEYDALMRELRHLEATHPELCSPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|189490484|ref|YP_001957054.1| putative DNA ligase [Pseudomonas phage 201phi2-1]
 gi|164609549|gb|ABY63158.1| putative DNA ligase [Pseudomonas phage 201phi2-1]
          Length = 695

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           E + L K   H+   YY LD  +  D LYD++   L  L+++ PE    D P  TVG+
Sbjct: 6   EYDVLCKRIRHYNYMYYVLDISIIPDSLYDQLLISLKLLEKEHPEWVTRDSPTQTVGH 63


>gi|298736308|ref|YP_003728834.1| NAD-dependent DNA ligase LigA [Helicobacter pylori B8]
 gi|298355498|emb|CBI66370.1| NAD-dependent DNA ligase LigA [Helicobacter pylori B8]
          Length = 656

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPTQKVG 63


>gi|302537077|ref|ZP_07289419.1| DNA ligase, NAD-dependent [Streptomyces sp. C]
 gi|302445972|gb|EFL17788.1| DNA ligase, NAD-dependent [Streptomyces sp. C]
          Length = 736

 Score = 40.4 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D++   L+AL+EQ+PEL   D P   V 
Sbjct: 28  HRFRYYVNDQPVVSDAEFDQLLRSLEALEEQYPELRTPDSPTQKVA 73


>gi|20807100|ref|NP_622271.1| NAD-dependent DNA ligase [Thermoanaerobacter tengcongensis MB4]
 gi|81482513|sp|Q8RC42|DNLJ_THETN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|20515592|gb|AAM23875.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Thermoanaerobacter tengcongensis MB4]
          Length = 666

 Score = 40.4 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA   +E L +   +H   YY LD P  +D  YD +   L  L+E++PE    D P
Sbjct: 1   MDREEARKRIEELREKINYHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFKTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|312880304|ref|ZP_07740104.1| DNA ligase, NAD-dependent [Aminomonas paucivorans DSM 12260]
 gi|310783595|gb|EFQ23993.1| DNA ligase, NAD-dependent [Aminomonas paucivorans DSM 12260]
          Length = 696

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E   +I LH  + YY LD+P+  D  YD +   L +L+   P+L D D P   VG
Sbjct: 19  ELTEQIRLHDHR-YYVLDDPVLPDDAYDALLRELRSLERAHPDLADPDSPTGRVG 72


>gi|253689765|ref|YP_003018955.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756343|gb|ACT14419.1| DNA ligase, NAD-dependent [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 681

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + V  L ++  HH+  Y+  D P   D  YD++ + L AL+   PEL   D P   VG
Sbjct: 13  LRVAELRRVLRHHEYKYHVEDAPEIPDVEYDKLMQELKALEADHPELVTSDSPTQRVG 70


>gi|309812136|ref|ZP_07705894.1| DNA ligase (NAD+) [Dermacoccus sp. Ellin185]
 gi|308433823|gb|EFP57697.1| DNA ligase (NAD+) [Dermacoccus sp. Ellin185]
          Length = 770

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P  +DG YD +   L  ++E +PEL   + P   VG
Sbjct: 39  HQFAYYVKDAPTISDGEYDELLRELQGVEESYPELRSPESPTQRVG 84


>gi|332092973|gb|EGI98039.1| DNA ligase, NAD-dependent [Shigella boydii 3594-74]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELITPDSPTQRVG 63


>gi|320180401|gb|EFW55332.1| DNA ligase [Shigella boydii ATCC 9905]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELITPDSPTQRVG 63


>gi|82544871|ref|YP_408818.1| NAD-dependent DNA ligase LigA [Shigella boydii Sb227]
 gi|123741957|sp|Q31Y68|DNLJ_SHIBS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81246282|gb|ABB66990.1| DNA ligase [Shigella boydii Sb227]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELCELETKHPELITPDSPTQRVG 63


>gi|330502846|ref|YP_004379715.1| NAD-dependent DNA ligase LigA [Pseudomonas mendocina NK-01]
 gi|328917132|gb|AEB57963.1| NAD-dependent DNA ligase LigA [Pseudomonas mendocina NK-01]
          Length = 786

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 18  HNYRYYVLDEPSVPDAEYDRLFRELQALEAEHPELVTPESPTQRVG 63


>gi|307297347|ref|ZP_07577153.1| DNA ligase, NAD-dependent [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916607|gb|EFN46989.1| DNA ligase, NAD-dependent [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 665

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   ++ L K   +H   YY LD+P   D  YD +   L  L+EQ+PEL   D P   V
Sbjct: 6   EARKRIDELRKEIDYHAYRYYVLDDPEIPDSEYDNLLRTLIDLEEQYPELKTPDSPSIRV 65

Query: 118 G 118
           G
Sbjct: 66  G 66


>gi|146307768|ref|YP_001188233.1| NAD-dependent DNA ligase LigA [Pseudomonas mendocina ymp]
 gi|190359273|sp|A4XVY5|DNLJ_PSEMY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145575969|gb|ABP85501.1| DNA ligase, NAD-dependent [Pseudomonas mendocina ymp]
          Length = 786

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 18  HNYRYYVLDEPSVPDAEYDRLFRELQALEAEHPELVTPESPTQRVG 63


>gi|315606212|ref|ZP_07881239.1| DNA ligase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315312100|gb|EFU60190.1| DNA ligase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 777

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P  +D  YDR+   L+ ++E++P+L   D P  +VG
Sbjct: 30  YYDRDSPTISDADYDRMYRELEEIEERYPQLRGADSPTMSVG 71


>gi|145593768|ref|YP_001158065.1| DNA ligase, NAD-dependent [Salinispora tropica CNB-440]
 gi|190359283|sp|A4X487|DNLJ_SALTO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145303105|gb|ABP53687.1| DNA ligase, NAD-dependent [Salinispora tropica CNB-440]
          Length = 711

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +D  +D     L AL+ +FP L   D P   VG
Sbjct: 40  HQYRYYVLDAPTISDAAFDEQLRELAALEAEFPALRTPDSPTQRVG 85


>gi|32267302|ref|NP_861334.1| NAD-dependent DNA ligase LigA [Helicobacter hepaticus ATCC 51449]
 gi|81665265|sp|Q7VF74|DNLJ_HELHP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|32263355|gb|AAP78400.1| DNA ligase [Helicobacter hepaticus ATCC 51449]
          Length = 650

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  E   +V+ L K+A H    YY LD P+ TD  YD +  ++   +E+ P L D   P
Sbjct: 1   MTSQEYYTQVQILKKMAYH----YYVLDEPIATDEQYDSLYHQIVRFEEENPHLIDASSP 56

Query: 114 WNTVG 118
              VG
Sbjct: 57  TQRVG 61


>gi|119774653|ref|YP_927393.1| DNA ligase (NAD(+)) [Shewanella amazonensis SB2B]
 gi|166216239|sp|A1S5R7|DNLJ_SHEAM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119767153|gb|ABL99723.1| DNA ligase (NAD(+)) [Shewanella amazonensis SB2B]
          Length = 681

 Score = 40.4 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L      H   YY  D P   D  YDR+  +L AL+ ++P+  + D P   VG
Sbjct: 17  EIQRLTAEINRHNIAYYVQDAPSIPDAEYDRLMNQLKALEAEYPQFAEPDSPTQRVG 73


>gi|108563021|ref|YP_627337.1| NAD-dependent DNA ligase LigA [Helicobacter pylori HPAG1]
 gi|123246990|sp|Q1CTQ9|DNLJ_HELPH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|107836794|gb|ABF84663.1| DNA ligase [Helicobacter pylori HPAG1]
          Length = 656

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPSHIQANSPTQKVG 63


>gi|294054681|ref|YP_003548339.1| DNA ligase, NAD-dependent [Coraliomargarita akajimensis DSM 45221]
 gi|293614014|gb|ADE54169.1| DNA ligase, NAD-dependent [Coraliomargarita akajimensis DSM 45221]
          Length = 711

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY+   P   D  YDR+  RL AL+ Q PEL     P  TVG
Sbjct: 66  HDRLYYKKAQPEIDDQAYDRLKARLTALESQNPELDFGSSPTQTVG 111


>gi|254510866|ref|ZP_05122933.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium KLH11]
 gi|221534577|gb|EEE37565.1| DNA ligase, NAD-dependent [Rhodobacteraceae bacterium KLH11]
          Length = 750

 Score = 40.4 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           + K   V  L++ +A  E+  L    L   + Y+  D P  +DG YD +  R   ++ +F
Sbjct: 1   MSKTTAVADLTEEDAQQELARLAAELLRANQLYHAEDAPELSDGDYDALKRRNAEIEARF 60

Query: 105 PELFDEDHPWNTVG 118
           P+L   D P   VG
Sbjct: 61  PDLKRTDSPSEQVG 74


>gi|152965283|ref|YP_001361067.1| DNA ligase, NAD-dependent [Kineococcus radiotolerans SRS30216]
 gi|190359261|sp|A6W7L4|DNLJ_KINRD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151359800|gb|ABS02803.1| DNA ligase, NAD-dependent [Kineococcus radiotolerans SRS30216]
          Length = 696

 Score = 40.4 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +Y R  +PL +DG YD +   L AL+EQ P+L   D P  TVG
Sbjct: 31  YYVRNSSPL-SDGQYDALERELRALEEQHPQLRTPDSPTQTVG 72


>gi|261345310|ref|ZP_05972954.1| DNA ligase, NAD-dependent [Providencia rustigianii DSM 4541]
 gi|282566645|gb|EFB72180.1| DNA ligase, NAD-dependent [Providencia rustigianii DSM 4541]
          Length = 678

 Score = 40.0 bits (92), Expect = 0.093,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YD++ + L  L+ + PEL   D P   VG
Sbjct: 23  HHEYLYHVLDAPEIPDVEYDKLMQELKGLEAENPELITTDSPTQRVG 69


>gi|227328979|ref|ZP_03833003.1| NAD-dependent DNA ligase LigA [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 684

 Score = 40.0 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A + V  L ++  HH+  Y+  D P   D  YD++ + L +L+   PEL   D P   VG
Sbjct: 14  AALRVAELRRVLRHHEYKYHVEDAPEIPDVEYDKLMQELKSLEAAHPELVTSDSPTQRVG 73


>gi|50364975|ref|YP_053400.1| DNA ligase, polydeoxyribonucleotide synthase NAD+ [Mesoplasma
           florum L1]
 gi|81391966|sp|Q6F1V7|DNLJ_MESFL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|50363531|gb|AAT75516.1| DNA ligase, polydeoxyribonucleotide synthase NAD+ [Mesoplasma
           florum L1]
          Length = 666

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           K YY LDNP   D  YD+   +L  L+ QFPEL   D     VG
Sbjct: 22  KEYYVLDNPSVDDAEYDKTIHQLLDLENQFPELITSDSITQKVG 65


>gi|166364069|ref|YP_001656342.1| DNA ligase [Microcystis aeruginosa NIES-843]
 gi|254781371|sp|B0JTW2|DNLJ_MICAN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166086442|dbj|BAG01150.1| DNA ligase [Microcystis aeruginosa NIES-843]
          Length = 669

 Score = 40.0 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D +YD++   L+ +++++P+L   D P   VG
Sbjct: 25  YYVLDDPFIPDSVYDQLYRELEDIEKRYPQLITPDSPTQRVG 66


>gi|153853203|ref|ZP_01994612.1| hypothetical protein DORLON_00597 [Dorea longicatena DSM 13814]
 gi|149753989|gb|EDM63920.1| hypothetical protein DORLON_00597 [Dorea longicatena DSM 13814]
          Length = 692

 Score = 40.0 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 52  TSLSKGEAMI--EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           T   KG++M    ++ LVK    ++  YY  D PL +D  YDR+ ++L  L+EQ   +  
Sbjct: 19  TPQKKGDSMSIKRIKNLVKQLNEYRHAYYNQDAPLVSDAEYDRLFDKLKKLEEQTGFIL- 77

Query: 110 EDHPWNTVGY 119
            + P  TVGY
Sbjct: 78  SNSPTQTVGY 87


>gi|110634347|ref|YP_674555.1| DNA ligase, NAD-dependent [Mesorhizobium sp. BNC1]
 gi|123162160|sp|Q11GT5|DNLJ_MESSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110285331|gb|ABG63390.1| DNA ligase, NAD-dependent [Chelativorans sp. BNC1]
          Length = 703

 Score = 40.0 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 33/68 (48%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ +A  E+  L +    H + YY  D P  +D  YD +  R  A+++ FP L   
Sbjct: 8   VDELTEEQAKDELARLAQEIGRHDRLYYSEDAPEVSDAEYDALRRRNLAIEQAFPNLIRA 67

Query: 111 DHPWNTVG 118
           D P   +G
Sbjct: 68  DSPSKRIG 75


>gi|298492390|ref|YP_003722567.1| DNA ligase, NAD-dependent ['Nostoc azollae' 0708]
 gi|298234308|gb|ADI65444.1| DNA ligase, NAD-dependent ['Nostoc azollae' 0708]
          Length = 684

 Score = 40.0 bits (92), Expect = 0.096,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YDR+   L  L+ Q+P L   D P   VG
Sbjct: 25  YYVLDAPVMEDMVYDRLYRELQELETQYPYLVTPDSPTQRVG 66


>gi|75906538|ref|YP_320834.1| NAD-dependent DNA ligase LigA [Anabaena variabilis ATCC 29413]
 gi|123745307|sp|Q3MGE7|DNLJ_ANAVT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|75700263|gb|ABA19939.1| NAD-dependent DNA ligase [Anabaena variabilis ATCC 29413]
          Length = 676

 Score = 40.0 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L ++       YY LD P+  D +YD++   L  L+ Q PEL   D P   +G
Sbjct: 11  VEELRRLLQQASYAYYVLDAPVMEDAVYDQLYRELQQLEIQHPELVTPDSPTQRIG 66


>gi|194333271|ref|YP_002015131.1| DNA ligase, NAD-dependent [Prosthecochloris aestuarii DSM 271]
 gi|254781391|sp|B4S4Y6|DNLJ_PROA2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194311089|gb|ACF45484.1| DNA ligase, NAD-dependent [Prosthecochloris aestuarii DSM 271]
          Length = 675

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A+ E+  L      H   YY L  P  +D  +D+  ERL AL++ FP+L   D P
Sbjct: 1   MQRKDALKEIARLRDELNRHNYRYYVLAQPEISDYAFDQELERLIALEKAFPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|187477571|ref|YP_785595.1| DNA ligase [Bordetella avium 197N]
 gi|123752160|sp|Q2KUU5|DNLJ_BORA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115422157|emb|CAJ48681.1| DNA ligase [Bordetella avium 197N]
          Length = 695

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +IA H+ + YY  D P  TD  YD +   L AL+ Q PEL   D P   VG
Sbjct: 18  EIAQHNIR-YYVYDEPSITDADYDALMRELMALEAQHPELVTPDSPTQRVG 67


>gi|33866919|ref|NP_898478.1| NAD-dependent DNA ligase LigA [Synechococcus sp. WH 8102]
 gi|81573701|sp|Q7U3P1|DNLJ_SYNPX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33639520|emb|CAE08904.1| Putative DNA ligase [Synechococcus sp. WH 8102]
          Length = 679

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L+  A H    YY LD P+  D LYDR+   L  L++  P L   D P   VG
Sbjct: 10  ELRSLLNRAAHA---YYVLDAPVMEDTLYDRLYRELQQLEQADPSLLSADSPTQRVG 63


>gi|319655032|ref|ZP_08009103.1| DNA ligase [Bacillus sp. 2_A_57_CT2]
 gi|317393299|gb|EFV74066.1| DNA ligase [Bacillus sp. 2_A_57_CT2]
          Length = 668

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDR+   L  L+ QFPEL  ED P   VG
Sbjct: 24  YHVLDQPSVPDAEYDRLMRDLIELEGQFPELKTEDSPTQRVG 65


>gi|50122504|ref|YP_051671.1| NAD-dependent DNA ligase LigA [Pectobacterium atrosepticum
           SCRI1043]
 gi|81644069|sp|Q6D165|DNLJ_ERWCT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49613030|emb|CAG76481.1| DNA ligase [Pectobacterium atrosepticum SCRI1043]
          Length = 681

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + V  L ++  HH+  Y+  D P   D  YD++ + L AL+   PEL   D P   VG
Sbjct: 6   LRVAELRRVLRHHEYKYHVEDAPEIPDIEYDKLMQELKALEADHPELVTSDSPTQRVG 63


>gi|119961355|ref|YP_947208.1| DNA ligase, NAD-dependent [Arthrobacter aurescens TC1]
 gi|166215391|sp|A1R4P6|DNLJ_ARTAT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119948214|gb|ABM07125.1| DNA ligase, NAD-dependent [Arthrobacter aurescens TC1]
          Length = 768

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E L  +   ++  YY+ D+P  +D  +D +  RL+ L+   PEL   D P   VG
Sbjct: 36  EYEQLADLVRKYRYAYYQEDSPTVSDAEFDELYRRLEELEALHPELVSNDSPTQEVG 92


>gi|226365931|ref|YP_002783714.1| NAD-dependent DNA ligase LigA [Rhodococcus opacus B4]
 gi|254781403|sp|C1B1S4|DNLJ_RHOOB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226244421|dbj|BAH54769.1| NAD(+)-dependent DNA ligase [Rhodococcus opacus B4]
          Length = 697

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            HQ  YY  D P+ +DG +D +   L+ L+ Q+P+L   D P   VG
Sbjct: 29  QHQFRYYVRDAPIISDGEFDALLGELNDLENQYPDLRTPDSPTQLVG 75


>gi|217032016|ref|ZP_03437517.1| hypothetical protein HPB128_187g43 [Helicobacter pylori B128]
 gi|216946326|gb|EEC24932.1| hypothetical protein HPB128_187g43 [Helicobacter pylori B128]
          Length = 458

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPNSIQANSPTQKVG 63


>gi|327480472|gb|AEA83782.1| NAD-dependent DNA ligase LigA [Pseudomonas stutzeri DSM 4166]
          Length = 791

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 21  HNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPELVTPESPTQRVG 66


>gi|256822391|ref|YP_003146354.1| NAD-dependent DNA ligase [Kangiella koreensis DSM 16069]
 gi|256795930|gb|ACV26586.1| DNA ligase, NAD-dependent [Kangiella koreensis DSM 16069]
          Length = 667

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +HQ  YY LD+P   D  YDR+   L  ++ + PEL   D P   VG
Sbjct: 19  NHQ--YYVLDDPSVPDAEYDRLLRELQQIESEHPELISSDSPTQRVG 63


>gi|166216289|sp|A4VKN0|DNLJ_PSEU5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 788

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 21  HNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPELVTPESPTQRVG 66


>gi|146282220|ref|YP_001172373.1| NAD-dependent DNA ligase LigA [Pseudomonas stutzeri A1501]
 gi|145570425|gb|ABP79531.1| DNA ligase, NAD-dependent [Pseudomonas stutzeri A1501]
          Length = 802

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 35  HNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPELVTPESPTQRVG 80


>gi|116329958|ref|YP_799676.1| DNA ligase (NAD+) [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|122282269|sp|Q04W02|DNLJ_LEPBJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116123647|gb|ABJ74918.1| DNA ligase (NAD+) [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 681

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 45  LDKAKKV--TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQE 102
           + K KK    +LS+ EA   +  L     HHQ  YY  + P  +D  +D++ +RL  L+E
Sbjct: 1   MSKKKKTYQNTLSEKEAKKVIAKLADEIRHHQYLYYVKNQPEISDFDFDQLFKRLRDLEE 60

Query: 103 QFPELFDEDHPWNTVG 118
           +FP+  D + P   VG
Sbjct: 61  EFPQFKDLNSPTLVVG 76


>gi|331005395|ref|ZP_08328777.1| DNA ligase [gamma proteobacterium IMCC1989]
 gi|330420789|gb|EGG95073.1| DNA ligase [gamma proteobacterium IMCC1989]
          Length = 707

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 71  LHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +HH  + YY LDNP   D  YDR+   L  L+++ P     D P   VG
Sbjct: 45  IHHYSYQYYALDNPTIPDAEYDRLFLELQTLEKENPSYVTSDSPTQRVG 93


>gi|170746461|ref|YP_001752721.1| DNA ligase, NAD-dependent [Methylobacterium radiotolerans JCM 2831]
 gi|254781368|sp|B1M575|DNLJ_METRJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|170652983|gb|ACB22038.1| DNA ligase, NAD-dependent [Methylobacterium radiotolerans JCM 2831]
          Length = 810

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           L+  EA  E   L    L   + YY+ D P  +D  YDR+  RL+ ++ +FP+L
Sbjct: 13  LTAEEARAEYARLSDAILEADRLYYQEDAPEISDAEYDRLRRRLEDIEARFPDL 66


>gi|116329438|ref|YP_799158.1| DNA ligase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|122282782|sp|Q04XH0|DNLJ_LEPBL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116122182|gb|ABJ80225.1| DNA ligase (NAD+) (contains BRCT domain type II) [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
          Length = 681

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 45  LDKAKKV--TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQE 102
           + K KK    +LS+ EA   +  L     HHQ  YY  + P  +D  +D++ +RL  L+E
Sbjct: 1   MSKKKKTYQNTLSEKEAKKVIAKLADEIRHHQYLYYVKNQPEISDFDFDQLFKRLRDLEE 60

Query: 103 QFPELFDEDHPWNTVG 118
           +FP+  D + P   VG
Sbjct: 61  EFPQFKDLNSPTLVVG 76


>gi|297570387|ref|YP_003691731.1| DNA ligase, NAD-dependent [Desulfurivibrio alkaliphilus AHT2]
 gi|296926302|gb|ADH87112.1| DNA ligase, NAD-dependent [Desulfurivibrio alkaliphilus AHT2]
          Length = 680

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 31/64 (48%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           +K +A   V  L +   +H   YY LD+P   D  YD +   L  L+E++P L   D P 
Sbjct: 10  AKEQARQRVAELREQIRYHNHRYYVLDDPEIPDAEYDALFRELQELEERYPGLAGADSPS 69

Query: 115 NTVG 118
             VG
Sbjct: 70  RQVG 73


>gi|15645240|ref|NP_207410.1| NAD-dependent DNA ligase LigA [Helicobacter pylori 26695]
 gi|3182983|sp|O25336|DNLJ_HELPY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|2313737|gb|AAD07680.1| DNA ligase (lig) [Helicobacter pylori 26695]
          Length = 656

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDEPIVSDAIYDELYQELKAYEEKNPNGIQANSPTQKVG 63


>gi|312882689|ref|ZP_07742426.1| NAD-dependent DNA ligase LigA [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369650|gb|EFP97165.1| NAD-dependent DNA ligase LigA [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 670

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 29/61 (47%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   ++ +L ++   H   YY  DNP   D  YDR+   L  L+ Q PEL   D P   V
Sbjct: 4   EIETKLNHLRQLLHSHGIKYYVEDNPQIPDSEYDRLMRELLELESQHPELVSLDSPTQRV 63

Query: 118 G 118
           G
Sbjct: 64  G 64


>gi|217970592|ref|YP_002355826.1| DNA ligase, NAD-dependent [Thauera sp. MZ1T]
 gi|217507919|gb|ACK54930.1| DNA ligase, NAD-dependent [Thauera sp. MZ1T]
          Length = 693

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L A++  +P L   D P   VG
Sbjct: 30  HDHAYYVLDAPTIPDAEYDRLFRELQAIERAYPALRSADSPTQRVG 75


>gi|325274411|ref|ZP_08140498.1| NAD-dependent DNA ligase LigA [Pseudomonas sp. TJI-51]
 gi|324100446|gb|EGB98205.1| NAD-dependent DNA ligase LigA [Pseudomonas sp. TJI-51]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|313497885|gb|ADR59251.1| LigA [Pseudomonas putida BIRD-1]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|218509214|ref|ZP_03507092.1| NAD-dependent DNA ligase LigA [Rhizobium etli Brasil 5]
          Length = 202

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   Y   D    +D  YD +  R DAL+ +FPEL  ED P   VG
Sbjct: 10  HHDALYQGKDQREISDADYDALKRRNDALEVRFPELIREDSPSRHVG 56


>gi|148546832|ref|YP_001266934.1| NAD-dependent DNA ligase LigA [Pseudomonas putida F1]
 gi|190359274|sp|A5W0U0|DNLJ_PSEP1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148510890|gb|ABQ77750.1| DNA ligase, NAD-dependent [Pseudomonas putida F1]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|167034833|ref|YP_001670064.1| NAD-dependent DNA ligase LigA [Pseudomonas putida GB-1]
 gi|190359275|sp|B0KPX3|DNLJ_PSEPG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166861321|gb|ABY99728.1| DNA ligase, NAD-dependent [Pseudomonas putida GB-1]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|170722763|ref|YP_001750451.1| NAD-dependent DNA ligase LigA [Pseudomonas putida W619]
 gi|254781396|sp|B1JC06|DNLJ_PSEPW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169760766|gb|ACA74082.1| DNA ligase, NAD-dependent [Pseudomonas putida W619]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|26990965|ref|NP_746390.1| NAD-dependent DNA ligase LigA [Pseudomonas putida KT2440]
 gi|81439923|sp|Q88F25|DNLJ_PSEPK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24985989|gb|AAN69854.1|AE016624_5 DNA ligase, NAD-dependent [Pseudomonas putida KT2440]
          Length = 776

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 16  QHNYRYYVLDEPSVPDAEYDRLFNELKALEAEHPHLVTPDSPTQRVG 62


>gi|257125939|ref|YP_003164053.1| DNA ligase, NAD-dependent [Leptotrichia buccalis C-1013-b]
 gi|257049878|gb|ACV39062.1| DNA ligase, NAD-dependent [Leptotrichia buccalis C-1013-b]
          Length = 706

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD--EDHPWNTVG 118
           +H   YY  DNP+ +D  YD +   L  L++++PEL +  E+ P   +G
Sbjct: 39  YHNNLYYNEDNPIISDMEYDALMRELKQLEQEYPELLENSENSPTKKIG 87


>gi|21231024|ref|NP_636941.1| NAD-dependent DNA ligase LigA [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768971|ref|YP_243733.1| NAD-dependent DNA ligase LigA [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992085|ref|YP_001904095.1| NAD-dependent DNA ligase LigA [Xanthomonas campestris pv.
           campestris str. B100]
 gi|81305065|sp|Q4UTB0|DNLJ_XANC8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81794799|sp|Q8PAB5|DNLJ_XANCP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254782312|sp|B0RUY2|DNLJ_XANCB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|21112648|gb|AAM40865.1| DNA ligase [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66574303|gb|AAY49713.1| DNA ligase [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733845|emb|CAP52051.1| DNA ligase (NAD(+)) [Xanthomonas campestris pv. campestris]
          Length = 833

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   L+AL+   PEL   D P   VGY
Sbjct: 25  YHVLDEPQIADVEYDRLLRELEALEAAHPELATADSPTQRVGY 67


>gi|86605509|ref|YP_474272.1| DNA ligase, NAD-dependent [Synechococcus sp. JA-3-3Ab]
 gi|123765626|sp|Q2JW63|DNLJ_SYNJA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86554051|gb|ABC99009.1| DNA ligase, NAD-dependent [Synechococcus sp. JA-3-3Ab]
          Length = 673

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YDR+   L  L+  +PEL   D P   VG
Sbjct: 23  YYVHDAPILEDSVYDRLYRELQELERAYPELITPDSPTQRVG 64


>gi|120602092|ref|YP_966492.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris DP4]
 gi|166215378|sp|A1VC99|DNLJ1_DESVV RecName: Full=DNA ligase 1; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 1
 gi|120562321|gb|ABM28065.1| DNA ligase, NAD-dependent [Desulfovibrio vulgaris DP4]
          Length = 680

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY LD P  +D  YD +   L  L+  +P L DE  P   VG
Sbjct: 21  HNRLYYELDTPEISDAEYDTLYRELVNLETLWPALMDEASPTQRVG 66


>gi|307609752|emb|CBW99264.1| DNA ligase [Legionella pneumophila 130b]
          Length = 650

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|289663144|ref|ZP_06484725.1| NAD-dependent DNA ligase LigA [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 833

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   L+AL+ ++P+L   D P   VG+
Sbjct: 25  YHVLDEPQMADVDYDRLMRELEALEAEYPQLASADSPTQRVGH 67


>gi|254430924|ref|ZP_05044627.1| DNA ligase, NAD-dependent [Cyanobium sp. PCC 7001]
 gi|197625377|gb|EDY37936.1| DNA ligase, NAD-dependent [Cyanobium sp. PCC 7001]
          Length = 667

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L+  A H    YY LD P+  D +YDR+   L  L++  PEL   D P   VG
Sbjct: 14  ELQRLLTQAAHA---YYVLDAPVMEDPVYDRLYRELLELEQAHPELIRPDSPTQRVG 67


>gi|220931078|ref|YP_002507986.1| DNA ligase, NAD-dependent [Halothermothrix orenii H 168]
 gi|254781343|sp|B8D122|DNLJ_HALOH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219992388|gb|ACL68991.1| DNA ligase, NAD-dependent [Halothermothrix orenii H 168]
          Length = 670

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L +   +H+  YY LD+P  +D  +D + +RL  L+E+ P L   D P   VG
Sbjct: 8   EIRDLREKIRYHEYRYYVLDDPEISDAEFDELIQRLIDLEEKHPGLVTPDSPTQRVG 64


>gi|332141273|ref|YP_004427011.1| NAD-dependent DNA ligase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551295|gb|AEA98013.1| NAD-dependent DNA ligase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 171

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D +YDR  + L AL++Q+P L   + P   VG
Sbjct: 26  YYVLDDPSIPDAVYDRDMQSLIALEKQYPSLQSPNSPSQKVG 67


>gi|150021387|ref|YP_001306741.1| DNA ligase, NAD-dependent [Thermosipho melanesiensis BI429]
 gi|190359297|sp|A6LN55|DNLJ_THEM4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|149793908|gb|ABR31356.1| DNA ligase, NAD-dependent [Thermosipho melanesiensis BI429]
          Length = 662

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L K   +H   YY L +P+ +D  YDR+ ++L  L++++P+    + P   VG
Sbjct: 7   EIERLRKEIEYHNYRYYVLADPIISDEEYDRLLKKLIELEKKYPKFSSPNSPTQKVG 63


>gi|78185772|ref|YP_378206.1| NAD-dependent DNA ligase LigA [Synechococcus sp. CC9902]
 gi|123743489|sp|Q3AUH7|DNLJ_SYNS9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78170066|gb|ABB27163.1| DNA ligase (NAD+) [Synechococcus sp. CC9902]
          Length = 680

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           + E   E+  L+  A H    YY LD P   D +YDR+ + L  L++  P L   D P  
Sbjct: 4   QSERATELRNLLNTAAHA---YYVLDTPTMEDAVYDRLYQELLELEQNTPSLKTADSPTQ 60

Query: 116 TVG 118
            VG
Sbjct: 61  RVG 63


>gi|114319842|ref|YP_741525.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312282|sp|Q0AAV2|DNLJ_ALHEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114226236|gb|ABI56035.1| DNA ligase, NAD-dependent [Alkalilimnicola ehrlichii MLHE-1]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 26/56 (46%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L +    H   YY LD P+  D  YD +   L AL+ + PEL   D P   V 
Sbjct: 12  IEALRREIREHDHRYYVLDAPVIADAEYDALMAELQALEAEHPELITPDSPSQRVA 67


>gi|17546117|ref|NP_519519.1| DNA ligase (polydeoxyribonucleotide synthase [NAD+]) protein
           [Ralstonia solanacearum GMI1000]
 gi|81505313|sp|Q8XZJ7|DNLJ_RALSO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|17428413|emb|CAD15100.1| putative dna ligase (polydeoxyribonucleotide synthase [nad+])
           protein [Ralstonia solanacearum GMI1000]
          Length = 813

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEAEHPELRTPDSPTLRVG 72


>gi|323697702|ref|ZP_08109614.1| DNA ligase, NAD-dependent [Desulfovibrio sp. ND132]
 gi|323457634|gb|EGB13499.1| DNA ligase, NAD-dependent [Desulfovibrio desulfuricans ND132]
          Length = 684

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD+P  +D  +D +   L AL+ + PEL D + P   VG
Sbjct: 19  HHNYRYYVLDDPEISDQEFDVLFRELAALEAEHPELDDPNSPTRRVG 65


>gi|46143448|ref|ZP_00135242.2| COG0272: NAD-dependent DNA ligase (contains BRCT domain type II)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208768|ref|YP_001053993.1| NAD-dependent DNA ligase LigA [Actinobacillus pleuropneumoniae L20]
 gi|166215385|sp|A3N1V2|DNLJ_ACTP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126097560|gb|ABN74388.1| DNA ligase [Actinobacillus pleuropneumoniae serovar 5b str. L20]
          Length = 683

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L +    ++  Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   VG
Sbjct: 18  QLEALRQKLREYEYHYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITVDSPTQRVG 74


>gi|119512036|ref|ZP_01631131.1| DNA ligase [Nodularia spumigena CCY9414]
 gi|119463326|gb|EAW44268.1| DNA ligase [Nodularia spumigena CCY9414]
          Length = 678

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L ++       YY LD P+  D +YD++   L  L+ ++PE    D P   VG
Sbjct: 11  VEELRQLLQQASYAYYVLDAPMMEDAVYDQLYRELQELEIKYPEFITPDSPTQRVG 66


>gi|54293931|ref|YP_126346.1| DNA ligase [Legionella pneumophila str. Lens]
 gi|81368949|sp|Q5WXV3|DNLJ_LEGPL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|53753763|emb|CAH15221.1| DNA ligase [Legionella pneumophila str. Lens]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|329297490|ref|ZP_08254826.1| NAD-dependent DNA ligase LigA [Plautia stali symbiont]
          Length = 672

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 17  HHEYLYHVMDTPEIPDAEYDRLMRELRELESAHPDLITPDSPTQRVG 63


>gi|108759370|ref|YP_633776.1| NAD-dependent DNA ligase [Myxococcus xanthus DK 1622]
 gi|123074067|sp|Q1D0P7|DNLJ_MYXXD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|108463250|gb|ABF88435.1| DNA ligase, NAD-dependent [Myxococcus xanthus DK 1622]
          Length = 672

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD+P  +D  YD++   L  L+ + P L   D P   VG
Sbjct: 20  HHNYRYYVLDSPEVSDAQYDKLMRELQDLEAKHPSLQTPDSPTQRVG 66


>gi|67920947|ref|ZP_00514466.1| NAD-dependent DNA ligase [Crocosphaera watsonii WH 8501]
 gi|67857064|gb|EAM52304.1| NAD-dependent DNA ligase [Crocosphaera watsonii WH 8501]
          Length = 670

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP+  D +YD++   LD L+++   L   D P   VG
Sbjct: 20  YYVLDNPIMEDAVYDQLYRELDTLEKENTHLITSDSPTQRVG 61


>gi|331663971|ref|ZP_08364881.1| DNA ligase, NAD-dependent [Escherichia coli TA143]
 gi|331059770|gb|EGI31747.1| DNA ligase, NAD-dependent [Escherichia coli TA143]
          Length = 671

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|300897228|ref|ZP_07115672.1| DNA ligase, NAD-dependent [Escherichia coli MS 198-1]
 gi|300358986|gb|EFJ74856.1| DNA ligase, NAD-dependent [Escherichia coli MS 198-1]
          Length = 671

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|218705919|ref|YP_002413438.1| NAD-dependent DNA ligase LigA [Escherichia coli UMN026]
 gi|293405854|ref|ZP_06649846.1| DNA ligase [Escherichia coli FVEC1412]
 gi|298381604|ref|ZP_06991203.1| DNA ligase [Escherichia coli FVEC1302]
 gi|254781326|sp|B7N602|DNLJ_ECOLU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218433016|emb|CAR13911.1| DNA ligase, NAD(+)-dependent [Escherichia coli UMN026]
 gi|284922366|emb|CBG35453.1| DNA ligase [Escherichia coli 042]
 gi|291428062|gb|EFF01089.1| DNA ligase [Escherichia coli FVEC1412]
 gi|298279046|gb|EFI20560.1| DNA ligase [Escherichia coli FVEC1302]
          Length = 671

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDVEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|166215832|sp|Q5ZWX6|DNLJ_LEGPH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|148360390|ref|YP_001251597.1| DNA ligase [Legionella pneumophila str. Corby]
 gi|166215817|sp|A5IFV1|DNLJ_LEGPC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|148282163|gb|ABQ56251.1| DNA ligase [Legionella pneumophila str. Corby]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|54296979|ref|YP_123348.1| DNA ligase [Legionella pneumophila str. Paris]
 gi|81370862|sp|Q5X6E6|DNLJ_LEGPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|53750764|emb|CAH12171.1| DNA ligase [Legionella pneumophila str. Paris]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|296106543|ref|YP_003618243.1| DNA ligase (NAD ) [Legionella pneumophila 2300/99 Alcoy]
 gi|295648444|gb|ADG24291.1| DNA ligase (NAD ) [Legionella pneumophila 2300/99 Alcoy]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 24  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 64


>gi|269792727|ref|YP_003317631.1| DNA ligase, NAD-dependent [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100362|gb|ACZ19349.1| DNA ligase, NAD-dependent [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  A   +E L ++  HH + YY+ ++P  TD  YD +   L  L+  FP+L   D P
Sbjct: 1   MDRSAARSRMEELAELIRHHDRLYYQENSPEITDQEYDALFRELVDLERSFPDLRLPDSP 60


>gi|226941791|ref|YP_002796865.1| DnlJ [Laribacter hongkongensis HLHK9]
 gi|254781355|sp|C1D4R5|DNLJ_LARHH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226716718|gb|ACO75856.1| DnlJ [Laribacter hongkongensis HLHK9]
          Length = 692

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 24  YYVLDAPSVPDAEYDRLFRELEALEAAHPELASADSPTRRVG 65


>gi|119503165|ref|ZP_01625249.1| DNA ligase (NAD+) [marine gamma proteobacterium HTCC2080]
 gi|119460811|gb|EAW41902.1| DNA ligase (NAD+) [marine gamma proteobacterium HTCC2080]
          Length = 673

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YYR D P  +D  YDR    L  L+++FP L   D P   VG
Sbjct: 24  YYRNDAPTVSDSEYDRTLLALRELEQKFPHLVSADSPTQRVG 65


>gi|86608809|ref|YP_477571.1| DNA ligase, NAD-dependent [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123724461|sp|Q2JLU3|DNLJ_SYNJB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|86557351|gb|ABD02308.1| DNA ligase, NAD-dependent [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 686

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YDR+   L  L+  +PEL   D P   VG
Sbjct: 23  YYVHDAPILEDSVYDRLYRELQELERAYPELVTPDSPTQRVG 64


>gi|199597353|ref|ZP_03210784.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus HN001]
 gi|199591869|gb|EDY99944.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus HN001]
          Length = 674

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 31/71 (43%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           +K     +  EA  EV  L K     +  YY  D P  TD +YD     L AL+  FP+L
Sbjct: 3   SKPAAQFTLEEAEAEVAKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEAAFPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQQVG 73


>gi|257054924|ref|YP_003132756.1| NAD-dependent DNA ligase LigA [Saccharomonospora viridis DSM 43017]
 gi|256584796|gb|ACU95929.1| DNA ligase, NAD-dependent [Saccharomonospora viridis DSM 43017]
          Length = 731

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +D  +D++   L+ L+ + P L   D P  TVG
Sbjct: 60  HQFRYYVLDAPTISDAEFDQLMRDLERLEAEHPALVSPDSPTQTVG 105


>gi|313201136|ref|YP_004039794.1| DNA ligase, nad-dependent [Methylovorus sp. MP688]
 gi|312440452|gb|ADQ84558.1| DNA ligase, NAD-dependent [Methylovorus sp. MP688]
          Length = 689

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P   D  YD++   L AL+   PEL   D P   VG
Sbjct: 32  YYVLDDPSVPDSEYDKLFRELQALEHAHPELLTPDSPTQRVG 73


>gi|303252067|ref|ZP_07338236.1| truncated NAD-dependent DNA ligase LigA [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649049|gb|EFL79236.1| truncated NAD-dependent DNA ligase LigA [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 451

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           G    ++E L +    ++ +Y+ LDNPL  D  YDR+   L  L+ Q PE    D P   
Sbjct: 12  GTTFAQLEALRQKLREYEYYYHVLDNPLVPDAEYDRLMNELKNLEWQHPEWITADSPTQR 71

Query: 117 VG 118
           VG
Sbjct: 72  VG 73


>gi|284042834|ref|YP_003393174.1| DNA ligase, NAD-dependent [Conexibacter woesei DSM 14684]
 gi|283947055|gb|ADB49799.1| DNA ligase, NAD-dependent [Conexibacter woesei DSM 14684]
          Length = 684

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD+P   D  YD + + L AL+   PEL   D P   VG
Sbjct: 19  YHGHRYYDLDDPEIGDDAYDALLDELRALEAAHPELLTPDSPTQRVG 65


>gi|86157121|ref|YP_463906.1| DNA ligase, NAD-dependent [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123723230|sp|Q2INT9|DNLJ_ANADE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|85773632|gb|ABC80469.1| DNA ligase, NAD-dependent [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 687

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P+  D  YDR+   L A++ + PEL   D P   V
Sbjct: 24  YYVLDQPVLADAEYDRLMHELQAIEAEHPELVTADSPTQRV 64


>gi|327475239|gb|AEA77214.1| DNA ligase [Bacillus sp. 15.4]
          Length = 668

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDRV   L A++ +FPEL   D P   VG
Sbjct: 24  YHVLDKPSVPDAEYDRVMNELIAIENKFPELRTADSPTQRVG 65


>gi|212638096|ref|YP_002314616.1| NAD-dependent DNA ligase LigA [Anoxybacillus flavithermus WK1]
 gi|254781544|sp|B7GFV1|DNLJ_ANOFW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212559576|gb|ACJ32631.1| NAD-dependent DNA ligase [Anoxybacillus flavithermus WK1]
          Length = 672

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  +D  YD +  +L  L+EQ+P+    D P   VG
Sbjct: 23  HNYAYYVLDQPSISDAEYDELMRKLMELEEQYPQYKTPDSPSQRVG 68


>gi|52841193|ref|YP_094992.1| DNA ligase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628304|gb|AAU27045.1| DNA ligase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 683

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD PL  D  YDR  + L   +EQ+P+    D P   V
Sbjct: 34  YYVLDEPLVPDAEYDRCFKALQQYEEQYPQFLSPDSPTQRV 74


>gi|212634787|ref|YP_002311312.1| NAD-dependent DNA ligase [Shewanella piezotolerans WP3]
 gi|254781417|sp|B8CN91|DNLJ_SHEPW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212556271|gb|ACJ28725.1| NAD-dependent DNA ligase [Shewanella piezotolerans WP3]
          Length = 668

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  DNP   D  YDR+ +RL  L+ Q PE    D P   VG
Sbjct: 18  HNYHYYVDDNPTIPDVEYDRLLKRLIELETQSPEFAKADSPTQRVG 63


>gi|159036755|ref|YP_001536008.1| DNA ligase, NAD-dependent [Salinispora arenicola CNS-205]
 gi|190359280|sp|A8M5E3|DNLJ_SALAI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157915590|gb|ABV97017.1| DNA ligase, NAD-dependent [Salinispora arenicola CNS-205]
          Length = 710

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +D  +D     L AL+ +FP L   D P   VG
Sbjct: 39  HQYRYYVLDAPTISDAEFDERLRELAALEAEFPALRTPDSPTQRVG 84


>gi|119898292|ref|YP_933505.1| DNA ligase (NAD+) [Azoarcus sp. BH72]
 gi|166215393|sp|A1K713|DNLJ_AZOSB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119670705|emb|CAL94618.1| DNA ligase (NAD+) [Azoarcus sp. BH72]
          Length = 693

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L  ++   PEL   D P   VG
Sbjct: 21  HNHAYYVLDTPTIPDAEYDRLFRELQDIEAAHPELLTPDSPTQRVG 66


>gi|111023430|ref|YP_706402.1| NAD-dependent DNA ligase LigA [Rhodococcus jostii RHA1]
 gi|123045472|sp|Q0S2J2|DNLJ_RHOSR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110822960|gb|ABG98244.1| DNA ligase (NAD+) [Rhodococcus jostii RHA1]
          Length = 696

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            HQ  YY  D P+ +DG +D +   L+ L+ Q+P+L   D P   VG
Sbjct: 28  QHQFRYYVRDAPIISDGEFDVLLGELNDLENQYPDLRTPDSPTQLVG 74


>gi|238020272|ref|ZP_04600698.1| hypothetical protein GCWU000324_00147 [Kingella oralis ATCC 51147]
 gi|237868666|gb|EEP69670.1| hypothetical protein GCWU000324_00147 [Kingella oralis ATCC 51147]
          Length = 797

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ ++P+    + P N VG
Sbjct: 41  YYTLDAPTVPDSEYDRLYRELEALETEYPQFRLPESPTNRVG 82


>gi|319638552|ref|ZP_07993314.1| DNA ligase [Neisseria mucosa C102]
 gi|317400301|gb|EFV80960.1| DNA ligase [Neisseria mucosa C102]
          Length = 822

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++YL  +   +   YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 8   IKYLTDLLNRYAYEYYTLDAPSVPDAEYDKLFRELEALERNHPELKLPDSPTQRVG 63


>gi|226945096|ref|YP_002800169.1| NAD-dependent DNA ligase LigA [Azotobacter vinelandii DJ]
 gi|254781546|sp|C1DN27|DNLJ_AZOVD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226720023|gb|ACO79194.1| DNA ligase, NAD-dependent [Azotobacter vinelandii DJ]
          Length = 784

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + PEL   + P   VG
Sbjct: 21  HNYRYYVLDAPSVPDAEYDRLFNELKALEAEHPELVTPESPTQRVG 66


>gi|320540519|ref|ZP_08040169.1| DNA ligase, NAD(+)-dependent [Serratia symbiotica str. Tucson]
 gi|320029450|gb|EFW11479.1| DNA ligase, NAD(+)-dependent [Serratia symbiotica str. Tucson]
          Length = 685

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 17  HHEYQYHVLDAPEVPDAEYDRLMCELRELESAHPELITADSPTQRVG 63


>gi|311694426|gb|ADP97299.1| NAD-dependent DNA ligase [marine bacterium HP15]
          Length = 678

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 26/56 (46%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L      H   YY LD+P   D  YDR+   L  L+  +PEL  +  P   VG
Sbjct: 12  VEELRSAIDDHNYRYYVLDDPRVPDAEYDRLFRELQGLETDYPELASDTSPTRRVG 67


>gi|288941063|ref|YP_003443303.1| DNA ligase, NAD-dependent [Allochromatium vinosum DSM 180]
 gi|288896435|gb|ADC62271.1| DNA ligase, NAD-dependent [Allochromatium vinosum DSM 180]
          Length = 696

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD+P   D  YDR+   L  L+ + P L   D P   VG
Sbjct: 19  YHNHRYYVLDDPEIPDAEYDRLFAELQQLEAEHPALITPDSPTQRVG 65


>gi|157961514|ref|YP_001501548.1| DNA ligase, NAD-dependent [Shewanella pealeana ATCC 700345]
 gi|190359287|sp|A8H376|DNLJ_SHEPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157846514|gb|ABV87013.1| DNA ligase, NAD-dependent [Shewanella pealeana ATCC 700345]
          Length = 668

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L      H   YY  D+P   D  YDR+  RL AL+ + PE    D P   VG
Sbjct: 7   EIAQLTAELNQHNYRYYVDDSPSIPDAEYDRLLNRLKALETEHPEFCRPDSPTQRVG 63


>gi|225013054|ref|ZP_03703469.1| DNA ligase (NAD(+)) [Flavobacteria bacterium MS024-2A]
 gi|225002782|gb|EEG40763.1| DNA ligase (NAD(+)) [Flavobacteria bacterium MS024-2A]
          Length = 183

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L ++   H   YY LD+P+ +D  +D++ ++L+ L+ Q P+L D + P   VG
Sbjct: 7   KIEALREVLHDHNHRYYILDDPIISDYEFDQLLQQLNELEVQNPDLTDLNSPTRRVG 63


>gi|312144161|ref|YP_003995607.1| DNA ligase, NAD-dependent [Halanaerobium sp. 'sapolanicus']
 gi|311904812|gb|ADQ15253.1| DNA ligase, NAD-dependent [Halanaerobium sp. 'sapolanicus']
          Length = 670

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD+P  +D  +D++ + L  L+ QFPEL   D P   VG
Sbjct: 27  YFVLDDPQISDAEFDKLMQDLLKLESQFPELVTADSPTQRVG 68


>gi|332755050|gb|EGJ85415.1| DNA ligase domain protein [Shigella flexneri 4343-70]
          Length = 256

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 71  LHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 16  CHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|149183793|ref|ZP_01862194.1| NAD-dependent DNA ligase LigA [Bacillus sp. SG-1]
 gi|148848496|gb|EDL62745.1| NAD-dependent DNA ligase LigA [Bacillus sp. SG-1]
          Length = 668

 Score = 39.7 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDRV   L A++ +FPEL   D P   VG
Sbjct: 24  YHVLDKPSVPDAEYDRVMNELIAIETEFPELRTPDSPTQRVG 65


>gi|15965917|ref|NP_386270.1| NAD-dependent DNA ligase LigA [Sinorhizobium meliloti 1021]
 gi|307308227|ref|ZP_07587936.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
 gi|307319694|ref|ZP_07599119.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|81634276|sp|Q92NM8|DNLJ_RHIME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15075186|emb|CAC46743.1| Probable DNA ligase [Sinorhizobium meliloti 1021]
 gi|306894625|gb|EFN25386.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti AK83]
 gi|306901225|gb|EFN31831.1| DNA ligase, NAD-dependent [Sinorhizobium meliloti BL225C]
          Length = 717

 Score = 39.7 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 38/74 (51%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L++ K V  L++ EA  E+ +L      H   Y+  D P  +D  YD +  R D ++E+F
Sbjct: 2   LNQRKSVEQLNEAEAAEELAFLAAELARHDMLYHGKDAPEISDADYDALKRRNDLIEERF 61

Query: 105 PELFDEDHPWNTVG 118
           P L  ED P   VG
Sbjct: 62  PVLVREDSPSRKVG 75


>gi|323143662|ref|ZP_08078336.1| DNA ligase (NAD+) [Succinatimonas hippei YIT 12066]
 gi|322416595|gb|EFY07255.1| DNA ligase (NAD+) [Succinatimonas hippei YIT 12066]
          Length = 696

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  D+P+ TD  YDR+  +L+ +++  P +   D P   VG
Sbjct: 11  LVALLNRYAKAYYVDDDPIVTDSEYDRLYRQLEIMEQADPTIISPDSPTRRVG 63


>gi|320334549|ref|YP_004171260.1| DNA ligase [Deinococcus maricopensis DSM 21211]
 gi|319755838|gb|ADV67595.1| DNA ligase [Deinococcus maricopensis DSM 21211]
          Length = 671

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 60  MIEVEY--LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           M E  Y  L++   HH + YY  D P  +D  YD +   L A +   PE    + P   V
Sbjct: 1   MTEARYRELIQTIQHHNRLYYEQDTPEISDAEYDALMRELRAAEAAHPEWITPESPTQKV 60

Query: 118 G 118
           G
Sbjct: 61  G 61


>gi|170739961|ref|YP_001768616.1| DNA ligase, NAD-dependent [Methylobacterium sp. 4-46]
 gi|254781369|sp|B0UQ51|DNLJ_METS4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168194235|gb|ACA16182.1| DNA ligase, NAD-dependent [Methylobacterium sp. 4-46]
          Length = 827

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           H + Y+  D P+ +D  YD +  RL+A++E+FP+L
Sbjct: 31  HDRRYHGEDAPIISDAAYDSLRRRLEAIEERFPDL 65


>gi|299535244|ref|ZP_07048568.1| DNA ligase [Lysinibacillus fusiformis ZC1]
 gi|298729365|gb|EFI69916.1| DNA ligase [Lysinibacillus fusiformis ZC1]
          Length = 667

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++ + L AL+E  P L   D P   VG
Sbjct: 22  YYVLDKPVVADSVYDQLLQELIALEEANPSLIYPDSPTQRVG 63


>gi|311898479|dbj|BAJ30887.1| putative DNA ligase [Kitasatospora setae KM-6054]
          Length = 788

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 8/78 (10%)

Query: 41  LESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +E W D   +V +    E   E+E        H+  YY  D P+ TD  +D +   L+AL
Sbjct: 1   MEGWEDVPAEVRT-RHAELATEIE-------EHRSRYYEQDAPVVTDAEFDALMRELEAL 52

Query: 101 QEQFPELFDEDHPWNTVG 118
           +   P L   D P   VG
Sbjct: 53  EAAHPALATPDSPTRKVG 70


>gi|332299534|ref|YP_004441455.1| DNA ligase [Porphyromonas asaccharolytica DSM 20707]
 gi|332176597|gb|AEE12287.1| DNA ligase [Porphyromonas asaccharolytica DSM 20707]
          Length = 679

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++    +E+E L      H + YY  + P  +D  YD + +RL  L+ + PEL D   P
Sbjct: 1   MTRNNTELEIEQLRTTIEQHNRAYYLDNAPTISDADYDALMQRLLTLEAEHPELADPTSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SLRVG 65


>gi|313886637|ref|ZP_07820349.1| DNA ligase (NAD+) [Porphyromonas asaccharolytica PR426713P-I]
 gi|312923933|gb|EFR34730.1| DNA ligase (NAD+) [Porphyromonas asaccharolytica PR426713P-I]
          Length = 679

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++    +E+E L      H + YY  + P  +D  YD + +RL  L+ + PEL D   P
Sbjct: 1   MTRNNTELEIEQLRTTIEQHNRAYYLDNAPTISDADYDALMQRLLTLEAEHPELADPTSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SLRVG 65


>gi|1816524|gb|AAB42062.1| DNA ligase [Escherichia coli]
          Length = 90

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|195940543|ref|ZP_03085925.1| NAD-dependent DNA ligase LigA [Escherichia coli O157:H7 str.
           EC4024]
          Length = 98

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG 63


>gi|325913348|ref|ZP_08175716.1| DNA ligase (NAD+) [Lactobacillus iners UPII 60-B]
 gi|325477451|gb|EGC80595.1| DNA ligase (NAD+) [Lactobacillus iners UPII 60-B]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLLDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|188533249|ref|YP_001907046.1| NAD-dependent DNA ligase LigA [Erwinia tasmaniensis Et1/99]
 gi|254781330|sp|B2VE40|DNLJ_ERWT9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|188028291|emb|CAO96149.1| DNA ligase [Erwinia tasmaniensis Et1/99]
          Length = 670

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ +L  +  H++  Y+ LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 7   KITHLRTLLRHYEYQYHVLDAPAVPDAEYDRLMGELRELEAAHPELLTTDSPTQRVG 63


>gi|308063596|gb|ADO05483.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Sat464]
          Length = 656

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+P+ +D +YD + + L   +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDPIVSDAVYDELYQELKVYEEKNPNNIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|91775756|ref|YP_545512.1| DNA ligase, NAD-dependent [Methylobacillus flagellatus KT]
 gi|123254532|sp|Q1H1G6|DNLJ_METFK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91709743|gb|ABE49671.1| DNA ligase, NAD-dependent [Methylobacillus flagellatus KT]
          Length = 693

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +VE L      +   YY L+ P   D  YDRV   L AL++  PEL   D P   VG
Sbjct: 20  KVEALRATIRRYDYEYYVLNAPSVPDSEYDRVFRELKALEDAHPELVTPDSPTQRVG 76


>gi|86148411|ref|ZP_01066703.1| DNA ligase [Vibrio sp. MED222]
 gi|85833825|gb|EAQ51991.1| DNA ligase [Vibrio sp. MED222]
          Length = 670

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 32/63 (50%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K    + +E L +   +H   YY  D+P   D  YDR+ ++L  L+E+ PEL   D P  
Sbjct: 2   KESIQVTLEQLRETLHYHAVRYYVEDSPEIPDVEYDRLMQQLLKLEEENPELVTVDSPSQ 61

Query: 116 TVG 118
            VG
Sbjct: 62  RVG 64


>gi|317012429|gb|ADU83037.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Lithuania75]
          Length = 656

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDEPIVSDAIYDELYQELKAYEEKNPNDIQANSPTQKVG 63


>gi|229591993|ref|YP_002874112.1| NAD-dependent DNA ligase LigA [Pseudomonas fluorescens SBW25]
 gi|254781395|sp|C3JXX6|DNLJ_PSEFS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|229363859|emb|CAY51325.1| DNA ligase [Pseudomonas fluorescens SBW25]
          Length = 785

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P+L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAEHPDLVTRDSPTQRVG 63


>gi|110637718|ref|YP_677925.1| DNA ligase [Cytophaga hutchinsonii ATCC 33406]
 gi|123354667|sp|Q11VI1|DNLJ_CYTH3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110280399|gb|ABG58585.1| DNA ligase [Cytophaga hutchinsonii ATCC 33406]
          Length = 670

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  +A+  +E L K+  +H   YY+ D    +D  +D + + L  L++QFP     D P
Sbjct: 1   MNDAQALARIEELNKVLHYHNNLYYQKDTTEISDFEFDTLLQELIELEKQFPLYLKADSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|321314391|ref|YP_004206678.1| NAD-dependent DNA ligase LigA [Bacillus subtilis BSn5]
 gi|320020665|gb|ADV95651.1| NAD-dependent DNA ligase LigA [Bacillus subtilis BSn5]
          Length = 668

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ P+L   D P   VG
Sbjct: 24  YYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVG 65


>gi|309782142|ref|ZP_07676872.1| DNA ligase, NAD-dependent [Ralstonia sp. 5_7_47FAA]
 gi|308919208|gb|EFP64875.1| DNA ligase, NAD-dependent [Ralstonia sp. 5_7_47FAA]
          Length = 813

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEAEHPELKTPDSPTLRVG 72


>gi|291483102|dbj|BAI84177.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. natto
           BEST195]
          Length = 668

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ P+L   D P   VG
Sbjct: 24  YYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVG 65


>gi|156740882|ref|YP_001431011.1| DNA ligase [Roseiflexus castenholzii DSM 13941]
 gi|190359279|sp|A7NHP6|DNLJ_ROSCS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|156232210|gb|ABU56993.1| DNA ligase, NAD-dependent [Roseiflexus castenholzii DSM 13941]
          Length = 718

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  + +   E L +   +H   YY LD P+ +D  YD +   L  L+   PEL   D P
Sbjct: 1   MTSNDPVRRAETLREQIRYHNYRYYVLDEPVISDAEYDALMRELRELEAAHPELVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|16077730|ref|NP_388544.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221308499|ref|ZP_03590346.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221312822|ref|ZP_03594627.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221317746|ref|ZP_03599040.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322025|ref|ZP_03603319.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|7673987|sp|O31498|DNLJ_BACSU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|2632976|emb|CAB12482.1| DNA ligase [Bacillus subtilis subsp. subtilis str. 168]
          Length = 668

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ P+L   D P   VG
Sbjct: 24  YYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVG 65


>gi|152984776|ref|YP_001349158.1| NAD-dependent DNA ligase LigA [Pseudomonas aeruginosa PA7]
 gi|190359272|sp|A6V7X3|DNLJ_PSEA7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|150959934|gb|ABR81959.1| DNA ligase, NAD-dependent [Pseudomonas aeruginosa PA7]
          Length = 794

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 22/45 (48%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           H   YY LD P   D  YDR+   L AL+ + P+L   D P   V
Sbjct: 21  HNYRYYVLDEPSIPDAEYDRLFRELQALEAEHPQLLTPDSPTQRV 65


>gi|296330120|ref|ZP_06872602.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305673365|ref|YP_003865037.1| NAD-dependent DNA ligase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296152709|gb|EFG93576.1| NAD-dependent DNA ligase LigA [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305411609|gb|ADM36728.1| NAD-dependent DNA ligase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 668

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L A++E+ P+L   D P   VG
Sbjct: 24  YYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVG 65


>gi|291278945|ref|YP_003495780.1| NAD-dependent DNA ligase [Deferribacter desulfuricans SSM1]
 gi|290753647|dbj|BAI80024.1| NAD-dependent DNA ligase [Deferribacter desulfuricans SSM1]
          Length = 663

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           +H   YY L++P+ +D  YD++ +RL  ++ ++PE+     P   VGY
Sbjct: 18  YHDYRYYVLNDPVISDYEYDQLYKRLKEIESKYPEIISPYSPTQRVGY 65


>gi|326317205|ref|YP_004234877.1| DNA ligase, NAD-dependent [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374041|gb|ADX46310.1| DNA ligase, NAD-dependent [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 732

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           HQ  YY LD P   D  YDRV + L AL+   PEL   D P   V
Sbjct: 35  HQ--YYVLDAPTVPDAEYDRVFQALQALEAAHPELVTPDSPTQRV 77


>gi|254383201|ref|ZP_04998554.1| DNA ligase [Streptomyces sp. Mg1]
 gi|194342099|gb|EDX23065.1| DNA ligase [Streptomyces sp. Mg1]
          Length = 736

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D++   L+AL+EQ+P+L   D P   V 
Sbjct: 31  HRFRYYVNDQPVVSDAEFDQLLRSLEALEEQYPQLRTPDSPTQKVA 76


>gi|166216290|sp|Q0AHH6|DNLJ_NITEC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 683

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           IALH    YY  D P+  D  YD++   L  L++Q+P L   D P   VG
Sbjct: 18  IALHDFH-YYVQDAPIIPDADYDKLFRTLQQLEQQYPHLITPDSPTQRVG 66


>gi|120611505|ref|YP_971183.1| DNA ligase [Acidovorax citrulli AAC00-1]
 gi|166215380|sp|A1TR21|DNLJ_ACIAC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120589969|gb|ABM33409.1| DNA ligase, NAD-dependent [Acidovorax citrulli AAC00-1]
          Length = 732

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           HQ  YY LD P   D  YDRV + L AL+   PEL   D P   V
Sbjct: 35  HQ--YYVLDAPTVPDAEYDRVFQALQALETAHPELVTPDSPTQRV 77


>gi|323705997|ref|ZP_08117567.1| DNA ligase, NAD-dependent [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534611|gb|EGB24392.1| DNA ligase, NAD-dependent [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 659

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P  +D  YD +   L  L+E++P+    D P   VG
Sbjct: 16  HHSYMYYVLDKPEISDYEYDMMMRELIELEEKYPQFKTPDSPTQRVG 62


>gi|167631047|ref|YP_001681546.1| DNA ligase, nad-dependent [Heliobacterium modesticaldum Ice1]
 gi|254781344|sp|B0TDL0|DNLJ_HELMI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|167593787|gb|ABZ85535.1| DNA ligase, nad-dependent [Heliobacterium modesticaldum Ice1]
          Length = 675

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  +D  YDR+   L  L++  PEL   D P   VG
Sbjct: 27  HDYCYYVLDAPEISDAEYDRLMRELLDLEQSHPELVTADSPSQRVG 72


>gi|188997338|ref|YP_001931589.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium sp. YO3AOP1]
 gi|254781435|sp|B2V5U1|DNLJ_SULSY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|188932405|gb|ACD67035.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 704

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 12/98 (12%)

Query: 20  TPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYR 79
           T  + K+L+ L  +FL         LD  K    L+K EA   VE L ++   H   YY 
Sbjct: 3   TDERQKELIKLTYEFLK--------LDAKK----LTKEEAKKIVEDLREVIRFHDWRYYV 50

Query: 80  LDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           L  P+ +D  YD++ + L  ++ ++PEL   D P   V
Sbjct: 51  LAQPVISDYEYDKLFKLLKDIEGKYPELITPDSPTQRV 88


>gi|241662937|ref|YP_002981297.1| DNA ligase [Ralstonia pickettii 12D]
 gi|240864964|gb|ACS62625.1| DNA ligase, NAD-dependent [Ralstonia pickettii 12D]
          Length = 813

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEAEHPELKTPDSPTLRVG 72


>gi|119487266|ref|ZP_01621017.1| DNA ligase [Lyngbya sp. PCC 8106]
 gi|119455821|gb|EAW36956.1| DNA ligase [Lyngbya sp. PCC 8106]
          Length = 685

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L  L+  +P+L   D P   VG
Sbjct: 26  YYVLDAPIIEDAIYDQLYRELQQLETDYPQLITPDSPTQRVG 67


>gi|330718928|ref|ZP_08313528.1| DNA ligase, NAD-dependent [Leuconostoc fallax KCTC 3537]
          Length = 681

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 33/74 (44%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L + K V+ L+  +A  E+  L      +   YY  DNP   D +YD    RL  L+  F
Sbjct: 2   LPEFKAVSELTTAQAQQEIAKLQDDLTRYGVEYYEDDNPSVEDHVYDAFYARLVDLEAAF 61

Query: 105 PELFDEDHPWNTVG 118
           P+    + P   VG
Sbjct: 62  PQFMTPESPTQRVG 75


>gi|261253653|ref|ZP_05946226.1| DNA ligase [Vibrio orientalis CIP 102891]
 gi|260937044|gb|EEX93033.1| DNA ligase [Vibrio orientalis CIP 102891]
          Length = 669

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 18  YHGVKYYVEDNPEIPDAEYDRLMRDLMELESQHPELMSIDSPSQRVG 64


>gi|254670337|emb|CBA05747.1| DNA ligase [Neisseria meningitidis alpha153]
          Length = 841

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|207723346|ref|YP_002253745.1| dna ligase (polydeoxyribonucleotide synthase [nad+]) (partial
           sequence n terminus) protein [Ralstonia solanacearum
           MolK2]
 gi|206588545|emb|CAQ35508.1| probable dna ligase (polydeoxyribonucleotide synthase [nad+])
           (partial sequence n terminus) protein [Ralstonia
           solanacearum MolK2]
          Length = 568

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRALEALEAEHPELRTPDSPTLRVG 72


>gi|152981161|ref|YP_001353755.1| DNA ligase (polydeoxyribonucleotide synthase) [Janthinobacterium
           sp. Marseille]
 gi|166215814|sp|A6SZQ8|DNLJ_JANMA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151281238|gb|ABR89648.1| DNA ligase (Polydeoxyribonucleotide synthase) [Janthinobacterium
           sp. Marseille]
          Length = 692

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LDNP   D  YD++   L AL+   PEL   D P   VG
Sbjct: 40  HNYSYHVLDNPSIPDAEYDKLFRELQALETSHPELLVFDSPTQRVG 85


>gi|83748812|ref|ZP_00945825.1| NAD-dependent DNA ligase [Ralstonia solanacearum UW551]
 gi|207743250|ref|YP_002259642.1| dna ligase (polydeoxyribonucleotide synthase [nad+]) protein
           [Ralstonia solanacearum IPO1609]
 gi|83724504|gb|EAP71669.1| NAD-dependent DNA ligase [Ralstonia solanacearum UW551]
 gi|206594647|emb|CAQ61574.1| dna ligase (polydeoxyribonucleotide synthase [nad+]) protein
           [Ralstonia solanacearum IPO1609]
          Length = 813

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRALEALEAEHPELRTPDSPTLRVG 72


>gi|325141882|gb|EGC64324.1| DNA ligase, NAD-dependent [Neisseria meningitidis 961-5945]
          Length = 841

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|157374877|ref|YP_001473477.1| DNA ligase (NAD(+)) [Shewanella sediminis HAW-EB3]
 gi|190359288|sp|A8FU26|DNLJ_SHESH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157317251|gb|ABV36349.1| DNA ligase (NAD(+)) [Shewanella sediminis HAW-EB3]
          Length = 670

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L  +   H   YY  D P   D  YDR+  RL  L+ + PEL   D P   VG
Sbjct: 7   EIKQLTSVLNEHNYRYYVDDAPSVPDAEYDRLINRLKQLEAENPELCLPDSPTQRVG 63


>gi|218767787|ref|YP_002342299.1| putative DNA ligase [Neisseria meningitidis Z2491]
 gi|166216217|sp|A1IQR7|DNLJ_NEIMA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|121051795|emb|CAM08101.1| putative DNA ligase [Neisseria meningitidis Z2491]
 gi|319410038|emb|CBY90372.1| DNA ligase (polydeoxyribonucleotide synthase [NAD+]) [Neisseria
           meningitidis WUE 2594]
          Length = 841

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|297544111|ref|YP_003676413.1| NAD-dependent DNA ligase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841886|gb|ADH60402.1| DNA ligase, NAD-dependent [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 662

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KI  H+ K YY LD P  +D  YD +   L  L+E++PEL   D P   VG
Sbjct: 13  KINYHNYK-YYVLDQPEISDYEYDMLMRELIELEEKYPELKTPDSPSQRVG 62


>gi|158312936|ref|YP_001505444.1| DNA ligase, NAD-dependent [Frankia sp. EAN1pec]
 gi|254781334|sp|A8L538|DNLJ_FRASN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158108341|gb|ABW10538.1| DNA ligase, NAD-dependent [Frankia sp. EAN1pec]
          Length = 703

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD +   L+A++E+ PEL   D P   V 
Sbjct: 40  HAYRYYVLDKPTVADAEYDALMRELEAIEERHPELRTPDSPTQKVA 85


>gi|254804544|ref|YP_003082765.1| DNA ligase [Neisseria meningitidis alpha14]
 gi|254668086|emb|CBA04596.1| DNA ligase [Neisseria meningitidis alpha14]
          Length = 841

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|77458028|ref|YP_347533.1| NAD-dependent DNA ligase LigA [Pseudomonas fluorescens Pf0-1]
 gi|123731132|sp|Q3KFB2|DNLJ_PSEPF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77382031|gb|ABA73544.1| DNA ligase [Pseudomonas fluorescens Pf0-1]
          Length = 785

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+   PEL   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAANPELITSDSPTQRVG 63


>gi|114330949|ref|YP_747171.1| DNA ligase, NAD-dependent [Nitrosomonas eutropha C91]
 gi|114307963|gb|ABI59206.1| DNA ligase, NAD-dependent [Nitrosomonas eutropha C91]
          Length = 715

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           IALH    YY  D P+  D  YD++   L  L++Q+P L   D P   VG
Sbjct: 50  IALHDFH-YYVQDAPIIPDADYDKLFRTLQQLEQQYPHLITPDSPTQRVG 98


>gi|163789388|ref|ZP_02183827.1| DNA ligase, NAD-dependent [Carnobacterium sp. AT7]
 gi|159875242|gb|EDP69307.1| DNA ligase, NAD-dependent [Carnobacterium sp. AT7]
          Length = 673

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D  YD++   L AL+E+FP+L   D P   VG
Sbjct: 27  YYVKDTPSIPDADYDKLYHELVALEEEFPDLISNDSPTQRVG 68


>gi|118470314|ref|YP_886705.1| NAD-dependent DNA ligase LigA [Mycobacterium smegmatis str. MC2
           155]
 gi|166216211|sp|A0QUW7|DNLJ_MYCS2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|118171601|gb|ABK72497.1| DNA ligase, NAD-dependent [Mycobacterium smegmatis str. MC2 155]
          Length = 701

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D++   L AL++  PEL   D P   VG
Sbjct: 35  HQFRYYVKDAPIISDAEFDKLLRELQALEDAHPELRTPDSPTQLVG 80


>gi|329920507|ref|ZP_08277239.1| DNA ligase (NAD+) [Lactobacillus iners SPIN 1401G]
 gi|328936183|gb|EGG32636.1| DNA ligase (NAD+) [Lactobacillus iners SPIN 1401G]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|315653834|ref|ZP_07906750.1| NAD-dependent DNA ligase LigA [Lactobacillus iners ATCC 55195]
 gi|315488530|gb|EFU78176.1| NAD-dependent DNA ligase LigA [Lactobacillus iners ATCC 55195]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|312875390|ref|ZP_07735394.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2053A-b]
 gi|311089053|gb|EFQ47493.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2053A-b]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|309808880|ref|ZP_07702761.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 01V1-a]
 gi|308167878|gb|EFO70015.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 01V1-a]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|239995022|ref|ZP_04715546.1| NAD-dependent DNA ligase [Alteromonas macleodii ATCC 27126]
          Length = 70

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A  ++E L      +   YY +D+P   D +YDR  + L AL++Q+P L   + P   V
Sbjct: 7   QAKQQIETLRNTLNEYNYQYYVMDDPSVPDAVYDRDMQALIALEKQYPTLQSPNSPSQKV 66

Query: 118 G 118
           G
Sbjct: 67  G 67


>gi|88809499|ref|ZP_01125007.1| DNA ligase [Synechococcus sp. WH 7805]
 gi|88786718|gb|EAR17877.1| DNA ligase [Synechococcus sp. WH 7805]
          Length = 692

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   E+  L+  A H    YY LD P   D +YDR+   L  L+   PEL + D P   V
Sbjct: 3   ERAAELRQLLNRAAHA---YYVLDAPDLEDAVYDRLYRELLDLESAHPELVEADSPTQRV 59

Query: 118 G 118
           G
Sbjct: 60  G 60


>gi|55821530|ref|YP_139972.1| NAD-dependent DNA ligase LigA [Streptococcus thermophilus LMG
           18311]
 gi|55823458|ref|YP_141899.1| NAD-dependent DNA ligase LigA [Streptococcus thermophilus CNRZ1066]
 gi|81559086|sp|Q5LYL9|DNLJ_STRT1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|81560280|sp|Q5M382|DNLJ_STRT2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|55737515|gb|AAV61157.1| DNA ligase [Streptococcus thermophilus LMG 18311]
 gi|55739443|gb|AAV63084.1| DNA ligase [Streptococcus thermophilus CNRZ1066]
          Length = 652

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L  L+ + PEL   D P + VG
Sbjct: 14  QYAKEYYTEDNPSVSDAEYDKLYRELVTLEAEHPELVQADSPTHRVG 60


>gi|15606063|ref|NP_213440.1| DNA ligase (NAD dependent) [Aquifex aeolicus VF5]
 gi|7673992|sp|O66880|DNLJ_AQUAE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|2983242|gb|AAC06838.1| DNA ligase (NAD dependent) [Aquifex aeolicus VF5]
          Length = 720

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L K K V  LS  EA    E L ++  +H   YY   NP+  D  YDR+   L  +++++
Sbjct: 18  LRKIKDVKVLSFEEAKKLAEDLREVIRYHDYKYYVEANPVIPDYDYDRLFRALKEIEKKY 77

Query: 105 PELFDEDHPWNTVG 118
           PEL   D P   V 
Sbjct: 78  PELITPDSPTQRVA 91


>gi|317489959|ref|ZP_07948451.1| DNA ligase [Eggerthella sp. 1_3_56FAA]
 gi|316910957|gb|EFV32574.1| DNA ligase [Eggerthella sp. 1_3_56FAA]
          Length = 708

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 31  EAKFLPNKRAL-ESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGL 89
           E + L +++AL E+  D A ++ +L +     E+E       HH   YY  D P  +D  
Sbjct: 4   EQQTLLDEQALAEATSDPAARIDALRR-----EIE-------HHSYLYYANDAPEISDAA 51

Query: 90  YDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +D +   L  L+   PEL D   P   VG
Sbjct: 52  FDSLMRELRELEAAHPELIDPSSPTQRVG 80


>gi|221632243|ref|YP_002521464.1| DNA ligase, NAD-dependent [Thermomicrobium roseum DSM 5159]
 gi|254781441|sp|B9KXM2|DNLJ_THERP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221155911|gb|ACM05038.1| DNA ligase, NAD-dependent [Thermomicrobium roseum DSM 5159]
          Length = 695

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 29/61 (47%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E    VE L ++   +   YY L+ P  +D  YD +   L   +EQ+PEL   D P   V
Sbjct: 15  EVRARVEELRRLIQRYNYEYYVLNAPTVSDAEYDALMLELRRWEEQYPELVTPDSPTQRV 74

Query: 118 G 118
           G
Sbjct: 75  G 75


>gi|212703192|ref|ZP_03311320.1| hypothetical protein DESPIG_01234 [Desulfovibrio piger ATCC 29098]
 gi|212673458|gb|EEB33941.1| hypothetical protein DESPIG_01234 [Desulfovibrio piger ATCC 29098]
          Length = 729

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 65  YLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +L  I  HH   Y+ LD P+ +D  YD +   L AL+E +P+
Sbjct: 63  WLTTILEHHNYLYHTLDKPVISDDQYDALFRELKALEEDYPQ 104


>gi|110833810|ref|YP_692669.1| NAD-dependent DNA ligase LigA [Alcanivorax borkumensis SK2]
 gi|123345666|sp|Q0VR01|DNLJ_ALCBS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110646921|emb|CAL16397.1| DNA ligase (NAD+) [Alcanivorax borkumensis SK2]
          Length = 777

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P   D  YDRV   L  L+ Q+P+L   D P   VG
Sbjct: 25  YYVQDDPAVPDAEYDRVFRALKDLEAQYPDLVTADSPTQRVG 66


>gi|319941620|ref|ZP_08015944.1| DNA ligase [Sutterella wadsworthensis 3_1_45B]
 gi|319804850|gb|EFW01704.1| DNA ligase [Sutterella wadsworthensis 3_1_45B]
          Length = 745

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++W   YY LD P   D  YDR    L AL+ +FPEL     P   VG
Sbjct: 69  ERWNYEYYVLDEPSVPDAEYDRAFNELKALEARFPELKSRTSPTLRVG 116


>gi|258508011|ref|YP_003170762.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus GG]
 gi|257147938|emb|CAR86911.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus GG]
 gi|259649339|dbj|BAI41501.1| DNA ligase [Lactobacillus rhamnosus GG]
          Length = 674

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 31/71 (43%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           +K     +  EA  E+  L K     +  YY  D P  TD +YD     L AL+  FP+L
Sbjct: 3   SKPAAQFTLEEAEAEIAKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEAAFPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQQVG 73


>gi|229551868|ref|ZP_04440593.1| DNA ligase (NAD(+)) [Lactobacillus rhamnosus LMS2-1]
 gi|258539286|ref|YP_003173785.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus Lc 705]
 gi|229314812|gb|EEN80785.1| DNA ligase (NAD(+)) [Lactobacillus rhamnosus LMS2-1]
 gi|257150962|emb|CAR89934.1| NAD-dependent DNA ligase [Lactobacillus rhamnosus Lc 705]
          Length = 674

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 31/71 (43%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           +K     +  EA  E+  L K     +  YY  D P  TD +YD     L AL+  FP+L
Sbjct: 3   SKPAAQFTLEEAEAEIAKLRKQLNQWRLEYYTKDAPTVTDNVYDDHYRDLQALEAAFPKL 62

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 63  VTPDSPTQQVG 73


>gi|325911416|ref|ZP_08173828.1| DNA ligase (NAD+) [Lactobacillus iners UPII 143-D]
 gi|325476766|gb|EGC79920.1| DNA ligase (NAD+) [Lactobacillus iners UPII 143-D]
          Length = 672

 Score = 39.3 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|116628243|ref|YP_820862.1| NAD-dependent DNA ligase LigA [Streptococcus thermophilus LMD-9]
 gi|116101520|gb|ABJ66666.1| NAD-dependent DNA ligase [Streptococcus thermophilus LMD-9]
          Length = 648

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L  L+ + PEL   D P + VG
Sbjct: 10  QYAKEYYTEDNPSVSDAEYDKLYRELVTLEAEHPELVQADSPTHRVG 56


>gi|166216285|sp|Q03JF6|DNLJ_STRTD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 652

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L  L+ + PEL   D P + VG
Sbjct: 14  QYAKEYYTEDNPSVSDAEYDKLYRELVTLEAEHPELVQADSPTHRVG 60


>gi|326797492|ref|YP_004315311.1| DNA ligase [Sphingobacterium sp. 21]
 gi|326548256|gb|ADZ76641.1| DNA ligase [Sphingobacterium sp. 21]
          Length = 672

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A+  +E L K    H   YY L  P  +D  +D+    L AL++ +PE  D D P
Sbjct: 1   MQRNDALSRIEALTKELNDHNYKYYVLAQPSISDFDFDQKLAELAALEKDYPEFLDPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQKVG 65


>gi|312278868|gb|ADQ63525.1| DNA ligase [Streptococcus thermophilus ND03]
          Length = 648

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L  L+ + PEL   D P + VG
Sbjct: 10  QYAKEYYTEDNPSVSDAEYDKLYRELVTLEAEHPELVQADSPTHRVG 56


>gi|166032192|ref|ZP_02235021.1| hypothetical protein DORFOR_01895 [Dorea formicigenerans ATCC
           27755]
 gi|166027915|gb|EDR46672.1| hypothetical protein DORFOR_01895 [Dorea formicigenerans ATCC
           27755]
          Length = 690

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 52  TSLSKGEAMI--EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           T   KG++M    ++ LVK    ++  YY  D PL +D  YDR+ + L  L+EQ   +  
Sbjct: 19  TPQKKGDSMSVKRIKNLVKQLNEYRHAYYNQDAPLVSDAEYDRLFDELKELEEQTGFIL- 77

Query: 110 EDHPWNTVGY 119
            + P  TVGY
Sbjct: 78  SNSPTQTVGY 87


>gi|120598462|ref|YP_963036.1| DNA ligase, NAD-dependent [Shewanella sp. W3-18-1]
 gi|166216244|sp|A1RII7|DNLJ_SHESW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120558555|gb|ABM24482.1| DNA ligase, NAD-dependent [Shewanella sp. W3-18-1]
          Length = 685

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ + L  L+ QFP+    D P   VG
Sbjct: 33  HNIRYYVDDAPTITDSEYDRLMQCLIKLEAQFPQFIVADSPTQRVG 78


>gi|146293460|ref|YP_001183884.1| DNA ligase, NAD-dependent [Shewanella putrefaciens CN-32]
 gi|166216243|sp|A4Y802|DNLJ_SHEPC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145565150|gb|ABP76085.1| DNA ligase, NAD-dependent [Shewanella putrefaciens CN-32]
          Length = 685

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ + L  L+ QFP+    D P   VG
Sbjct: 33  HNIRYYVDDAPTITDSEYDRLMQCLIKLEAQFPQFIVADSPTQRVG 78


>gi|309803834|ref|ZP_07697919.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 11V1-d]
 gi|312870780|ref|ZP_07730886.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 3008A-a]
 gi|312873110|ref|ZP_07733169.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2062A-h1]
 gi|308164068|gb|EFO66330.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 11V1-d]
 gi|311091343|gb|EFQ49728.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2062A-h1]
 gi|311093656|gb|EFQ51994.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 3008A-a]
          Length = 672

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|300856841|ref|YP_003781825.1| DNA ligase [Clostridium ljungdahlii DSM 13528]
 gi|300436956|gb|ADK16723.1| DNA ligase [Clostridium ljungdahlii DSM 13528]
          Length = 664

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L KI  +H   YY  DNP  +D  YD + + L  ++ + PE+   D P   VG
Sbjct: 10  LKKIINYHNDRYYNQDNPEVSDYEYDMLMQELKNIEREHPEVITPDSPTQHVG 62


>gi|295397184|ref|ZP_06807287.1| NAD-dependent DNA ligase LigA [Aerococcus viridans ATCC 11563]
 gi|294974573|gb|EFG50297.1| NAD-dependent DNA ligase LigA [Aerococcus viridans ATCC 11563]
          Length = 670

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L ++   +   YY LDNP  +D  YD++   L  L+ ++P     + P   VG
Sbjct: 14  IEALTRLLNDYAYQYYALDNPTISDTEYDKLYRELQDLEAKYPTFIQAESPTQRVG 69


>gi|259501108|ref|ZP_05744010.1| DNA ligase [Lactobacillus iners DSM 13335]
 gi|302190444|ref|ZP_07266698.1| DNA ligase [Lactobacillus iners AB-1]
 gi|259167802|gb|EEW52297.1| DNA ligase [Lactobacillus iners DSM 13335]
          Length = 672

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|309804542|ref|ZP_07698607.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 09V1-c]
 gi|309809394|ref|ZP_07703256.1| DNA ligase (NAD+) [Lactobacillus iners SPIN 2503V10-D]
 gi|312873385|ref|ZP_07733436.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2052A-d]
 gi|308165934|gb|EFO68152.1| DNA ligase (NAD+) [Lactobacillus iners LactinV 09V1-c]
 gi|308170305|gb|EFO72336.1| DNA ligase (NAD+) [Lactobacillus iners SPIN 2503V10-D]
 gi|311091069|gb|EFQ49462.1| DNA ligase (NAD+) [Lactobacillus iners LEAF 2052A-d]
          Length = 672

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 36/68 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           ++ LS  +A +EV  L K        YY  D P+  D +YD+V ++L  L++++P L D 
Sbjct: 1   MSELSLAQAKLEVLKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVLIDP 60

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 61  DSITQRVG 68


>gi|240115079|ref|ZP_04729141.1| putative DNA ligase [Neisseria gonorrhoeae PID18]
 gi|240125172|ref|ZP_04738058.1| putative DNA ligase [Neisseria gonorrhoeae SK-92-679]
 gi|240127627|ref|ZP_04740288.1| putative DNA ligase [Neisseria gonorrhoeae SK-93-1035]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|240013546|ref|ZP_04720459.1| putative DNA ligase [Neisseria gonorrhoeae DGI18]
 gi|240120618|ref|ZP_04733580.1| putative DNA ligase [Neisseria gonorrhoeae PID24-1]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|148272584|ref|YP_001222145.1| NAD-dependent DNA ligase LigA [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|166215575|sp|A5CQU5|DNLJ_CLAM3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147830514|emb|CAN01449.1| NAD-dependant DNA ligase [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 853

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D    +D  YD +   L+AL+E  P L  +D P  TVG
Sbjct: 40  HRDEYYGADASTLSDAEYDALVHELEALEEAHPTLRSQDSPTQTVG 85


>gi|146321044|ref|YP_001200755.1| NAD-dependent DNA ligase LigA [Streptococcus suis 98HAH33]
 gi|253751920|ref|YP_003025061.1| DNA ligase [Streptococcus suis SC84]
 gi|253753743|ref|YP_003026884.1| DNA ligase [Streptococcus suis P1/7]
 gi|253755379|ref|YP_003028519.1| DNA ligase [Streptococcus suis BM407]
 gi|166216248|sp|A4W1W6|DNLJ_STRS2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145691850|gb|ABP92355.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Streptococcus suis 98HAH33]
 gi|251816209|emb|CAZ51836.1| DNA ligase [Streptococcus suis SC84]
 gi|251817843|emb|CAZ55596.1| DNA ligase [Streptococcus suis BM407]
 gi|251819989|emb|CAR46142.1| DNA ligase [Streptococcus suis P1/7]
 gi|292558495|gb|ADE31496.1| NAD-dependent DNA ligase [Streptococcus suis GZ1]
 gi|319758281|gb|ADV70223.1| NAD-dependent DNA ligase LigA [Streptococcus suis JS14]
          Length = 652

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +   + K YY+LD P  +D  YD +   L  L+   PEL   D P + VG
Sbjct: 5   ISELVSVLNQYAKEYYQLDQPSVSDAEYDTLYRELVELETAHPELILPDSPTHRVG 60


>gi|59800688|ref|YP_207400.1| putative DNA ligase [Neisseria gonorrhoeae FA 1090]
 gi|75356380|sp|Q5F9Z9|DNLJ_NEIG1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|59717583|gb|AAW88988.1| putative DNA ligase [Neisseria gonorrhoeae FA 1090]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|268600753|ref|ZP_06134920.1| DNA ligase [Neisseria gonorrhoeae PID18]
 gi|268683767|ref|ZP_06150629.1| DNA ligase [Neisseria gonorrhoeae SK-92-679]
 gi|268686007|ref|ZP_06152869.1| DNA ligase [Neisseria gonorrhoeae SK-93-1035]
 gi|293399617|ref|ZP_06643770.1| DNA ligase, NAD-dependent [Neisseria gonorrhoeae F62]
 gi|268584884|gb|EEZ49560.1| DNA ligase [Neisseria gonorrhoeae PID18]
 gi|268624051|gb|EEZ56451.1| DNA ligase [Neisseria gonorrhoeae SK-92-679]
 gi|268626291|gb|EEZ58691.1| DNA ligase [Neisseria gonorrhoeae SK-93-1035]
 gi|291610186|gb|EFF39308.1| DNA ligase, NAD-dependent [Neisseria gonorrhoeae F62]
          Length = 829

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 28  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 69


>gi|240122918|ref|ZP_04735874.1| putative DNA ligase [Neisseria gonorrhoeae PID332]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|240080125|ref|ZP_04724668.1| putative DNA ligase [Neisseria gonorrhoeae FA19]
 gi|240117363|ref|ZP_04731425.1| putative DNA ligase [Neisseria gonorrhoeae PID1]
 gi|260441105|ref|ZP_05794921.1| putative DNA ligase [Neisseria gonorrhoeae DGI2]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|240015985|ref|ZP_04722525.1| putative DNA ligase [Neisseria gonorrhoeae FA6140]
 gi|240112339|ref|ZP_04726829.1| putative DNA ligase [Neisseria gonorrhoeae MS11]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|194097948|ref|YP_002000994.1| putative DNA ligase [Neisseria gonorrhoeae NCCP11945]
 gi|239998421|ref|ZP_04718345.1| putative DNA ligase [Neisseria gonorrhoeae 35/02]
 gi|254781380|sp|B4RJQ9|DNLJ_NEIG2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193933238|gb|ACF29062.1| putative DNA ligase [Neisseria gonorrhoeae NCCP11945]
 gi|317163707|gb|ADV07248.1| putative DNA ligase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 823

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 63


>gi|146318834|ref|YP_001198546.1| NAD-dependent DNA ligase LigA [Streptococcus suis 05ZYH33]
 gi|166216250|sp|A4VVK7|DNLJ_STRSY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145689640|gb|ABP90146.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Streptococcus suis 05ZYH33]
          Length = 652

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +   + K YY+LD P  +D  YD +   L  L+   PEL   D P + VG
Sbjct: 5   ISELVSVLNQYAKEYYQLDQPSVSDAEYDTLYRELVELETAHPELILPDSPTHRVG 60


>gi|81429164|ref|YP_396165.1| NAD-dependent DNA ligase [Lactobacillus sakei subsp. sakei 23K]
 gi|123755813|sp|Q38VC5|DNLJ_LACSS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78610807|emb|CAI55858.1| NAD-dependent DNA ligase [Lactobacillus sakei subsp. sakei 23K]
          Length = 677

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 32/71 (45%)

Query: 48  AKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           AK V   ++ EA    + L      + + YY  D PL  D +YD +   L+ L+  FP +
Sbjct: 4   AKLVEDYTQSEAASLAQQLRDQLADYSQAYYTQDAPLVEDHVYDELYRDLEQLEAAFPVI 63

Query: 108 FDEDHPWNTVG 118
              D P   VG
Sbjct: 64  VTNDSPTQKVG 74


>gi|302023934|ref|ZP_07249145.1| NAD-dependent DNA ligase LigA [Streptococcus suis 05HAS68]
 gi|330832985|ref|YP_004401810.1| NAD-dependent DNA ligase LigA [Streptococcus suis ST3]
 gi|329307208|gb|AEB81624.1| NAD-dependent DNA ligase LigA [Streptococcus suis ST3]
          Length = 652

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +   + K YY+LD P  +D  YD +   L  L+   PEL   D P + VG
Sbjct: 5   ISELVSVLNQYAKEYYQLDQPSVSDAEYDTLYRELVELETAHPELILPDSPTHRVG 60


>gi|228469580|ref|ZP_04054573.1| DNA ligase, NAD-dependent [Porphyromonas uenonis 60-3]
 gi|228308930|gb|EEK17605.1| DNA ligase, NAD-dependent [Porphyromonas uenonis 60-3]
          Length = 679

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E+E L K    H + YY  + P  +D  YD + +RL  L+ + PE  D   P   VG
Sbjct: 8   LEIEQLRKTIEQHNRAYYLDNAPTISDADYDALMQRLLTLEAEHPEFADPTSPSLRVG 65


>gi|223932796|ref|ZP_03624793.1| DNA ligase, NAD-dependent [Streptococcus suis 89/1591]
 gi|223898505|gb|EEF64869.1| DNA ligase, NAD-dependent [Streptococcus suis 89/1591]
          Length = 652

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +   + K YY+LD P  +D  YD +   L  L+   PEL   D P + VG
Sbjct: 5   ISELVSVLNQYAKEYYQLDQPSVSDAEYDTLYRELVELETAHPELILPDSPTHRVG 60


>gi|254673676|emb|CBA09270.1| DNA ligase [Neisseria meningitidis alpha275]
          Length = 423

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|323228068|gb|EGA12205.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
          Length = 276

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|317009372|gb|ADU79952.1| NAD-dependent DNA ligase LigA [Helicobacter pylori India7]
          Length = 656

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +I       HH   YY LD+P+ +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIGYLNTLSHH---YYNLDDPIVSDAVYDELYQELKAYEEKNPSHIQANSPTQKVG 63


>gi|268681538|ref|ZP_06148400.1| DNA ligase [Neisseria gonorrhoeae PID332]
 gi|268621822|gb|EEZ54222.1| DNA ligase [Neisseria gonorrhoeae PID332]
          Length = 829

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 28  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 69


>gi|268596277|ref|ZP_06130444.1| DNA ligase [Neisseria gonorrhoeae FA19]
 gi|268603059|ref|ZP_06137226.1| DNA ligase [Neisseria gonorrhoeae PID1]
 gi|291044437|ref|ZP_06570146.1| DNA ligase [Neisseria gonorrhoeae DGI2]
 gi|268550065|gb|EEZ45084.1| DNA ligase [Neisseria gonorrhoeae FA19]
 gi|268587190|gb|EEZ51866.1| DNA ligase [Neisseria gonorrhoeae PID1]
 gi|291011331|gb|EFE03327.1| DNA ligase [Neisseria gonorrhoeae DGI2]
          Length = 829

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 28  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 69


>gi|268594283|ref|ZP_06128450.1| DNA ligase [Neisseria gonorrhoeae 35/02]
 gi|268547672|gb|EEZ43090.1| DNA ligase [Neisseria gonorrhoeae 35/02]
          Length = 827

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 26  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 67


>gi|254493140|ref|ZP_05106311.1| DNA ligase [Neisseria gonorrhoeae 1291]
 gi|268598398|ref|ZP_06132565.1| DNA ligase [Neisseria gonorrhoeae MS11]
 gi|226512180|gb|EEH61525.1| DNA ligase [Neisseria gonorrhoeae 1291]
 gi|268582529|gb|EEZ47205.1| DNA ligase [Neisseria gonorrhoeae MS11]
          Length = 829

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 28  YYTLDAPSIPDAEYDRLFRELEALERNHPELKLPDSPTQRVG 69


>gi|304317508|ref|YP_003852653.1| DNA ligase, NAD-dependent [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779010|gb|ADL69569.1| DNA ligase, NAD-dependent [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 659

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LD P  +D  YD +   L  L+E+ PE    D P   VG
Sbjct: 16  HHNYMYYVLDRPEISDYEYDMMMRELIKLEEEHPEFKTPDSPTQRVG 62


>gi|126729669|ref|ZP_01745482.1| DNA ligase, NAD-dependent [Sagittula stellata E-37]
 gi|126709788|gb|EBA08841.1| DNA ligase, NAD-dependent [Sagittula stellata E-37]
          Length = 714

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 37  NKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSER 96
           + RA E       +V  +++ +A  E+  L  I     + Y+  D P  TD  YDR+  R
Sbjct: 2   DDRASEELGMNDTEVGQMTEDQAREELRALSDILGQANRAYHAEDAPELTDAEYDRLKRR 61

Query: 97  LDALQEQFPELFDEDHPWNTVG 118
              ++ +FP+L   D P   VG
Sbjct: 62  NAEIEARFPQLKLADSPSEQVG 83


>gi|158521726|ref|YP_001529596.1| DNA ligase, NAD-dependent [Desulfococcus oleovorans Hxd3]
 gi|254781314|sp|A9A0L9|DNLJ_DESOH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|158510552|gb|ABW67519.1| DNA ligase, NAD-dependent [Desulfococcus oleovorans Hxd3]
          Length = 682

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 29/66 (43%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +L K EA   V +L      H   YY  D P  +D  YDR+   L  L+   P+L D   
Sbjct: 4   TLDKSEAKERVTFLRNELHRHNHLYYIKDAPEISDAEYDRLFRELAELEALHPDLADPAS 63

Query: 113 PWNTVG 118
           P   VG
Sbjct: 64  PTARVG 69


>gi|157826142|ref|YP_001493862.1| NAD-dependent DNA ligase LigA [Rickettsia akari str. Hartford]
 gi|166216231|sp|A8GPM9|DNLJ_RICAH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157800100|gb|ABV75354.1| DNA ligase [Rickettsia akari str. Hartford]
          Length = 689

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 49  KKVTSLSKGEAMIEVEYL-VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           + +  +S+ EA   +E L  KIA ++   YY  DNPL +D  YD++      L++QFP L
Sbjct: 2   QNIDFISEAEAKKLLEELSCKIAAYNHA-YYIEDNPLVSDAEYDQLVNINLKLEQQFPHL 60

Query: 108 FDEDHPWNTVG 118
             E+ P   VG
Sbjct: 61  VLENSPSKEVG 71


>gi|224826983|ref|ZP_03700081.1| DNA ligase, NAD-dependent [Lutiella nitroferrum 2002]
 gi|224600816|gb|EEG07001.1| DNA ligase, NAD-dependent [Lutiella nitroferrum 2002]
          Length = 815

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 32/66 (48%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           S  + +A+  +  LV +   + + YY  D P   D  YDR+   L+AL+   PEL   D 
Sbjct: 8   SNEREQAVQRIAELVPLLNRYSREYYERDEPTVPDVEYDRLYRELEALEAAHPELRRADS 67

Query: 113 PWNTVG 118
           P   VG
Sbjct: 68  PTLRVG 73


>gi|122879187|ref|YP_201049.6| NAD-dependent DNA ligase LigA [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|166216280|sp|Q5H057|DNLJ_XANOR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 841

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY L +P  TD  YD++   L  L++++PEL   D P   VG
Sbjct: 23  YYDLADPEITDAQYDQLFRELQELEQKYPELVTADSPSMRVG 64


>gi|84623945|ref|YP_451317.1| NAD-dependent DNA ligase LigA [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|123752764|sp|Q2P334|DNLJ_XANOM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|84367885|dbj|BAE69043.1| DNA ligase [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 841

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY L +P  TD  YD++   L  L++++PEL   D P   VG
Sbjct: 23  YYDLADPEITDAQYDQLFRELQELEQKYPELVTADSPSMRVG 64


>gi|299067453|emb|CBJ38652.1| DNA ligase [Ralstonia solanacearum CMR15]
          Length = 813

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEADHPELRTPDSPTLRVG 72


>gi|260769097|ref|ZP_05878031.1| DNA ligase [Vibrio furnissii CIP 102972]
 gi|260617127|gb|EEX42312.1| DNA ligase [Vibrio furnissii CIP 102972]
          Length = 669

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K  LH H   YY  D+P   D  YDR+   L  L+ Q PEL   D P   VG
Sbjct: 11  LKDTLHYHAIRYYVEDDPTIPDAEYDRLMRELLDLEAQHPELVTPDSPSQRVG 63


>gi|148240764|ref|YP_001226151.1| NAD-dependent DNA ligase LigA [Synechococcus sp. WH 7803]
 gi|166216252|sp|A5GPI9|DNLJ_SYNPW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147849303|emb|CAK24854.1| NAD-dependent DNA ligase [Synechococcus sp. WH 7803]
          Length = 698

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   E+  L+  A H    YY LD P   D +YDR+   L  L+   PEL + D P   V
Sbjct: 9   ERAAELRQLLNRAAHA---YYVLDAPDLEDSVYDRLYRELLDLEAAHPELVEADSPTQRV 65

Query: 118 G 118
           G
Sbjct: 66  G 66


>gi|254488738|ref|ZP_05101943.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
 gi|214045607|gb|EEB86245.1| DNA ligase, NAD-dependent [Roseobacter sp. GAI101]
          Length = 706

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  LSK +A  E+  L  +     + YY  D P  +D  YD +  R   ++ +FP L   
Sbjct: 7   VQDLSKDQAAEELRRLSGLLAQANRQYYAEDAPQISDAEYDCLKRRNTEIETRFPSLKRA 66

Query: 111 DHPWNTVG 118
           D P   +G
Sbjct: 67  DSPTEQIG 74


>gi|301169841|emb|CBW29445.1| DNA ligase, NAD(+)-dependent [Haemophilus influenzae 10810]
          Length = 670

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LD+P   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDHPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|298293088|ref|YP_003695027.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
 gi|296929599|gb|ADH90408.1| DNA ligase, NAD-dependent [Starkeya novella DSM 506]
          Length = 725

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 32/68 (47%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L+  EA  E   L      H + YY+ D P  +D  YD +  R +A++ QFPEL   
Sbjct: 10  VEKLTADEAAKEHARLGDEIAGHDRRYYQDDAPSVSDADYDALRRRYEAIEAQFPELKGI 69

Query: 111 DHPWNTVG 118
           D     VG
Sbjct: 70  DSLSEKVG 77


>gi|149275978|ref|ZP_01882123.1| DNA ligase [Pedobacter sp. BAL39]
 gi|149233406|gb|EDM38780.1| DNA ligase [Pedobacter sp. BAL39]
          Length = 671

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK E   +++ LVK    H   YY L  P   D  +DR    L+ L++Q+PE  D + P
Sbjct: 1   MSKNEVKDKMDALVKELNQHTYDYYVLAMPTIADYEFDRKLAALNKLEQQYPEYADPNSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQQVG 65


>gi|332880018|ref|ZP_08447702.1| DNA ligase [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332682014|gb|EGJ54927.1| DNA ligase [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 663

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P  +D  +D+  + L AL++  PE +DE+ P   VG
Sbjct: 14  QHNYNYYVLDTPTISDFEFDQKLKELQALEQAHPEYYDENSPTVRVG 60


>gi|24216818|ref|NP_714299.1| NAD dependent DNA ligase [Leptospira interrogans serovar Lai str.
           56601]
 gi|81465271|sp|Q8EYU4|DNLJ_LEPIN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24198185|gb|AAN51317.1| NAD dependent DNA ligase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 681

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +LS+ EA   +  L     HHQ  YY  ++P  +D  +D++  RL  L+E+FP+  D   
Sbjct: 11  TLSEKEAKGLIAKLSDEIRHHQYLYYVKNDPKISDFDFDQLFRRLQDLEEEFPQFKDLAS 70

Query: 113 PWNTVG 118
           P   VG
Sbjct: 71  PTLVVG 76


>gi|293188969|ref|ZP_06607703.1| DNA ligase, NAD-dependent [Actinomyces odontolyticus F0309]
 gi|292822104|gb|EFF81029.1| DNA ligase, NAD-dependent [Actinomyces odontolyticus F0309]
          Length = 777

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P   D  YDR+   ++ ++E++P+L   D P  +VG
Sbjct: 30  YYDRDSPTLADADYDRMYREVEQIEERYPQLRSADSPTMSVG 71


>gi|262276434|ref|ZP_06054243.1| DNA ligase [Grimontia hollisae CIP 101886]
 gi|262220242|gb|EEY71558.1| DNA ligase [Grimontia hollisae CIP 101886]
          Length = 670

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D P   D  YDR+ + L A++ + PEL   D P   VG
Sbjct: 18  YHGHLYYVEDKPELPDAEYDRMMQELLAIEAKHPELVTADSPSQRVG 64


>gi|289804479|ref|ZP_06535108.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 119

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|167038089|ref|YP_001665667.1| NAD-dependent DNA ligase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320116496|ref|YP_004186655.1| NAD-dependent DNA ligase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|254781439|sp|B0KBN6|DNLJ_THEP3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166856923|gb|ABY95331.1| DNA ligase, NAD-dependent [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319929587|gb|ADV80272.1| DNA ligase, NAD-dependent [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 662

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PEL   D P   VG
Sbjct: 16  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPELKTPDSPSQRVG 62


>gi|289704853|ref|ZP_06501270.1| DNA ligase (NAD(+)) [Micrococcus luteus SK58]
 gi|289558349|gb|EFD51623.1| DNA ligase (NAD(+)) [Micrococcus luteus SK58]
          Length = 797

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E LV+     +  YY+ D P  +D  YD +  RL+ L+   PEL   D P   VG
Sbjct: 24  EYEDLVERVRAARTAYYQRDAPEISDAEYDALYRRLEDLEALHPELVSNDSPTQEVG 80


>gi|289577826|ref|YP_003476453.1| DNA ligase, NAD-dependent [Thermoanaerobacter italicus Ab9]
 gi|289527539|gb|ADD01891.1| DNA ligase, NAD-dependent [Thermoanaerobacter italicus Ab9]
          Length = 662

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PEL   D P   VG
Sbjct: 16  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPELKTPDSPSQRVG 62


>gi|167039197|ref|YP_001662182.1| NAD-dependent DNA ligase [Thermoanaerobacter sp. X514]
 gi|256752857|ref|ZP_05493696.1| DNA ligase, NAD-dependent [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913208|ref|ZP_07130525.1| DNA ligase, NAD-dependent [Thermoanaerobacter sp. X561]
 gi|307723778|ref|YP_003903529.1| NAD-dependent DNA ligase [Thermoanaerobacter sp. X513]
 gi|254781440|sp|B0K3S1|DNLJ_THEPX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166853437|gb|ABY91846.1| DNA ligase, NAD-dependent [Thermoanaerobacter sp. X514]
 gi|256748259|gb|EEU61324.1| DNA ligase, NAD-dependent [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889893|gb|EFK85038.1| DNA ligase, NAD-dependent [Thermoanaerobacter sp. X561]
 gi|307580839|gb|ADN54238.1| DNA ligase, NAD-dependent [Thermoanaerobacter sp. X513]
          Length = 662

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PEL   D P   VG
Sbjct: 16  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPELKTPDSPSQRVG 62


>gi|45659103|ref|YP_003189.1| NAD dependent DNA ligase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|81406496|sp|Q72MA6|DNLJ_LEPIC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|45602349|gb|AAS71826.1| NAD dependent DNA ligase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 681

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +LS+ EA   +  L     HHQ  YY  ++P  +D  +D++  RL  L+E+FP+  D   
Sbjct: 11  TLSEKEAKGLIAKLSDEIRHHQYLYYVKNDPKISDFDFDQLFRRLQDLEEEFPQFKDLAS 70

Query: 113 PWNTVG 118
           P   VG
Sbjct: 71  PTLVVG 76


>gi|213027451|ref|ZP_03341898.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 79

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|300691610|ref|YP_003752605.1| DNA ligase [Ralstonia solanacearum PSI07]
 gi|299078670|emb|CBJ51328.1| DNA ligase [Ralstonia solanacearum PSI07]
          Length = 813

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEADHPELKTPDSPTLRVG 72


>gi|319762938|ref|YP_004126875.1| DNA ligase, nad-dependent [Alicycliphilus denitrificans BC]
 gi|330825018|ref|YP_004388321.1| DNA ligase [Alicycliphilus denitrificans K601]
 gi|317117499|gb|ADU99987.1| DNA ligase, NAD-dependent [Alicycliphilus denitrificans BC]
 gi|329310390|gb|AEB84805.1| DNA ligase, NAD-dependent [Alicycliphilus denitrificans K601]
          Length = 717

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P   D  YDRV ++L AL+  +P L   D P   V
Sbjct: 37  YYVLDEPSVPDAEYDRVFQQLQALEGAYPALVTPDSPTQRV 77


>gi|127513305|ref|YP_001094502.1| DNA ligase, NAD-dependent [Shewanella loihica PV-4]
 gi|166216242|sp|A3QFJ5|DNLJ_SHELP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126638600|gb|ABO24243.1| DNA ligase, NAD-dependent [Shewanella loihica PV-4]
          Length = 669

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L      H   YY  D P   D  YDR+  RL  L+ + PEL   D P   VG
Sbjct: 7   EIKQLTDELNQHNYRYYVDDAPSIPDAEYDRLMRRLQELEAEHPELALADSPTQRVG 63


>gi|332970057|gb|EGK09055.1| NAD-dependent DNA ligase LigA [Desmospora sp. 8437]
          Length = 670

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA   +E L +    H   Y+ L+ P+ +D  YD +   L  L+++ PEL   D P
Sbjct: 1   MERKEAEQRIEALRREIHEHDHRYHVLNQPVISDQEYDAMMRELLGLEQEHPELVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|228995667|ref|ZP_04155330.1| DNA ligase [Bacillus mycoides Rock3-17]
 gi|228764044|gb|EEM12928.1| DNA ligase [Bacillus mycoides Rock3-17]
          Length = 669

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK EA   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEEAKQRIEELRDMLNAFNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFLIEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TVRVG 65


>gi|239917127|ref|YP_002956685.1| DNA ligase, NAD-dependent [Micrococcus luteus NCTC 2665]
 gi|239838334|gb|ACS30131.1| DNA ligase, NAD-dependent [Micrococcus luteus NCTC 2665]
          Length = 797

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E LV+     +  YY+ D P  +D  YD +  RL+ L+   PEL   D P   VG
Sbjct: 24  EYEDLVERVRAARTAYYQRDAPEISDAEYDALYRRLEDLEALHPELVSNDSPTQEVG 80


>gi|228989472|ref|ZP_04149457.1| DNA ligase [Bacillus pseudomycoides DSM 12442]
 gi|228770197|gb|EEM18776.1| DNA ligase [Bacillus pseudomycoides DSM 12442]
          Length = 669

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK EA   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEEAKQRIEELRDMLNAFNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFLIEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TVRVG 65


>gi|229003296|ref|ZP_04161126.1| DNA ligase [Bacillus mycoides Rock1-4]
 gi|228757914|gb|EEM07129.1| DNA ligase [Bacillus mycoides Rock1-4]
          Length = 669

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK EA   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEEAKQRIEELRDMLNAFNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFLIEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TVRVG 65


>gi|257791950|ref|YP_003182556.1| DNA ligase, NAD-dependent [Eggerthella lenta DSM 2243]
 gi|325829905|ref|ZP_08163363.1| DNA ligase (NAD+) [Eggerthella sp. HGA1]
 gi|257475847|gb|ACV56167.1| DNA ligase, NAD-dependent [Eggerthella lenta DSM 2243]
 gi|325488072|gb|EGC90509.1| DNA ligase (NAD+) [Eggerthella sp. HGA1]
          Length = 708

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 31  EAKFLPNKRAL-ESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGL 89
           E + L +++AL E+  D A ++ +L +     E+E       HH   YY  D P  +D  
Sbjct: 4   EQQTLLDEQALAEATNDPAARIDALRR-----EIE-------HHSYLYYANDAPEISDAA 51

Query: 90  YDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +D +   L  L+   PEL D   P   VG
Sbjct: 52  FDSLMRELRELEAAHPELIDPSSPTQRVG 80


>gi|225075650|ref|ZP_03718849.1| hypothetical protein NEIFLAOT_00666 [Neisseria flavescens
           NRL30031/H210]
 gi|224953072|gb|EEG34281.1| hypothetical protein NEIFLAOT_00666 [Neisseria flavescens
           NRL30031/H210]
          Length = 822

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++YL  +   +   YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 8   IQYLTDLLNRYAYEYYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 63


>gi|187734527|ref|YP_001876639.1| DNA ligase, NAD-dependent [Akkermansia muciniphila ATCC BAA-835]
 gi|254781249|sp|B2UL69|DNLJ_AKKM8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|187424579|gb|ACD03858.1| DNA ligase, NAD-dependent [Akkermansia muciniphila ATCC BAA-835]
          Length = 794

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++YL      H + YY    P  +D  YD +   L+ L++  PEL D D P   VG
Sbjct: 49  IDYLRSELRRHNRLYYEQAEPEISDAEYDALFLELEKLEKAHPELSDPDSPTRRVG 104


>gi|312865342|ref|ZP_07725570.1| DNA ligase (NAD+) [Streptococcus downei F0415]
 gi|311099453|gb|EFQ57669.1| DNA ligase (NAD+) [Streptococcus downei F0415]
          Length = 673

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + K YY  DNP  +D  YD++   L  L++  PEL   D P + VG
Sbjct: 36  YAKEYYTQDNPSVSDAQYDKLYRELVDLEKAHPELVQADSPTHRVG 81


>gi|213850350|ref|ZP_03381248.1| NAD-dependent DNA ligase LigA [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
          Length = 110

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 17  HHEYLYHVMDAPEILDAEYDRLMRELRELEAQRPDLITPDSPTQRVG 63


>gi|325928155|ref|ZP_08189364.1| DNA ligase, NAD-dependent [Xanthomonas perforans 91-118]
 gi|325541451|gb|EGD12984.1| DNA ligase, NAD-dependent [Xanthomonas perforans 91-118]
          Length = 833

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YD++   L+AL+   PEL   D P   VG+
Sbjct: 25  YHVLDEPQMADADYDKLMRELEALERAHPELASADSPTQRVGH 67


>gi|78047224|ref|YP_363399.1| NAD-dependent DNA ligase LigA [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|123744002|sp|Q3BV14|DNLJ_XANC5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|78035654|emb|CAJ23345.1| DNA ligase [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 833

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YD++   L+AL+   PEL   D P   VG+
Sbjct: 25  YHVLDEPQMADADYDKLMRELEALERAHPELASADSPTQRVGH 67


>gi|294665962|ref|ZP_06731226.1| DNA ligase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292604265|gb|EFF47652.1| DNA ligase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 833

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YD++   L+AL+   PEL   D P   VG+
Sbjct: 25  YHVLDEPQMADADYDKLMRELEALERAHPELASADSPTQRVGH 67


>gi|294626370|ref|ZP_06704972.1| DNA ligase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292599371|gb|EFF43506.1| DNA ligase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 833

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YD++   L+AL+   PEL   D P   VG+
Sbjct: 25  YHVLDEPQMADADYDKLMRELEALERAHPELASADSPTQRVGH 67


>gi|254427631|ref|ZP_05041338.1| DNA ligase, NAD-dependent [Alcanivorax sp. DG881]
 gi|196193800|gb|EDX88759.1| DNA ligase, NAD-dependent [Alcanivorax sp. DG881]
          Length = 776

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P   D  YDR    L  L+ Q+P+L   D P   VG
Sbjct: 24  YYVQDDPAVPDAEYDRAFRELKDLEAQYPDLITADSPTQRVG 65


>gi|269216606|ref|ZP_06160460.1| DNA ligase, NAD-dependent [Slackia exigua ATCC 700122]
 gi|269130135|gb|EEZ61217.1| DNA ligase, NAD-dependent [Slackia exigua ATCC 700122]
          Length = 709

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 25/56 (44%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           V  L K   HH   YY  D P  +D  +D +   L  L++  PEL D   P   VG
Sbjct: 23  VRALRKEIEHHTYLYYAKDAPEISDAAFDSLMRELRELEQAHPELIDPTSPTQRVG 78


>gi|21242377|ref|NP_641959.1| NAD-dependent DNA ligase LigA [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|81803317|sp|Q8PM07|DNLJ_XANAC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|21107814|gb|AAM36495.1| DNA ligase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 833

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YD++   L+AL+   PEL   D P   VG+
Sbjct: 25  YHVLDEPQMADADYDKLMRELEALERAHPELASADSPTQRVGH 67


>gi|298528094|ref|ZP_07015498.1| DNA ligase, NAD-dependent [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511746|gb|EFI35648.1| DNA ligase, NAD-dependent [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 679

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H  +YY LD+PL +D  YDR+   L  L+E+ P L     P   VG
Sbjct: 22  HNYYYYVLDDPLISDVEYDRMLAELKDLEEKHPGLKHSGSPTMKVG 67


>gi|160940658|ref|ZP_02088001.1| hypothetical protein CLOBOL_05552 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436393|gb|EDP14160.1| hypothetical protein CLOBOL_05552 [Clostridium bolteae ATCC
           BAA-613]
          Length = 699

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 30  LEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGL 89
           L   F  NK+ +E+ + K  +   LS  +  I + +LVK    ++  YY ++ P  +D +
Sbjct: 10  LSNTFNDNKKIMEAHM-KQNQNEHLS--QEAIRIHHLVKQLNQYRHEYYNMNAPSVSDAV 66

Query: 90  YDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           YD + + LDAL+++   +   + P  TVGY
Sbjct: 67  YDCLFDELDALEKR-TGIILSNSPTQTVGY 95


>gi|110597868|ref|ZP_01386151.1| DNA ligase, NAD-dependent [Chlorobium ferrooxidans DSM 13031]
 gi|110340593|gb|EAT59076.1| DNA ligase, NAD-dependent [Chlorobium ferrooxidans DSM 13031]
          Length = 674

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H + YY+   P  +D  +D + E+L AL++QFP+L   D P   VG
Sbjct: 20  RHNRLYYQEAKPEISDYDFDLLLEQLVALEQQFPDLVTPDSPSQRVG 66


>gi|319426762|gb|ADV54836.1| DNA ligase, NAD-dependent [Shewanella putrefaciens 200]
          Length = 685

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ + L  L+ QFP+    D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQCLIKLEAQFPQFIVADSPTQRVG 78


>gi|114797923|ref|YP_759116.1| DNA ligase, NAD-dependent [Hyphomonas neptunium ATCC 15444]
 gi|122942770|sp|Q0C577|DNLJ_HYPNA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114738097|gb|ABI76222.1| DNA ligase, NAD-dependent [Hyphomonas neptunium ATCC 15444]
          Length = 701

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY+ D P  TD  YD + +R  A++ +FP L  ED P + VG
Sbjct: 33  YYQNDAPELTDADYDALRQRNLAIEARFPALKREDSPTDRVG 74


>gi|303232470|ref|ZP_07319159.1| DNA ligase (NAD+) [Atopobium vaginae PB189-T1-4]
 gi|302481435|gb|EFL44506.1| DNA ligase (NAD+) [Atopobium vaginae PB189-T1-4]
          Length = 836

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           A + V  L ++  +H   YY LD+PL +D  +D   + L AL++  PEL
Sbjct: 96  AALRVPELRRLLTYHAWRYYALDDPLISDAQFDAYLQELIALEQAHPEL 144


>gi|154507531|ref|ZP_02043173.1| hypothetical protein ACTODO_00010 [Actinomyces odontolyticus ATCC
           17982]
 gi|153799320|gb|EDN81740.1| hypothetical protein ACTODO_00010 [Actinomyces odontolyticus ATCC
           17982]
          Length = 777

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P   D  YDR+   ++ ++E++P+L   D P  +VG
Sbjct: 30  YYDRDSPTLADADYDRMYREVEEIEERYPQLRGADSPTMSVG 71


>gi|327438552|dbj|BAK14917.1| NAD-dependent DNA ligase [Solibacillus silvestris StLB046]
          Length = 665

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L AL+E  PE    D P   VG
Sbjct: 22  YYVLDKPVVEDSVYDQLLHELIALEEANPEFIYPDSPTQRVG 63


>gi|327402054|ref|YP_004342892.1| DNA ligase [Fluviicola taffensis DSM 16823]
 gi|327317562|gb|AEA42054.1| DNA ligase [Fluviicola taffensis DSM 16823]
          Length = 670

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA +++E L K    H   YY   NP  +D  +D + + L  L+ QFPEL  +  P   V
Sbjct: 5   EAQLKIEQLTKELTLHNHNYYVESNPTISDYEFDVLLKELQDLETQFPELASDLSPTKRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|269123713|ref|YP_003306290.1| DNA ligase, NAD-dependent [Streptobacillus moniliformis DSM 12112]
 gi|268315039|gb|ACZ01413.1| DNA ligase, NAD-dependent [Streptobacillus moniliformis DSM 12112]
          Length = 675

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 67  VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++I  HH   YY LD  L TD  YD + ++++ L+++FPEL  ++ P   +G
Sbjct: 23  IEIYNHH---YYNLDESLITDREYDALLKKIELLEKEFPELKLKNSPTEIIG 71


>gi|312888786|ref|ZP_07748349.1| DNA ligase, NAD-dependent [Mucilaginibacter paludis DSM 18603]
 gi|311298661|gb|EFQ75767.1| DNA ligase, NAD-dependent [Mucilaginibacter paludis DSM 18603]
          Length = 675

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +S  EA  ++  L      H   YY L  P  +D  +D+  E L AL++QFPE  + D P
Sbjct: 1   MSPTEAKNKIHTLSAELKQHNYNYYVLAMPTISDFDFDKKLEELAALEKQFPEFAEPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQQVG 65


>gi|77463176|ref|YP_352680.1| DNA ligase [Rhodobacter sphaeroides 2.4.1]
 gi|123730578|sp|Q3J355|DNLJ_RHOS4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77387594|gb|ABA78779.1| DNA ligase [Rhodobacter sphaeroides 2.4.1]
          Length = 704

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  R  A++EQFPEL   D P + VG
Sbjct: 33  YHTHDAPQISDADYDALKVRNRAIEEQFPELRRSDSPSDRVG 74


>gi|82523684|emb|CAI78466.1| NAD-dependent DNA ligase [uncultured candidate division WS3
           bacterium]
          Length = 667

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           A   V  L ++  HH + YY    P   DG YD +   L AL+ + PEL   D P
Sbjct: 7   ARARVAELRELIRHHDRKYYVDAAPEIADGEYDALMSELAALEREHPELVTADSP 61


>gi|88658391|ref|YP_507122.1| DNA ligase, NAD-dependent [Ehrlichia chaffeensis str. Arkansas]
 gi|123763773|sp|Q2GHG1|DNLJ_EHRCR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|88599848|gb|ABD45317.1| DNA ligase, NAD-dependent [Ehrlichia chaffeensis str. Arkansas]
          Length = 676

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A +E++ L K   HH   YY  DNP  +D  YD +  + + +   FP+L   +   N +
Sbjct: 6   KAKLELDKLNKQIQHHDVLYYVQDNPEISDAEYDELCRKRNLILNAFPKLTQSNDYQNNI 65

Query: 118 G 118
           G
Sbjct: 66  G 66


>gi|148982028|ref|ZP_01816589.1| NAD-dependent DNA ligase LigA [Vibrionales bacterium SWAT-3]
 gi|145960667|gb|EDK26012.1| NAD-dependent DNA ligase LigA [Vibrionales bacterium SWAT-3]
          Length = 670

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 32/63 (50%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K    + +E L +   +H   YY  D+P   D  YDR+ ++L  ++E+ PEL   D P  
Sbjct: 2   KESIQVTLEQLRETLHYHAVRYYVEDSPEIPDVEYDRLMQQLLKIEEENPELVTVDSPSQ 61

Query: 116 TVG 118
            VG
Sbjct: 62  RVG 64


>gi|84393803|ref|ZP_00992550.1| DNA ligase [Vibrio splendidus 12B01]
 gi|84375600|gb|EAP92500.1| DNA ligase [Vibrio splendidus 12B01]
          Length = 670

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 32/63 (50%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K    + +E L +   +H   YY  D+P   D  YDR+ ++L  ++E+ PEL   D P  
Sbjct: 2   KESIQVTLEQLRETLHYHAVRYYVEDSPEIPDVEYDRLMQQLLKIEEENPELVTVDSPSQ 61

Query: 116 TVG 118
            VG
Sbjct: 62  RVG 64


>gi|332970926|gb|EGK09901.1| NAD-dependent DNA ligase LigA [Kingella kingae ATCC 23330]
          Length = 785

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +S  +   ++++L +I   +   YY LD P   D  YD++   L+ L+  FP     + P
Sbjct: 1   MSNTQIQNQIKHLTEILNRYAHEYYTLDAPSVPDSEYDKLYRELEQLERDFPYFRLPESP 60

Query: 114 WNTVG 118
            N VG
Sbjct: 61  TNRVG 65


>gi|76801093|ref|YP_326101.1| NAD-dependent DNA ligase LigA [Natronomonas pharaonis DSM 2160]
 gi|121729348|sp|Q3ITK1|DNLJ_NATPD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|76556958|emb|CAI48532.1| DNA ligase (NAD) [Natronomonas pharaonis DSM 2160]
          Length = 691

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           V  L    A  +VE L +    H   YY+L +P+ +D  YD++ ERL+ L+ +F
Sbjct: 20  VDELDAASATRQVETLREAIRFHDYRYYQLADPVISDRAYDQLFERLERLESKF 73


>gi|16329180|ref|NP_439908.1| NAD-dependent DNA ligase LigA [Synechocystis sp. PCC 6803]
 gi|7674015|sp|P72588|DNLJ_SYNY3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|1651660|dbj|BAA16588.1| DNA ligase [Synechocystis sp. PCC 6803]
          Length = 669

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L  L+ + PEL   D P   VG
Sbjct: 21  YYVLDAPVMEDSVYDQLYRELQRLEAENPELITPDSPTQRVG 62


>gi|261380488|ref|ZP_05985061.1| DNA ligase, NAD-dependent [Neisseria subflava NJ9703]
 gi|284796739|gb|EFC52086.1| DNA ligase, NAD-dependent [Neisseria subflava NJ9703]
          Length = 822

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++YL  +   +   YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 8   IKYLTDLLNRYAYEYYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 63


>gi|37520296|ref|NP_923673.1| NAD-dependent DNA ligase LigA [Gloeobacter violaceus PCC 7421]
 gi|81710991|sp|Q7NMN8|DNLJ_GLOVI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|35211289|dbj|BAC88668.1| DNA ligase [Gloeobacter violaceus PCC 7421]
          Length = 668

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 70  ALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           AL H +W   YY LD P  +D +YD+    L  L+ ++PEL   D P   VG
Sbjct: 18  ALLH-RWGYAYYVLDAPEVSDAIYDQHYRELVDLESRYPELVSPDSPTRRVG 68


>gi|302037359|ref|YP_003797681.1| DNA ligase (NAD(+)) [Candidatus Nitrospira defluvii]
 gi|300605423|emb|CBK41756.1| DNA ligase (NAD(+)) [Candidatus Nitrospira defluvii]
          Length = 675

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY  D P  +D  YDR+   L  L+   P+L   D P   VG
Sbjct: 24  HHDHLYYTKDRPEISDAEYDRLFRELVDLETAHPDLVTGDSPTQRVG 70


>gi|259416760|ref|ZP_05740680.1| DNA ligase, NAD-dependent [Silicibacter sp. TrichCH4B]
 gi|259348199|gb|EEW59976.1| DNA ligase, NAD-dependent [Silicibacter sp. TrichCH4B]
          Length = 739

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y++ D P  +D  YDR+  R  AL E FPEL +E     +VG
Sbjct: 24  YHQKDAPTLSDAEYDRLKRRYLALAEAFPELAEEGTRVESVG 65


>gi|126649600|ref|ZP_01721841.1| NAD-dependent DNA ligase LigA [Bacillus sp. B14905]
 gi|126593925|gb|EAZ87848.1| NAD-dependent DNA ligase LigA [Bacillus sp. B14905]
          Length = 667

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L AL+E  P L   D P   VG
Sbjct: 22  YYVLDKPVVADSVYDQLLHELIALEEANPSLIFPDSPTQRVG 63


>gi|288927843|ref|ZP_06421690.1| DNA ligase, NAD-dependent [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288330677|gb|EFC69261.1| DNA ligase, NAD-dependent [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 665

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY  ++P  +D  +DR+   L  L+ + PE++D + P   VG
Sbjct: 16  HHNYLYYVQNSPTLSDQEFDRLMRELQDLEAKHPEVYDPNSPTQRVG 62


>gi|260219439|emb|CBA26284.1| DNA ligase [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 696

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL  D  YDR+   L  L+ Q PE    D P   VG
Sbjct: 36  YYVLDAPLVPDVEYDRLFRELQDLEAQHPEWVTPDSPTQRVG 77


>gi|167647059|ref|YP_001684722.1| NAD-dependent DNA ligase [Caulobacter sp. K31]
 gi|190359242|sp|B0T1N5|DNLJ_CAUSK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|167349489|gb|ABZ72224.1| DNA ligase, NAD-dependent [Caulobacter sp. K31]
          Length = 792

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 34/68 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ +A  E+E L      H   Y++ D P  +D  YD +  R   ++++FP L  +
Sbjct: 6   VADLTEAQAAEELERLADDLAAHDLRYHQQDAPTISDAEYDALKRRNLDIEDRFPHLVRD 65

Query: 111 DHPWNTVG 118
           + P   VG
Sbjct: 66  NSPSMRVG 73


>gi|15613212|ref|NP_241515.1| NAD-dependent DNA ligase LigA [Bacillus halodurans C-125]
 gi|15213980|sp|Q9KF37|DNLJ_BACHD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|10173263|dbj|BAB04368.1| DNA ligase (polydeoxyribonucleotide synthase (NAD+)) [Bacillus
           halodurans C-125]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A  ++E L      +   YY LD PL +D  YD +   L  L+E FPEL  +  P
Sbjct: 1   MERNDAERKIEKLRNQLEEYGYHYYVLDKPLVSDAEYDGLMNELIELEEAFPELKSDTSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|256380031|ref|YP_003103691.1| DNA ligase, NAD-dependent [Actinosynnema mirum DSM 43827]
 gi|255924334|gb|ACU39845.1| DNA ligase, NAD-dependent [Actinosynnema mirum DSM 43827]
          Length = 816

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P  +DG +D +   L +L++  P L   D P   VG
Sbjct: 60  HQFRYYVLDAPTISDGEFDALLRELQSLEDAHPGLATPDSPTQQVG 105


>gi|169825829|ref|YP_001695987.1| DNA ligase [Lysinibacillus sphaericus C3-41]
 gi|254781361|sp|B1HTW6|DNLJ_LYSSC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168990317|gb|ACA37857.1| DNA ligase [Lysinibacillus sphaericus C3-41]
          Length = 667

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L AL+E  P L   D P   VG
Sbjct: 22  YYVLDKPVVADSVYDQLLHELIALEEANPSLIFPDSPTQRVG 63


>gi|146168649|ref|XP_001471359.1| hypothetical protein TTHERM_00490927 [Tetrahymena thermophila]
 gi|146145195|gb|EDK31677.1| hypothetical protein TTHERM_00490927 [Tetrahymena thermophila
           SB210]
          Length = 704

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 8   FRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM-IEVEYL 66
           FR   F +++NI+  Q +     +  FL  K+ L + +   K+VT+++KG  + +E +Y 
Sbjct: 200 FRIKLFASQYNISSQQNQVSYRNQFIFLNPKQTLLTTISAQKQVTTVNKGFLIQVESKYS 259

Query: 67  VKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
             I  + Q   Y LDN   +   Y +V E +  ++ QFP
Sbjct: 260 FPIQFNQQNQSYELDNKPLSQVSY-QVDEVIQYIEIQFP 297


>gi|94497003|ref|ZP_01303577.1| DNA ligase, NAD-dependent [Sphingomonas sp. SKA58]
 gi|94423679|gb|EAT08706.1| DNA ligase, NAD-dependent [Sphingomonas sp. SKA58]
          Length = 703

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L++ EA   +  L K    H + Y+  D P  +D  YD +    +AL+  FP L   D P
Sbjct: 7   LTEAEAANRLMRLAKEVAKHNRLYHDQDAPEISDADYDALIRENNALEAAFPHLIRADSP 66

Query: 114 WNTVG 118
              VG
Sbjct: 67  NAQVG 71


>gi|296110658|ref|YP_003621039.1| NAD-dependent DNA ligase [Leuconostoc kimchii IMSNU 11154]
 gi|295832189|gb|ADG40070.1| NAD-dependent DNA ligase [Leuconostoc kimchii IMSNU 11154]
          Length = 681

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +  L+   A  E+    +  L +   YY  D PL  D +YD +  RL  L+  FP+  + 
Sbjct: 8   IEQLTTPMAQQEIANHQETLLQYGVAYYEQDAPLVEDYVYDALYARLVELEAAFPQFINP 67

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 68  DSPTQKVG 75


>gi|317132010|ref|YP_004091324.1| DNA ligase, NAD-dependent [Ethanoligenens harbinense YUAN-3]
 gi|315469989|gb|ADU26593.1| DNA ligase, NAD-dependent [Ethanoligenens harbinense YUAN-3]
          Length = 661

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 27/61 (44%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A    + L K    H   YY LD P   D  YDR+   L+ L+   PE+   D P   V
Sbjct: 2   DAAARAKELRKALSRHNYLYYVLDAPEIEDFEYDRMLRELEELEAAHPEIVTPDSPTQRV 61

Query: 118 G 118
           G
Sbjct: 62  G 62


>gi|332558050|ref|ZP_08412372.1| DNA ligase [Rhodobacter sphaeroides WS8N]
 gi|332275762|gb|EGJ21077.1| DNA ligase [Rhodobacter sphaeroides WS8N]
          Length = 704

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  R  A++EQFPEL   D P + VG
Sbjct: 33  YHTHDAPQISDADYDALKLRNRAIEEQFPELRRSDSPSDRVG 74


>gi|241759788|ref|ZP_04757888.1| DNA ligase, NAD-dependent [Neisseria flavescens SK114]
 gi|241319796|gb|EER56192.1| DNA ligase, NAD-dependent [Neisseria flavescens SK114]
          Length = 859

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++YL  +   +   YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 45  IKYLTDLLNRYAYEYYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 100


>gi|88608555|ref|YP_506384.1| DNA ligase, NAD-dependent [Neorickettsia sennetsu str. Miyayama]
 gi|123736355|sp|Q2GDR2|DNLJ_NEOSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|88600724|gb|ABD46192.1| DNA ligase, NAD-dependent [Neorickettsia sennetsu str. Miyayama]
          Length = 670

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           EA  E++ L +  L H K YY+ D+P  TD  YD + +R   L E  P L
Sbjct: 2   EAKKEIQELYEKLLRHNKKYYQDDSPEITDAEYDSIKDRYLKLLEANPSL 51


>gi|116071920|ref|ZP_01469188.1| DNA ligase [Synechococcus sp. BL107]
 gi|116065543|gb|EAU71301.1| DNA ligase [Synechococcus sp. BL107]
          Length = 682

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           + E   E+  L+  A H    YY LD P   D +YDR+   L  L++  P L   D P  
Sbjct: 4   QSERASELRNLLNTAAHA---YYVLDTPTMEDAVYDRLYRELLELEQTTPSLKTADSPTQ 60

Query: 116 TVG 118
            VG
Sbjct: 61  RVG 63


>gi|237747723|ref|ZP_04578203.1| DNA ligase [Oxalobacter formigenes OXCC13]
 gi|229379085|gb|EEO29176.1| DNA ligase [Oxalobacter formigenes OXCC13]
          Length = 685

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D  YDR+  +L  L++  PEL   D P   VG
Sbjct: 33  YYVLDAPIVPDSEYDRLFRQLQELEKAHPELVVPDSPTQRVG 74


>gi|190575033|ref|YP_001972878.1| NAD-dependent DNA ligase LigA [Stenotrophomonas maltophilia K279a]
 gi|254781423|sp|B2FKJ1|DNLJ_STRMK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190012955|emb|CAQ46587.1| putative DNA ligase [Stenotrophomonas maltophilia K279a]
          Length = 821

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 23  YHELDAPEIPDVDYDRMVRELEALEREHPELARADSPTQQVG 64


>gi|11967289|gb|AAG42042.1| NAD-dependent DNA ligase [Aquifex pyrophilus]
          Length = 719

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           L++ K +  LS  EA    E L ++   H   YY   +P+ +D  YDR+   L  ++ +F
Sbjct: 18  LERIKSLKDLSLEEAKRLAEELKEVIRFHDYKYYVQASPVISDYDYDRLFRALKEIERKF 77

Query: 105 PELFDEDHPWNTVG 118
           P+    D P   V 
Sbjct: 78  PQFITPDSPTQRVA 91


>gi|293603951|ref|ZP_06686365.1| NAD-dependent DNA ligase LigA [Achromobacter piechaudii ATCC 43553]
 gi|292817644|gb|EFF76711.1| NAD-dependent DNA ligase LigA [Achromobacter piechaudii ATCC 43553]
          Length = 700

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D P  +D  YD +  +L+AL+ + PEL   + P   VG
Sbjct: 23  QHNVRYYVYDEPSISDAEYDGLMRQLEALEAEHPELITPESPTQRVG 69


>gi|153001196|ref|YP_001366877.1| DNA ligase, NAD-dependent [Shewanella baltica OS185]
 gi|166216241|sp|A6WPS5|DNLJ_SHEB8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|151365814|gb|ABS08814.1| DNA ligase, NAD-dependent [Shewanella baltica OS185]
          Length = 685

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+  +P L   D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQRLLKLEALYPHLIVADSPTQRVG 78


>gi|329121050|ref|ZP_08249681.1| NAD-dependent DNA ligase LigA [Dialister micraerophilus DSM 19965]
 gi|327471212|gb|EGF16666.1| NAD-dependent DNA ligase LigA [Dialister micraerophilus DSM 19965]
          Length = 666

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + +V+ L +   +H   YY LD P  +D  +D++   L   + ++PEL  +D P   V
Sbjct: 5   EIISKVKKLREELRYHSYLYYVLDKPEISDFEFDKMYRELVDFESKYPELITQDSPTQRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|325129804|gb|EGC52612.1| DNA ligase, NAD-dependent [Neisseria meningitidis OX99.30304]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   +  +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNLTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|194366356|ref|YP_002028966.1| NAD-dependent DNA ligase LigA [Stenotrophomonas maltophilia R551-3]
 gi|254781422|sp|B4SP88|DNLJ_STRM5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|194349160|gb|ACF52283.1| DNA ligase, NAD-dependent [Stenotrophomonas maltophilia R551-3]
          Length = 821

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 23  YHELDAPEIPDVDYDRMVRELEALEREHPELARADSPTQQVG 64


>gi|330752433|emb|CBL87383.1| DNA ligase [uncultured Flavobacteria bacterium]
          Length = 663

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  +D  +D   ++L  L+ Q+PEL D + P   VG
Sbjct: 17  HNHNYYVLDTPTISDFEFDIKLKKLQVLESQYPELSDPNSPTMRVG 62


>gi|325135742|gb|EGC58354.1| DNA ligase, NAD-dependent [Neisseria meningitidis M0579]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   +  +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNLTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALERNHPELKLPDSPTQRVG 85


>gi|254776288|ref|ZP_05217804.1| NAD-dependent DNA ligase LigA [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 681

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +    HQ  YY  D P+ +D  +D +   L AL+E+ PEL   D P   VG
Sbjct: 8   LAETVREHQFRYYIKDAPIISDAEFDALFNELLALEERHPELRVADSPTQLVG 60


>gi|254523079|ref|ZP_05135134.1| DNA ligase, NAD-dependent [Stenotrophomonas sp. SKA14]
 gi|219720670|gb|EED39195.1| DNA ligase, NAD-dependent [Stenotrophomonas sp. SKA14]
          Length = 821

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 23  YHELDAPEIPDVDYDRMVRELEALEREHPELARADSPTQQVG 64


>gi|217972882|ref|YP_002357633.1| DNA ligase, NAD-dependent [Shewanella baltica OS223]
 gi|254781416|sp|B8EEK5|DNLJ_SHEB2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|217498017|gb|ACK46210.1| DNA ligase, NAD-dependent [Shewanella baltica OS223]
          Length = 685

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+  +P L   D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQRLLKLEALYPHLIVADSPTQRVG 78


>gi|118465270|ref|YP_883031.1| NAD-dependent DNA ligase LigA [Mycobacterium avium 104]
 gi|166215821|sp|A0QJE3|DNLJ_MYCA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|118166557|gb|ABK67454.1| DNA ligase, NAD-dependent [Mycobacterium avium 104]
          Length = 693

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +    HQ  YY  D P+ +D  +D +   L AL+E+ PEL   D P   VG
Sbjct: 20  LAETVREHQFRYYIKDAPIISDAEFDALFNELLALEERHPELRVADSPTQLVG 72


>gi|160875869|ref|YP_001555185.1| DNA ligase, NAD-dependent [Shewanella baltica OS195]
 gi|190359285|sp|A9L5Z1|DNLJ_SHEB9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160861391|gb|ABX49925.1| DNA ligase, NAD-dependent [Shewanella baltica OS195]
 gi|315268060|gb|ADT94913.1| DNA ligase, NAD-dependent [Shewanella baltica OS678]
          Length = 685

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+  +P L   D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQRLLKLEALYPHLIVADSPTQRVG 78


>gi|304411949|ref|ZP_07393560.1| DNA ligase, NAD-dependent [Shewanella baltica OS183]
 gi|307303283|ref|ZP_07583038.1| DNA ligase, NAD-dependent [Shewanella baltica BA175]
 gi|304349809|gb|EFM14216.1| DNA ligase, NAD-dependent [Shewanella baltica OS183]
 gi|306913643|gb|EFN44065.1| DNA ligase, NAD-dependent [Shewanella baltica BA175]
          Length = 685

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+  +P L   D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQRLLKLEALYPHLIVADSPTQRVG 78


>gi|291544905|emb|CBL18014.1| DNA ligase, NAD-dependent [Ruminococcus sp. 18P13]
          Length = 660

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 28/61 (45%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A + +  L K    H   YY LD P   D  YD +   L A++ ++P+L     P   V
Sbjct: 5   QAKLRLAQLTKEIEQHNYAYYVLDAPTIEDCDYDALMRELKAIETEYPQLLSPHSPSQRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|329120426|ref|ZP_08249092.1| NAD-dependent DNA ligase LigA [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327462110|gb|EGF08438.1| NAD-dependent DNA ligase LigA [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 887

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 85  YYTLDAPSVPDAEYDRLFRELEALEAAHPELKLPDSPTQRVG 126


>gi|308061946|gb|ADO03834.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Cuz20]
          Length = 656

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+ + +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDSIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|317051097|ref|YP_004112213.1| DNA ligase, NAD-dependent [Desulfurispirillum indicum S5]
 gi|316946181|gb|ADU65657.1| DNA ligase, NAD-dependent [Desulfurispirillum indicum S5]
          Length = 660

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY L +P+  DG YD +   L AL+ +FP+    D P   +G
Sbjct: 23  YYTLADPIMGDGEYDGLYRELRALEARFPQYVHADSPTRRIG 64


>gi|121634462|ref|YP_974707.1| DNA ligase [Neisseria meningitidis FAM18]
 gi|166216218|sp|A1KSS7|DNLJ_NEIMF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120866168|emb|CAM09908.1| putative DNA ligase [Neisseria meningitidis FAM18]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|325137931|gb|EGC60506.1| DNA ligase, NAD-dependent [Neisseria meningitidis ES14902]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|77919807|ref|YP_357622.1| DNA ligase, NAD-dependent [Pelobacter carbinolicus DSM 2380]
 gi|123756590|sp|Q3A2F5|DNLJ_PELCD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77545890|gb|ABA89452.1| DNA ligase, NAD-dependent [Pelobacter carbinolicus DSM 2380]
          Length = 671

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 71  LH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LH H + YY  D P  TD  YDR+   L  L++ +PEL     P   VG
Sbjct: 17  LHRHSRLYYTYDRPEITDAEYDRLFRELLELEKAYPELVTAASPSLRVG 65


>gi|303247047|ref|ZP_07333322.1| DNA ligase, NAD-dependent [Desulfovibrio fructosovorans JJ]
 gi|302491473|gb|EFL51358.1| DNA ligase, NAD-dependent [Desulfovibrio fructosovorans JJ]
          Length = 693

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P+  D  YD +   L  L+   PEL D + P   VG
Sbjct: 21  HDYRYYVLDDPVIEDAAYDALYRELRKLETAHPELDDPNSPTKRVG 66


>gi|219850499|ref|YP_002464932.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
 gi|254781282|sp|B8GAC1|DNLJ_CHLAD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219544758|gb|ACL26496.1| DNA ligase, NAD-dependent [Chloroflexus aggregans DSM 9485]
          Length = 681

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E+  L++   +H   YY LD+P+ +D  YD +   L AL+   PEL   D P   V
Sbjct: 12  ELRTLIRRYDYH---YYVLDDPIVSDAEYDALMNELRALEAAHPELITPDSPTQRV 64


>gi|117927902|ref|YP_872453.1| DNA ligase, NAD-dependent [Acidothermus cellulolyticus 11B]
 gi|166215382|sp|A0LSQ7|DNLJ_ACIC1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|117648365|gb|ABK52467.1| DNA ligase, NAD-dependent [Acidothermus cellulolyticus 11B]
          Length = 695

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           LVK    H   YY LD P  +D  YD +   L+ ++  +PEL   D P   V
Sbjct: 23  LVKEIEEHAYRYYVLDAPTISDAEYDALMRELEEIENAYPELRTPDSPTQKV 74


>gi|325203753|gb|ADY99206.1| DNA ligase, NAD-dependent [Neisseria meningitidis M01-240355]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|295135415|ref|YP_003586091.1| DNA ligase [Zunongwangia profunda SM-A87]
 gi|294983430|gb|ADF53895.1| DNA ligase [Zunongwangia profunda SM-A87]
          Length = 812

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY LDNP  +D  +D   + L  L+E+ PE  D + P   VG
Sbjct: 16  HHNYQYYVLDNPEISDYDFDMKLKELQELEEKHPEFNDPNSPTQRVG 62


>gi|325131881|gb|EGC54581.1| DNA ligase, NAD-dependent [Neisseria meningitidis M6190]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|308388851|gb|ADO31171.1| DNA ligase [Neisseria meningitidis alpha710]
 gi|325202538|gb|ADY97992.1| DNA ligase, NAD-dependent [Neisseria meningitidis M01-240149]
 gi|325207712|gb|ADZ03164.1| DNA ligase, NAD-dependent [Neisseria meningitidis NZ-05/33]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 37/83 (44%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|254820448|ref|ZP_05225449.1| NAD-dependent DNA ligase LigA [Mycobacterium intracellulare ATCC
           13950]
          Length = 693

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +    HQ  YY  D P+ +D  +D +   L AL+E+ PEL   D P   VG
Sbjct: 20  LAEAVREHQFRYYIKDAPIISDAEFDSMFNELLALEERHPELRVADSPTQLVG 72


>gi|226325717|ref|ZP_03801235.1| hypothetical protein COPCOM_03530 [Coprococcus comes ATCC 27758]
 gi|225205841|gb|EEG88195.1| hypothetical protein COPCOM_03530 [Coprococcus comes ATCC 27758]
          Length = 687

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 52  TSLSKGEAMI--EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           T   KG++M    ++ LVK    ++  YY  D PL +D  YDR+ + L  L+EQ   +  
Sbjct: 19  TPQKKGDSMSVKRIKNLVKQLNEYRHAYYNQDAPLVSDAEYDRLFDELKELEEQTGFIL- 77

Query: 110 EDHPWNTVGY 119
            + P  TVGY
Sbjct: 78  SNSPTQTVGY 87


>gi|295090337|emb|CBK76444.1| DNA ligase, NAD-dependent [Clostridium cf. saccharolyticum K10]
          Length = 676

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           +++ LV+    H+  YY L+ P  +D  YDR+ ++L+ L+E+   ++  + P  TVGY
Sbjct: 17  KIKELVQTLNRHRHAYYNLNAPEISDAEYDRMYDQLERLEEETGIIY-SNSPTQTVGY 73


>gi|24374425|ref|NP_718468.1| DNA ligase, NAD-dependent [Shewanella oneidensis MR-1]
 gi|81460839|sp|Q8ED70|DNLJ_SHEON RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24348997|gb|AAN55912.1|AE015728_1 DNA ligase, NAD-dependent [Shewanella oneidensis MR-1]
          Length = 689

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ ++L  L+ ++P+    D P   VG
Sbjct: 37  HNIRYYVDDAPSITDSEYDRLMQQLKKLEAEYPQFVLADSPTQRVG 82


>gi|320157090|ref|YP_004189469.1| DNA ligase [Vibrio vulnificus MO6-24/O]
 gi|319932402|gb|ADV87266.1| DNA ligase [Vibrio vulnificus MO6-24/O]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 64  EYL--VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +YL  +K  LH H   YY  DNP   D  YDR+   L A++ + PE    D P   VG
Sbjct: 7   QYLEELKQQLHYHAVRYYVEDNPEIPDAEYDRMMRELMAIEAEHPEWISVDSPSQRVG 64


>gi|27363688|ref|NP_759216.1| NAD-dependent DNA ligase LigA [Vibrio vulnificus CMCP6]
 gi|81449211|sp|Q8DFK5|DNLJ_VIBVU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|27359804|gb|AAO08743.1| DNA ligase, NAD-dependent [Vibrio vulnificus CMCP6]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 64  EYL--VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +YL  +K  LH H   YY  DNP   D  YDR+   L A++ + PE    D P   VG
Sbjct: 7   QYLEELKQQLHYHAVRYYVEDNPEIPDAEYDRMMRELMAIEAEHPEWISVDSPSQRVG 64


>gi|221639033|ref|YP_002525295.1| DNA ligase [Rhodobacter sphaeroides KD131]
 gi|254781405|sp|B9KRK2|DNLJ_RHOSK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221159814|gb|ACM00794.1| DNA ligase [Rhodobacter sphaeroides KD131]
          Length = 704

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  R  A++EQFPEL   D P + VG
Sbjct: 33  YHTHDAPQISDADYDALRLRNRAIEEQFPELRRSDSPSDRVG 74


>gi|37679166|ref|NP_933775.1| NAD-dependent DNA ligase LigA [Vibrio vulnificus YJ016]
 gi|81758078|sp|Q7MMT5|DNLJ_VIBVY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|37197908|dbj|BAC93746.1| NAD-dependent DNA ligase [Vibrio vulnificus YJ016]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 64  EYL--VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +YL  +K  LH H   YY  DNP   D  YDR+   L A++ + PE    D P   VG
Sbjct: 7   QYLEELKQQLHYHAVRYYVEDNPEIPDAEYDRMMRELMAIEAEHPEWISVDSPSQRVG 64


>gi|297717812|gb|ADI50049.1| DNA ligase [Candidatus Odyssella thessalonicensis L13]
          Length = 676

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L K   +H + Y++ D P  +D  YD +  R   ++  FP+L  ED P   VG
Sbjct: 1   LAKTIAYHDELYFQKDMPQISDAAYDALVVRNRQIENLFPDLRREDSPSKRVG 53


>gi|261392961|emb|CAX50546.1| DNA ligase (polydeoxyribonucleotide synthase [NAD+]) [Neisseria
           meningitidis 8013]
          Length = 841

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YDR+  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDRLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PE    D P   VG
Sbjct: 63  ELEALELNHPEFKLPDSPTQRVG 85


>gi|302878427|ref|YP_003846991.1| DNA ligase, NAD-dependent [Gallionella capsiferriformans ES-2]
 gi|302581216|gb|ADL55227.1| DNA ligase, NAD-dependent [Gallionella capsiferriformans ES-2]
          Length = 674

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 20/46 (43%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD +   L  L+ Q PE    D P   VG
Sbjct: 20  HNYQYYVLDAPTVPDAGYDTLFRELQRLEAQHPEFLTSDSPTQRVG 65


>gi|113868039|ref|YP_726528.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
 gi|123133949|sp|Q0KA11|DNLJ_RALEH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|113526815|emb|CAJ93160.1| NAD-dependent DNA ligase [Ralstonia eutropha H16]
          Length = 709

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 38  HNYQYYVLDAPTIPDAEYDALFSELQALELEHPELQTPDSPTQRVG 83


>gi|229083590|ref|ZP_04215919.1| DNA ligase [Bacillus cereus Rock3-44]
 gi|228699722|gb|EEL52378.1| DNA ligase [Bacillus cereus Rock3-44]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK +A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEKAKQRIEELRDMLNACNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFLTEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TVRVG 65


>gi|154498024|ref|ZP_02036402.1| hypothetical protein BACCAP_02004 [Bacteroides capillosus ATCC
           29799]
 gi|150273014|gb|EDN00171.1| hypothetical protein BACCAP_02004 [Bacteroides capillosus ATCC
           29799]
          Length = 664

 Score = 37.7 bits (86), Expect = 0.46,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LDNP  +D  +D    RL+ L++  P+   ED P   VG
Sbjct: 21  YYVLDNPTMSDYDFDHKLRRLEELEQAHPDQITEDSPTRRVG 62


>gi|22298400|ref|NP_681647.1| NAD-dependent DNA ligase LigA [Thermosynechococcus elongatus BP-1]
 gi|81743454|sp|Q8DKK2|DNLJ_THEEB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|22294579|dbj|BAC08409.1| DNA ligase [Thermosynechococcus elongatus BP-1]
          Length = 689

 Score = 37.7 bits (86), Expect = 0.46,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D +YD++   L  L+  +PE    D P   +G
Sbjct: 25  YYALDQPIMEDEVYDQLYRELQELEAAYPEYITPDSPTQRIG 66


>gi|294497111|ref|YP_003560811.1| DNA ligase, NAD-dependent [Bacillus megaterium QM B1551]
 gi|294347048|gb|ADE67377.1| DNA ligase, NAD-dependent [Bacillus megaterium QM B1551]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.47,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L  ++E FPEL   D P   +G
Sbjct: 24  YYVLDQPSVPDAEYDKLMNELIEIEESFPELKTADSPTQRIG 65


>gi|319744895|gb|EFV97229.1| NAD-dependent DNA ligase LigA [Streptococcus agalactiae ATCC 13813]
          Length = 652

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L+EQ PE    + P + VG
Sbjct: 8   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEEQHPENILPNSPTHRVG 60


>gi|317455470|pdb|3PN1|A Chain A, Novel Bacterial Nad+-Dependent Dna Ligase Inhibitors With
           Broad Spectrum Potency And Antibacterial Efficacy In
           Vivo
          Length = 318

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|145627933|ref|ZP_01783734.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 22.1-21]
 gi|145640788|ref|ZP_01796371.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae R3021]
 gi|144979708|gb|EDJ89367.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 22.1-21]
 gi|145274714|gb|EDK14577.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae 22.4-21]
          Length = 278

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    ++  Y+ LDNP   D  YDR+  +L AL+ + PE    D P   VG
Sbjct: 7   QLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG 63


>gi|197117724|ref|YP_002138151.1| NAD-dependent DNA ligase [Geobacter bemidjiensis Bem]
 gi|254781337|sp|B5EIJ0|DNLJ_GEOBB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197087084|gb|ACH38355.1| DNA ligase, NAD-dependent [Geobacter bemidjiensis Bem]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.47,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 29/65 (44%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A   +++L      H + YY  D P  TD  YD +   L  L+  +P+L   D P
Sbjct: 1   MDKTAAAQRIKWLSSEIERHNRLYYEQDMPEITDAEYDALFRELKELEASYPDLALPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TGRVG 65


>gi|25010923|ref|NP_735318.1| NAD-dependent DNA ligase LigA [Streptococcus agalactiae NEM316]
 gi|81457056|sp|Q8E5W1|DNLJ_STRA3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|23095302|emb|CAD46512.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 652

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L+EQ PE    + P + VG
Sbjct: 8   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEEQHPENILPNSPTHRVG 60


>gi|187928361|ref|YP_001898848.1| DNA ligase [Ralstonia pickettii 12J]
 gi|254781397|sp|B2UB00|DNLJ_RALPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|187725251|gb|ACD26416.1| DNA ligase, NAD-dependent [Ralstonia pickettii 12J]
          Length = 817

 Score = 37.7 bits (86), Expect = 0.48,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + PEL   D P   VG
Sbjct: 35  YYVLDQPSVPDVEYDRLYRELEALETEHPELKTPDSPTLRVG 76


>gi|255021565|ref|ZP_05293608.1| DNA ligase [Acidithiobacillus caldus ATCC 51756]
 gi|254968953|gb|EET26472.1| DNA ligase [Acidithiobacillus caldus ATCC 51756]
          Length = 659

 Score = 37.7 bits (86), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YYR D P+ +D  YD +   L AL++  PEL   D P   VG
Sbjct: 10  YYRDDAPVMSDAEYDALLRELRALEDAHPELRVADSPTQRVG 51


>gi|42779416|ref|NP_976663.1| NAD-dependent DNA ligase LigA [Bacillus cereus ATCC 10987]
 gi|81411242|sp|Q73EM3|DNLJ_BACC1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|42735332|gb|AAS39271.1| DNA ligase, NAD-dependent [Bacillus cereus ATCC 10987]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|228919228|ref|ZP_04082598.1| DNA ligase [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228840335|gb|EEM85606.1| DNA ligase [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|229107967|ref|ZP_04237594.1| DNA ligase [Bacillus cereus Rock1-15]
 gi|228675470|gb|EEL30687.1| DNA ligase [Bacillus cereus Rock1-15]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|196045221|ref|ZP_03112453.1| DNA ligase, NAD-dependent [Bacillus cereus 03BB108]
 gi|196023805|gb|EDX62480.1| DNA ligase, NAD-dependent [Bacillus cereus 03BB108]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|161598439|ref|YP_120478.2| NAD-dependent DNA ligase LigA [Nocardia farcinica IFM 10152]
          Length = 710

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E  +  + L +    HQ  YY  D P+ +DG +D +   L  L+++ P+L   D P   V
Sbjct: 25  EDRVRWQRLAEEVREHQFRYYVRDAPIISDGEFDALLRELQELEDRHPDLRTPDSPTQLV 84

Query: 118 G 118
           G
Sbjct: 85  G 85


>gi|324324305|gb|ADY19565.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|319946751|ref|ZP_08020985.1| NAD-dependent DNA ligase LigA [Streptococcus australis ATCC 700641]
 gi|319746799|gb|EFV99058.1| NAD-dependent DNA ligase LigA [Streptococcus australis ATCC 700641]
          Length = 652

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  H+ + YY  D P  +D  YD++   L AL+E  PEL   + P + VG
Sbjct: 8   LVTLLNHYAEEYYTKDAPSVSDYEYDKLYRELVALEEAHPELVQPNSPTHRVG 60


>gi|300118925|ref|ZP_07056636.1| NAD-dependent DNA ligase LigA [Bacillus cereus SJ1]
 gi|298723541|gb|EFI64272.1| NAD-dependent DNA ligase LigA [Bacillus cereus SJ1]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|256826919|ref|YP_003150878.1| DNA ligase, NAD-dependent [Cryptobacterium curtum DSM 15641]
 gi|256583062|gb|ACU94196.1| DNA ligase, NAD-dependent [Cryptobacterium curtum DSM 15641]
          Length = 725

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 71  LHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + H  W YY  D P  +D  +D +   L  L+ + PE +D   P   VG
Sbjct: 26  IEHNSWLYYAQDAPAISDAAFDSLMRELRQLEAEHPEFYDPTSPTQRVG 74


>gi|229194680|ref|ZP_04321473.1| DNA ligase [Bacillus cereus m1293]
 gi|228588783|gb|EEK46808.1| DNA ligase [Bacillus cereus m1293]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|206974389|ref|ZP_03235306.1| DNA ligase, NAD-dependent [Bacillus cereus H3081.97]
 gi|217957864|ref|YP_002336408.1| NAD-dependent DNA ligase LigA [Bacillus cereus AH187]
 gi|254781553|sp|B7HSW5|DNLJ_BACC7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781554|sp|B9J1L6|DNLJ_BACCQ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206747629|gb|EDZ59019.1| DNA ligase, NAD-dependent [Bacillus cereus H3081.97]
 gi|217064176|gb|ACJ78426.1| DNA ligase, NAD-dependent [Bacillus cereus AH187]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|318059490|ref|ZP_07978213.1| NAD-dependent DNA ligase LigA [Streptomyces sp. SA3_actG]
 gi|318076490|ref|ZP_07983822.1| NAD-dependent DNA ligase LigA [Streptomyces sp. SA3_actF]
          Length = 783

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D +  RL AL+E+ P+L   D P   V 
Sbjct: 50  HRYRYYVNDQPVVSDAQFDELLRRLTALEEEHPQLRTPDSPTQKVA 95


>gi|302522063|ref|ZP_07274405.1| DNA ligase, NAD-dependent [Streptomyces sp. SPB78]
 gi|302430958|gb|EFL02774.1| DNA ligase, NAD-dependent [Streptomyces sp. SPB78]
          Length = 783

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D +  RL AL+E+ P+L   D P   V 
Sbjct: 50  HRYRYYVNDQPVVSDAQFDELLRRLTALEEEHPQLRTPDSPTQKVA 95


>gi|29829290|ref|NP_823924.1| NAD-dependent DNA ligase LigA [Streptomyces avermitilis MA-4680]
 gi|81719851|sp|Q82JK7|DNLJ_STRAW RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|29606397|dbj|BAC70459.1| putative DNA ligase [Streptomyces avermitilis MA-4680]
          Length = 730

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D +   L+AL+E++PEL   D P   V 
Sbjct: 30  HRFRYYVKDAPVVSDAEFDTLLRSLEALEEEYPELRTPDSPTQKVA 75


>gi|42519595|ref|NP_965525.1| NAD-dependent DNA ligase [Lactobacillus johnsonii NCC 533]
 gi|81667534|sp|Q74I49|DNLJ_LACJO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|41583884|gb|AAS09491.1| NAD-dependent DNA ligase [Lactobacillus johnsonii NCC 533]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D P+  D +YD+  + L  L+EQFP+L   D     VG
Sbjct: 22  KWADDYYAKDAPVVEDAVYDKTYQELVELEEQFPDLVTADSITQRVG 68


>gi|77414096|ref|ZP_00790264.1| DNA ligase, NAD-dependent [Streptococcus agalactiae 515]
 gi|77159848|gb|EAO70991.1| DNA ligase, NAD-dependent [Streptococcus agalactiae 515]
          Length = 648

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L+EQ PE    + P + VG
Sbjct: 4   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEEQHPENILPNSPTHRVG 56


>gi|229101110|ref|ZP_04231876.1| DNA ligase [Bacillus cereus Rock3-28]
 gi|228682238|gb|EEL36349.1| DNA ligase [Bacillus cereus Rock3-28]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|218895413|ref|YP_002443824.1| DNA ligase, NAD-dependent [Bacillus cereus G9842]
 gi|228963387|ref|ZP_04124548.1| DNA ligase [Bacillus thuringiensis serovar sotto str. T04001]
 gi|254781550|sp|B7IUW5|DNLJ_BACC2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218545091|gb|ACK97485.1| DNA ligase, NAD-dependent [Bacillus cereus G9842]
 gi|228796281|gb|EEM43728.1| DNA ligase [Bacillus thuringiensis serovar sotto str. T04001]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|49479078|ref|YP_034626.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|118476055|ref|YP_893206.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis str. Al
           Hakam]
 gi|225862344|ref|YP_002747722.1| DNA ligase, NAD-dependent [Bacillus cereus 03BB102]
 gi|229182688|ref|ZP_04309929.1| DNA ligase [Bacillus cereus BGSC 6E1]
 gi|81397398|sp|Q6HP94|DNLJ_BACHK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215395|sp|A0R906|DNLJ_BACAH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781551|sp|C1EV74|DNLJ_BACC3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|49330634|gb|AAT61280.1| DNA ligase(NAD+) (NAD-dependent DNA ligase) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|118415280|gb|ABK83699.1| NAD-dependent DNA ligase [Bacillus thuringiensis str. Al Hakam]
 gi|225789655|gb|ACO29872.1| DNA ligase (NAD(+)) [Bacillus cereus 03BB102]
 gi|228600773|gb|EEK58352.1| DNA ligase [Bacillus cereus BGSC 6E1]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|30018549|ref|NP_830180.1| NAD-dependent DNA ligase LigA [Bacillus cereus ATCC 14579]
 gi|229125792|ref|ZP_04254818.1| DNA ligase [Bacillus cereus BDRD-Cer4]
 gi|81436035|sp|Q81IP2|DNLJ_BACCR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|29894090|gb|AAP07381.1| NAD-dependent DNA ligase [Bacillus cereus ATCC 14579]
 gi|228657649|gb|EEL13461.1| DNA ligase [Bacillus cereus BDRD-Cer4]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|163845839|ref|YP_001633883.1| DNA ligase [Chloroflexus aurantiacus J-10-fl]
 gi|222523550|ref|YP_002568020.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
 gi|190359243|sp|A9WCA1|DNLJ_CHLAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781286|sp|B9LHI6|DNLJ_CHLSY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163667128|gb|ABY33494.1| DNA ligase, NAD-dependent [Chloroflexus aurantiacus J-10-fl]
 gi|222447429|gb|ACM51695.1| DNA ligase, NAD-dependent [Chloroflexus sp. Y-400-fl]
          Length = 709

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E+  L++   +H   YY LD+P+ +D  YD +   L AL+   PEL   D P   V
Sbjct: 12  ELRSLIRRYDYH---YYVLDDPIVSDAEYDALMTELRALEAAHPELITPDSPTQRV 64


>gi|317485271|ref|ZP_07944151.1| DNA ligase [Bilophila wadsworthia 3_1_6]
 gi|316923397|gb|EFV44603.1| DNA ligase [Bilophila wadsworthia 3_1_6]
          Length = 698

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L    ++H   Y+ LD P  TD  Y+   + L  L+E+ PE    D P N +G
Sbjct: 19  LEELRAFVIYHNHRYHTLDAPEITDDEYNAAFQELLRLEERHPEWRSPDSPTNRIG 74


>gi|52144941|ref|YP_081888.1| NAD-dependent DNA ligase LigA [Bacillus cereus E33L]
 gi|81689708|sp|Q63GS3|DNLJ_BACCZ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|51978410|gb|AAU19960.1| DNA ligase(NAD+) (NAD-dependent DNA ligase) [Bacillus cereus E33L]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|107028796|ref|YP_625891.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia AU 1054]
 gi|105897960|gb|ABF80918.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia AU 1054]
          Length = 746

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 86  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 127


>gi|328473436|gb|EGF44284.1| NAD-dependent DNA ligase LigA [Vibrio parahaemolyticus 10329]
          Length = 670

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ Q P+L   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTVDSPSQRVG 64


>gi|301052018|ref|YP_003790229.1| DNA ligase [Bacillus anthracis CI]
 gi|300374187|gb|ADK03091.1| DNA ligase [Bacillus cereus biovar anthracis str. CI]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|206560458|ref|YP_002231222.1| DNA ligase [Burkholderia cenocepacia J2315]
 gi|254781275|sp|B4ECN6|DNLJ_BURCJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|198036499|emb|CAR52396.1| DNA ligase [Burkholderia cenocepacia J2315]
          Length = 691

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 72


>gi|170733380|ref|YP_001765327.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia MC0-3]
 gi|254781274|sp|B1JUF5|DNLJ_BURCC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169816622|gb|ACA91205.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia MC0-3]
          Length = 691

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 72


>gi|313114130|ref|ZP_07799682.1| DNA ligase, NAD-dependent [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310623539|gb|EFQ06942.1| DNA ligase, NAD-dependent [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 666

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 28/61 (45%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A   VE L  +   + + YY  D P   D  YD ++  L  L+ QFP+L     P   V
Sbjct: 8   QAKKRVEELRAVIEKNNRLYYDQDAPELEDFEYDALTRELKELEAQFPQLVTASSPTQKV 67

Query: 118 G 118
           G
Sbjct: 68  G 68


>gi|229095009|ref|ZP_04226005.1| DNA ligase [Bacillus cereus Rock3-29]
 gi|229113962|ref|ZP_04243388.1| DNA ligase [Bacillus cereus Rock1-3]
 gi|228669421|gb|EEL24837.1| DNA ligase [Bacillus cereus Rock1-3]
 gi|228688339|gb|EEL42221.1| DNA ligase [Bacillus cereus Rock3-29]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|116690045|ref|YP_835668.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia HI2424]
 gi|166215562|sp|A0K8E8|DNLJ_BURCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215593|sp|Q1BHI7|DNLJ_BURCA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116648134|gb|ABK08775.1| DNA ligase, NAD-dependent [Burkholderia cenocepacia HI2424]
          Length = 691

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 72


>gi|30249713|ref|NP_841783.1| NAD-dependent DNA ligase [Nitrosomonas europaea ATCC 19718]
 gi|75540341|sp|Q82TW6|DNLJ_NITEU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|30180750|emb|CAD85664.1| NAD-dependent DNA ligase [Nitrosomonas europaea ATCC 19718]
          Length = 681

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 69  IALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           IALH    YY  D P+  D  YD +   L  L++Q+P L   D P   VG
Sbjct: 18  IALHDFH-YYVQDAPVIPDAEYDALFRTLQQLEQQYPHLVTPDSPTQRVG 66


>gi|254247879|ref|ZP_04941200.1| NAD-dependent DNA ligase [Burkholderia cenocepacia PC184]
 gi|124872655|gb|EAY64371.1| NAD-dependent DNA ligase [Burkholderia cenocepacia PC184]
          Length = 691

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 72


>gi|28897574|ref|NP_797179.1| NAD-dependent DNA ligase LigA [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260878266|ref|ZP_05890621.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AN-5034]
 gi|260895418|ref|ZP_05903914.1| DNA ligase (NAD+) [Vibrio parahaemolyticus Peru-466]
 gi|260903353|ref|ZP_05911748.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AQ4037]
 gi|81728289|sp|Q87RJ4|DNLJ_VIBPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|28805786|dbj|BAC59063.1| DNA ligase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088617|gb|EFO38312.1| DNA ligase (NAD+) [Vibrio parahaemolyticus Peru-466]
 gi|308090169|gb|EFO39864.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AN-5034]
 gi|308107994|gb|EFO45534.1| DNA ligase (NAD+) [Vibrio parahaemolyticus AQ4037]
          Length = 670

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ Q P+L   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTVDSPSQRVG 64


>gi|17229209|ref|NP_485757.1| NAD-dependent DNA ligase LigA [Nostoc sp. PCC 7120]
 gi|81772126|sp|Q8YW98|DNLJ_ANASP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|17135537|dbj|BAB78083.1| DNA ligase [Nostoc sp. PCC 7120]
          Length = 677

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           VE L ++       YY  D P+  D +YD++   L  L+ Q PEL   D P   +G
Sbjct: 11  VEELRRLLQQASYAYYVSDAPIMEDAVYDQLYRELQQLEIQHPELVTPDSPTQRIG 66


>gi|333024269|ref|ZP_08452333.1| putative NAD-dependent DNA ligase LigA [Streptomyces sp. Tu6071]
 gi|332744121|gb|EGJ74562.1| putative NAD-dependent DNA ligase LigA [Streptomyces sp. Tu6071]
          Length = 771

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D +  RL AL+E+ P+L   D P   V 
Sbjct: 50  HRYRYYVNDQPVVSDAQFDELLRRLTALEEEHPQLRTPDSPTQKVA 95


>gi|229042193|ref|ZP_04189947.1| DNA ligase [Bacillus cereus AH676]
 gi|228727128|gb|EEL78331.1| DNA ligase [Bacillus cereus AH676]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|218230787|ref|YP_002365135.1| NAD-dependent DNA ligase LigA [Bacillus cereus B4264]
 gi|254781552|sp|B7H4U8|DNLJ_BACC4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218158744|gb|ACK58736.1| DNA ligase (NAD(+)) [Bacillus cereus B4264]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|81373659|sp|Q5YRS7|DNLJ2_NOCFA RecName: Full=DNA ligase 2; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 2
 gi|54017744|dbj|BAD59114.1| putative DNA ligase [Nocardia farcinica IFM 10152]
          Length = 683

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +DG +D +   L  L+++ P+L   D P   VG
Sbjct: 13  HQFRYYVRDAPIISDGEFDALLRELQELEDRHPDLRTPDSPTQLVG 58


>gi|228956728|ref|ZP_04118514.1| DNA ligase [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|229143090|ref|ZP_04271523.1| DNA ligase [Bacillus cereus BDRD-ST24]
 gi|296501121|ref|YP_003662821.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis BMB171]
 gi|228640363|gb|EEK96760.1| DNA ligase [Bacillus cereus BDRD-ST24]
 gi|228802916|gb|EEM49748.1| DNA ligase [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|296322173|gb|ADH05101.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis BMB171]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|229148695|ref|ZP_04276945.1| DNA ligase [Bacillus cereus m1550]
 gi|228634703|gb|EEK91282.1| DNA ligase [Bacillus cereus m1550]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|302554316|ref|ZP_07306658.1| DNA ligase, NAD-dependent [Streptomyces viridochromogenes DSM
           40736]
 gi|302471934|gb|EFL35027.1| DNA ligase, NAD-dependent [Streptomyces viridochromogenes DSM
           40736]
          Length = 731

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           DK  + T++   EA  +   L +    H+  YY  D P+ +D  +D++   L+AL++++P
Sbjct: 4   DKQAETTTVP-AEAREKHARLAEQIEEHRFRYYVKDAPVVSDAEFDQLLRSLEALEDEYP 62

Query: 106 ELFDEDHPWNTVG 118
           EL   D P   V 
Sbjct: 63  ELRTPDSPTQKVA 75


>gi|153838362|ref|ZP_01991029.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus AQ3810]
 gi|149748221|gb|EDM59080.1| DNA ligase, NAD-dependent [Vibrio parahaemolyticus AQ3810]
          Length = 670

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ Q P+L   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTVDSPSQRVG 64


>gi|227494609|ref|ZP_03924925.1| DNA ligase (NAD(+)) [Actinomyces coleocanis DSM 15436]
 gi|226832343|gb|EEH64726.1| DNA ligase (NAD(+)) [Actinomyces coleocanis DSM 15436]
          Length = 806

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD + E L  L+ ++P L   D P  TVG
Sbjct: 51  YYNLDAPTASDAEYDVLFEELKDLEAKWPMLVTPDSPTQTVG 92


>gi|150025890|ref|YP_001296716.1| DNA ligase (NAD+) [Flavobacterium psychrophilum JIP02/86]
 gi|166215404|sp|A6H0N9|DNLJ_FLAPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|149772431|emb|CAL43913.1| DNA ligase (NAD+) [Flavobacterium psychrophilum JIP02/86]
          Length = 666

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNP  +D  +D     L +L++  PE FDE+ P   VG
Sbjct: 17  HNYNYYVLDNPTISDYDFDVKLTDLQSLEKNNPEYFDENSPTQRVG 62


>gi|59712497|ref|YP_205273.1| NAD-dependent DNA ligase LigA [Vibrio fischeri ES114]
 gi|75353581|sp|Q5E3L1|DNLJ_VIBF1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|59480598|gb|AAW86385.1| DNA ligase, NAD(+)-dependent [Vibrio fischeri ES114]
          Length = 668

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P   D  YDR+ ++L +++ + PEL   D P   VG
Sbjct: 16  YHAYRYYVEDSPELPDAEYDRMMQQLLSIESEHPELVTVDSPSQRVG 62


>gi|298372045|ref|ZP_06982035.1| DNA ligase, NAD-dependent [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274949|gb|EFI16500.1| DNA ligase, NAD-dependent [Bacteroidetes oral taxon 274 str. F0058]
          Length = 670

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  +NP  +D  +D   ++L+++++ +PE FD++ P   VG
Sbjct: 20  HNHAYYVDNNPTISDFEFDMRLKQLESMEKAYPEYFDKNSPTQRVG 65


>gi|145298235|ref|YP_001141076.1| NAD-dependent DNA ligase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166215387|sp|A4SKA6|DNLJ_AERS4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|142851007|gb|ABO89328.1| NAD-dependent DNA ligase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 664

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LDNP   D  YDR+   L A++ + PEL     P   VG
Sbjct: 20  HQ--YYVLDNPTVPDAEYDRLMRELIAIESEHPELKTSASPSVRVG 63


>gi|78066803|ref|YP_369572.1| DNA ligase (NAD+) [Burkholderia sp. 383]
 gi|123742568|sp|Q39F38|DNLJ_BURS3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|77967548|gb|ABB08928.1| DNA ligase (NAD+) [Burkholderia sp. 383]
          Length = 691

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLETDHPELVTPDSPTQRVG 72


>gi|254724765|ref|ZP_05186548.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. A1055]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229496499|ref|ZP_04390213.1| DNA ligase, NAD-dependent [Porphyromonas endodontalis ATCC 35406]
 gi|229316396|gb|EEN82315.1| DNA ligase, NAD-dependent [Porphyromonas endodontalis ATCC 35406]
          Length = 671

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY L  PL +D  +DR+ ++L  L+ Q PEL     P   VG
Sbjct: 17  QHNYRYYVLSTPLISDVEFDRLMQQLIDLEAQHPELITPTSPTQRVG 63


>gi|228931797|ref|ZP_04094693.1| DNA ligase [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228827777|gb|EEM73515.1| DNA ligase [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229028145|ref|ZP_04184287.1| DNA ligase [Bacillus cereus AH1271]
 gi|228733163|gb|EEL84003.1| DNA ligase [Bacillus cereus AH1271]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|228937587|ref|ZP_04100225.1| DNA ligase [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228970474|ref|ZP_04131125.1| DNA ligase [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228977043|ref|ZP_04137446.1| DNA ligase [Bacillus thuringiensis Bt407]
 gi|228782660|gb|EEM30835.1| DNA ligase [Bacillus thuringiensis Bt407]
 gi|228789206|gb|EEM37134.1| DNA ligase [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228822068|gb|EEM68058.1| DNA ligase [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|326938080|gb|AEA13976.1| NAD-dependent DNA ligase LigA [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|218901495|ref|YP_002449329.1| DNA ligase, NAD-dependent [Bacillus cereus AH820]
 gi|254781549|sp|B7JM96|DNLJ_BACC0 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218535434|gb|ACK87832.1| DNA ligase, NAD-dependent [Bacillus cereus AH820]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SIRVG 65


>gi|30260478|ref|NP_842855.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Ames]
 gi|49183320|ref|YP_026572.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Sterne]
 gi|50196911|ref|YP_052606.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|65317730|ref|ZP_00390689.1| COG0272: NAD-dependent DNA ligase (contains BRCT domain type II)
           [Bacillus anthracis str. A2012]
 gi|165871348|ref|ZP_02215996.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0488]
 gi|167634237|ref|ZP_02392559.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0442]
 gi|167640082|ref|ZP_02398349.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0193]
 gi|170688355|ref|ZP_02879564.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0465]
 gi|170708762|ref|ZP_02899199.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0389]
 gi|177653653|ref|ZP_02935792.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0174]
 gi|190567340|ref|ZP_03020254.1| DNA ligase, NAD-dependent [Bacillus anthracis Tsiankovskii-I]
 gi|190567489|ref|ZP_03020402.1| DNA ligase, NAD-dependent [Bacillus anthracis Tsiankovskii-I]
 gi|196034623|ref|ZP_03102031.1| DNA ligase, NAD-dependent [Bacillus cereus W]
 gi|227812970|ref|YP_002812979.1| DNA ligase, NAD-dependent [Bacillus anthracis str. CDC 684]
 gi|228913034|ref|ZP_04076673.1| DNA ligase [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228925550|ref|ZP_04088639.1| DNA ligase [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
 gi|228944102|ref|ZP_04106481.1| DNA ligase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229119952|ref|ZP_04249207.1| DNA ligase [Bacillus cereus 95/8201]
 gi|229604913|ref|YP_002864923.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0248]
 gi|254686689|ref|ZP_05150547.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. CNEVA-9066]
 gi|254739086|ref|ZP_05196788.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Western
           North America USA6153]
 gi|254742292|ref|ZP_05199978.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Kruger B]
 gi|254756068|ref|ZP_05208097.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Vollum]
 gi|254761885|ref|ZP_05213734.1| NAD-dependent DNA ligase LigA [Bacillus anthracis str. Australia
           94]
 gi|81584374|sp|Q81ZG1|DNLJ_BACAN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781547|sp|C3PBP1|DNLJ_BACAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781548|sp|C3L543|DNLJ_BACAC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|30253846|gb|AAP24341.1| DNA ligase (NAD(+)) [Bacillus anthracis str. Ames]
 gi|49177247|gb|AAT52623.1| DNA ligase, NAD-dependent [Bacillus anthracis str. Sterne]
 gi|50082973|gb|AAT70114.1| DNA ligase, NAD-dependent [Bacillus anthracis str. 'Ames Ancestor']
 gi|164712832|gb|EDR18361.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0488]
 gi|167511893|gb|EDR87272.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0193]
 gi|167530551|gb|EDR93266.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0442]
 gi|170126341|gb|EDS95231.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0389]
 gi|170667687|gb|EDT18441.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0465]
 gi|172081233|gb|EDT66308.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0174]
 gi|190561276|gb|EDV15248.1| DNA ligase, NAD-dependent [Bacillus anthracis Tsiankovskii-I]
 gi|190561467|gb|EDV15438.1| DNA ligase, NAD-dependent [Bacillus anthracis Tsiankovskii-I]
 gi|195992666|gb|EDX56626.1| DNA ligase, NAD-dependent [Bacillus cereus W]
 gi|227002604|gb|ACP12347.1| DNA ligase (NAD(+)) [Bacillus anthracis str. CDC 684]
 gi|228663418|gb|EEL19003.1| DNA ligase [Bacillus cereus 95/8201]
 gi|228815491|gb|EEM61733.1| DNA ligase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228834028|gb|EEM79576.1| DNA ligase [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
 gi|228846439|gb|EEM91452.1| DNA ligase [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229269321|gb|ACQ50958.1| DNA ligase, NAD-dependent [Bacillus anthracis str. A0248]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|296046585|gb|ADG86434.1| NAD-dependent DNA ligase [Francisella novicida]
          Length = 670

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L      H   YY  D P   D  YDR+ +RL  L+  +P+    D P   VG
Sbjct: 7   EMDQLTHTINQHNIRYYVDDAPSIPDAEYDRLIKRLTELERDYPQFKSVDSPTQRVG 63


>gi|228983547|ref|ZP_04143752.1| DNA ligase [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228776143|gb|EEM24504.1| DNA ligase [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229159446|ref|ZP_04287464.1| DNA ligase [Bacillus cereus R309803]
 gi|228624017|gb|EEK80825.1| DNA ligase [Bacillus cereus R309803]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|300783591|ref|YP_003763882.1| DNA ligase (NAD+) [Amycolatopsis mediterranei U32]
 gi|299793105|gb|ADJ43480.1| DNA ligase (NAD+) [Amycolatopsis mediterranei U32]
          Length = 726

 Score = 37.7 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD+P+ +DG +D +   L  L++  P L   + P   VG
Sbjct: 44  HQFRYYVLDSPIISDGQFDELLGELQRLEDAHPALVTPESPTQRVG 89


>gi|228906068|ref|ZP_04069957.1| DNA ligase [Bacillus thuringiensis IBL 200]
 gi|228853477|gb|EEM98245.1| DNA ligase [Bacillus thuringiensis IBL 200]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|229154059|ref|ZP_04282184.1| DNA ligase [Bacillus cereus ATCC 4342]
 gi|228629339|gb|EEK86041.1| DNA ligase [Bacillus cereus ATCC 4342]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229089420|ref|ZP_04220691.1| DNA ligase [Bacillus cereus Rock3-42]
 gi|228693897|gb|EEL47589.1| DNA ligase [Bacillus cereus Rock3-42]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229171138|ref|ZP_04298732.1| DNA ligase [Bacillus cereus MM3]
 gi|228612316|gb|EEK69544.1| DNA ligase [Bacillus cereus MM3]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKQRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SIRVG 65


>gi|196040110|ref|ZP_03107412.1| DNA ligase (NAD(+)) [Bacillus cereus NVH0597-99]
 gi|196028965|gb|EDX67570.1| DNA ligase (NAD(+)) [Bacillus cereus NVH0597-99]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|307729327|ref|YP_003906551.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1003]
 gi|307583862|gb|ADN57260.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1003]
          Length = 688

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L++++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDRLFKELESIEAEHPDLIVPDSPTQRVG 73


>gi|289422752|ref|ZP_06424592.1| DNA ligase (NAD(+)) [Peptostreptococcus anaerobius 653-L]
 gi|289156931|gb|EFD05556.1| DNA ligase (NAD(+)) [Peptostreptococcus anaerobius 653-L]
          Length = 700

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP  +D  YDR+   L  L++++P+L   D P   VG
Sbjct: 41  YHSDSYYNKDNPEISDYQYDRMMRCLIGLEDKYPDLKAPDSPSVRVG 87


>gi|312197574|ref|YP_004017635.1| hypothetical protein FraEuI1c_3758 [Frankia sp. EuI1c]
 gi|311228910|gb|ADP81765.1| hypothetical protein FraEuI1c_3758 [Frankia sp. EuI1c]
          Length = 347

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 13/103 (12%)

Query: 4   FDRVFRSSKFENEHNITPAQWKKLLTLE---AKFLPNKRALESWLDKAKKVTS------- 53
           FD        E    + PA W  LL  E   A   P+  ALE+WL  A+++ +       
Sbjct: 113 FDLPPAGRTPEAAVELLPAAWADLLAREPELAAMFPDGEALEAWLASARELLAGYFALED 172

Query: 54  ---LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRV 93
              L+     + VE+++   L  + +  RLD     DGL  RV
Sbjct: 173 PRRLAPAARELYVEHVLGSGLRLRGYVDRLDEATTPDGLALRV 215


>gi|163731899|ref|ZP_02139346.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
 gi|161395353|gb|EDQ19675.1| DNA ligase, NAD-dependent [Roseobacter litoralis Och 149]
          Length = 705

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 32/66 (48%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SL++  A  E+  L ++       Y+  D P  +D  YD    R  AL+++FP L   D 
Sbjct: 8   SLNEKAAEEELSRLAELLEQANTAYHTKDAPFMSDAEYDAYKRRNLALEDRFPHLKRADS 67

Query: 113 PWNTVG 118
           P + VG
Sbjct: 68  PTDVVG 73


>gi|75759916|ref|ZP_00739987.1| NAD-dependent DNA ligase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228899023|ref|ZP_04063296.1| DNA ligase [Bacillus thuringiensis IBL 4222]
 gi|74492583|gb|EAO55728.1| NAD-dependent DNA ligase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228860598|gb|EEN04985.1| DNA ligase [Bacillus thuringiensis IBL 4222]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK  A   +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIELEAENPEFMSEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|328956034|ref|YP_004373367.1| DNA ligase, NAD-dependent [Coriobacterium glomerans PW2]
 gi|328456358|gb|AEB07552.1| DNA ligase, NAD-dependent [Coriobacterium glomerans PW2]
          Length = 752

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 38/84 (45%)

Query: 35  LPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVS 94
           +P + + +S    A  +TS +        E L ++  +H   YY LD P  +D  +DR+ 
Sbjct: 20  MPGEASKDSTAQPAGHMTSTAAVPPAERAEELRRLLDYHAYRYYALDAPEISDAQFDRLL 79

Query: 95  ERLDALQEQFPELFDEDHPWNTVG 118
             L  ++ + P+L   D     VG
Sbjct: 80  RELQQIEVEHPDLITPDSYTQRVG 103


>gi|126726435|ref|ZP_01742276.1| DNA ligase [Rhodobacterales bacterium HTCC2150]
 gi|126704298|gb|EBA03390.1| DNA ligase [Rhodobacterales bacterium HTCC2150]
          Length = 705

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 32/70 (45%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           K    ++  EA  E++ L K+       Y+  D P  +D  YDR+      ++  FP+L 
Sbjct: 3   KNPLDMTMAEARSELKRLAKVIAAANSSYHTADAPEISDAEYDRLRRLNSEIEAAFPDLK 62

Query: 109 DEDHPWNTVG 118
             D P + VG
Sbjct: 63  RADSPSDNVG 72


>gi|323526494|ref|YP_004228647.1| NAD-dependent DNA ligase [Burkholderia sp. CCGE1001]
 gi|323383496|gb|ADX55587.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1001]
          Length = 688

 Score = 37.7 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L++++ Q P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDKLFKELESIEAQHPDLIVPDSPTQRVG 73


>gi|300021787|ref|YP_003754398.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523608|gb|ADJ22077.1| DNA ligase, NAD-dependent [Hyphomicrobium denitrificans ATCC 51888]
          Length = 712

 Score = 37.7 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YYR D P  +D  YD +  RL  L++  PEL     P   VG
Sbjct: 37  HDELYYRNDAPEISDADYDALRRRLTQLEDAHPELKRAGSPSEKVG 82


>gi|319789848|ref|YP_004151481.1| DNA ligase, NAD-dependent [Thermovibrio ammonificans HB-1]
 gi|317114350|gb|ADU96840.1| DNA ligase, NAD-dependent [Thermovibrio ammonificans HB-1]
          Length = 723

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           LS  EA    E L ++  +H   YY   NP+ +D  YD++   L+AL++  PE+   D P
Sbjct: 32  LSTEEARELAEKLRRVIRYHDYKYYVQANPVISDYQYDKLFHALEALEKAHPEVVTPDSP 91

Query: 114 WNTV 117
              +
Sbjct: 92  TQRI 95


>gi|308182775|ref|YP_003926902.1| NAD-dependent DNA ligase LigA [Helicobacter pylori PeCan4]
 gi|308064960|gb|ADO06852.1| NAD-dependent DNA ligase LigA [Helicobacter pylori PeCan4]
          Length = 656

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD  + +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDESIVSDAVYDELYQELKAYEEKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|283850424|ref|ZP_06367713.1| DNA ligase, NAD-dependent [Desulfovibrio sp. FW1012B]
 gi|283574450|gb|EFC22421.1| DNA ligase, NAD-dependent [Desulfovibrio sp. FW1012B]
          Length = 697

 Score = 37.7 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P   D  YD +   L  L+   PEL D + P   VG
Sbjct: 22  HNHRYYVLDDPQIEDAAYDALYRELVTLEAAHPELADPNSPTRRVG 67


>gi|226356158|ref|YP_002785898.1| DNA ligase (NAD(+)) [Deinococcus deserti VCD115]
 gi|254778151|sp|C1CVC7|DNLJ2_DEIDV RecName: Full=DNA ligase 2; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 2
 gi|226318148|gb|ACO46144.1| putative DNA ligase (NAD(+)) [Deinococcus deserti VCD115]
          Length = 686

 Score = 37.7 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY  D P  +D  YD ++  L  ++ + PE  ++D P  T+G
Sbjct: 23  HNRAYYEQDAPEISDDEYDALARALRDMEARHPEWVEDDSPVQTIG 68


>gi|148927169|ref|ZP_01810794.1| DNA ligase, NAD-dependent [candidate division TM7 genomosp. GTL1]
 gi|147887384|gb|EDK72833.1| DNA ligase, NAD-dependent [candidate division TM7 genomosp. GTL1]
          Length = 675

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD +   L  L+ + PEL   D P   VG
Sbjct: 24  YYVLDRPSVADAIYDSLFGELKKLEAEHPELITADSPTQRVG 65


>gi|296158912|ref|ZP_06841740.1| DNA ligase, NAD-dependent [Burkholderia sp. Ch1-1]
 gi|295890787|gb|EFG70577.1| DNA ligase, NAD-dependent [Burkholderia sp. Ch1-1]
          Length = 688

 Score = 37.4 bits (85), Expect = 0.60,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L++++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDRLFKELESIETEHPDLIVPDSPTQRVG 73


>gi|91784125|ref|YP_559331.1| NAD-dependent DNA ligase [Burkholderia xenovorans LB400]
 gi|123358676|sp|Q13XB0|DNLJ_BURXL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91688079|gb|ABE31279.1| NAD-dependent DNA ligase [Burkholderia xenovorans LB400]
          Length = 688

 Score = 37.4 bits (85), Expect = 0.60,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L++++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDRLFKELESIETEHPDLIVPDSPTQRVG 73


>gi|308184399|ref|YP_003928532.1| NAD-dependent DNA ligase LigA [Helicobacter pylori SJM180]
 gi|308060319|gb|ADO02215.1| NAD-dependent DNA ligase LigA [Helicobacter pylori SJM180]
          Length = 656

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD  + +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDESIVSDAVYDELYQELKAYEEENPNRIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|39995996|ref|NP_951947.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens PCA]
 gi|81702997|sp|Q74ER9|DNLJ_GEOSL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|39982761|gb|AAR34220.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens PCA]
 gi|298505011|gb|ADI83734.1| DNA ligase, NAD-dependent [Geobacter sulfurreducens KN400]
          Length = 670

 Score = 37.4 bits (85), Expect = 0.61,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY  D P  TD  YD +   L  L+ +FP+L   D P   VG
Sbjct: 20  HNRLYYAEDRPEITDAEYDLLFRELVDLETRFPDLAAPDSPTQRVG 65


>gi|229015686|ref|ZP_04172669.1| DNA ligase [Bacillus cereus AH1273]
 gi|229021878|ref|ZP_04178448.1| DNA ligase [Bacillus cereus AH1272]
 gi|228739424|gb|EEL89850.1| DNA ligase [Bacillus cereus AH1272]
 gi|228745603|gb|EEL95622.1| DNA ligase [Bacillus cereus AH1273]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMGEDSPSIRVG 65


>gi|309805852|ref|ZP_07699887.1| NAD-dependent DNA ligase adenylation domain protein [Lactobacillus
           iners LactinV 03V1-b]
 gi|308167761|gb|EFO69905.1| NAD-dependent DNA ligase adenylation domain protein [Lactobacillus
           iners LactinV 03V1-b]
          Length = 109

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           ++ LS  +A +EV   +K+      W   YY  D P+  D +YD+V ++L  L++++P L
Sbjct: 1   MSELSLAQAKLEV---LKLRKQLDSWAYAYYVQDAPVVEDNIYDQVYQQLLELEQKYPVL 57

Query: 108 FDEDHPWNTVG 118
            D D     VG
Sbjct: 58  IDPDSITQRVG 68


>gi|163938297|ref|YP_001643181.1| NAD-dependent DNA ligase LigA [Bacillus weihenstephanensis KBAB4]
 gi|229165272|ref|ZP_04293059.1| DNA ligase [Bacillus cereus AH621]
 gi|254781256|sp|A9VRG3|DNLJ_BACWK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163860494|gb|ABY41553.1| DNA ligase, NAD-dependent [Bacillus weihenstephanensis KBAB4]
 gi|228618097|gb|EEK75135.1| DNA ligase [Bacillus cereus AH621]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|239944478|ref|ZP_04696415.1| NAD-dependent DNA ligase LigA [Streptomyces roseosporus NRRL 15998]
 gi|239990936|ref|ZP_04711600.1| NAD-dependent DNA ligase LigA [Streptomyces roseosporus NRRL 11379]
 gi|291447943|ref|ZP_06587333.1| NAD-dependent DNA ligase LigA [Streptomyces roseosporus NRRL 15998]
 gi|291350890|gb|EFE77794.1| NAD-dependent DNA ligase LigA [Streptomyces roseosporus NRRL 15998]
          Length = 743

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +DR+   L+AL++++P L   D P   V 
Sbjct: 31  HRFRYYVKDQPVVSDAEFDRLLRSLEALEDEYPPLRTPDSPTQQVA 76


>gi|229055132|ref|ZP_04195560.1| DNA ligase [Bacillus cereus AH603]
 gi|228721208|gb|EEL72737.1| DNA ligase [Bacillus cereus AH603]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|206967609|ref|ZP_03228565.1| DNA ligase, NAD-dependent [Bacillus cereus AH1134]
 gi|228950848|ref|ZP_04112971.1| DNA ligase [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|229068048|ref|ZP_04201356.1| DNA ligase [Bacillus cereus F65185]
 gi|229077651|ref|ZP_04210281.1| DNA ligase [Bacillus cereus Rock4-2]
 gi|229176884|ref|ZP_04304280.1| DNA ligase [Bacillus cereus 172560W]
 gi|206736529|gb|EDZ53676.1| DNA ligase, NAD-dependent [Bacillus cereus AH1134]
 gi|228606557|gb|EEK63982.1| DNA ligase [Bacillus cereus 172560W]
 gi|228705592|gb|EEL57948.1| DNA ligase [Bacillus cereus Rock4-2]
 gi|228715056|gb|EEL66923.1| DNA ligase [Bacillus cereus F65185]
 gi|228808777|gb|EEM55273.1| DNA ligase [Bacillus thuringiensis serovar kurstaki str. T03a001]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|261401085|ref|ZP_05987210.1| DNA ligase, NAD-dependent [Neisseria lactamica ATCC 23970]
 gi|269208977|gb|EEZ75432.1| DNA ligase, NAD-dependent [Neisseria lactamica ATCC 23970]
          Length = 827

 Score = 37.4 bits (85), Expect = 0.64,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+   PEL   D P   VG
Sbjct: 30  YYTLDAPSVPDAEYDRLFRELEALELNHPELKLPDSPTQRVG 71


>gi|229009789|ref|ZP_04167009.1| DNA ligase [Bacillus mycoides DSM 2048]
 gi|228751407|gb|EEM01213.1| DNA ligase [Bacillus mycoides DSM 2048]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|229188563|ref|ZP_04315602.1| DNA ligase [Bacillus cereus ATCC 10876]
 gi|228594752|gb|EEK52532.1| DNA ligase [Bacillus cereus ATCC 10876]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.64,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|257387145|ref|YP_003176918.1| NAD-dependent DNA ligase LigA [Halomicrobium mukohataei DSM 12286]
 gi|257169452|gb|ACV47211.1| DNA ligase, NAD-dependent [Halomicrobium mukohataei DSM 12286]
          Length = 700

 Score = 37.4 bits (85), Expect = 0.64,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 31  EAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLY 90
           EA   P+   +E    + + V   S  EA  + + L +   +H   YY L +P+  D  Y
Sbjct: 6   EATPPPDNPYVEDPPTEFEPVEDFSDDEAREQAQRLREAIRYHDHRYYVLADPVIGDRAY 65

Query: 91  DRVSERLDALQEQFPELFDEDHPWNTVG 118
           D +  RL+AL++ F +L  E  P   VG
Sbjct: 66  DALFARLEALEDAF-DLDREASPTQRVG 92


>gi|229131294|ref|ZP_04260196.1| DNA ligase [Bacillus cereus BDRD-ST196]
 gi|228652180|gb|EEL08115.1| DNA ligase [Bacillus cereus BDRD-ST196]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRDMQELIKLEAENPEFMSEDSPSIRVG 65


>gi|81611354|sp|Q6A7A2|DNLJ_PROAC RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|50840696|gb|AAT83363.1| DNA ligase [Propionibacterium acnes KPA171202]
          Length = 772

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 34  VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 93

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 94  EDDHPELRTPDSPTQRVG 111


>gi|152974127|ref|YP_001373644.1| NAD-dependent DNA ligase LigA [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|190359228|sp|A7GKJ1|DNLJ_BACCN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|152022879|gb|ABS20649.1| DNA ligase, NAD-dependent [Bacillus cytotoxicus NVH 391-98]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK      +E L  +       Y+ LDNP  +D  YDR  + L  L+ + PE   ED P
Sbjct: 1   MSKEAVQQRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELIKLETENPEFITEDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SVRVG 65


>gi|326390897|ref|ZP_08212448.1| DNA ligase, NAD-dependent [Thermoanaerobacter ethanolicus JW 200]
 gi|325993045|gb|EGD51486.1| DNA ligase, NAD-dependent [Thermoanaerobacter ethanolicus JW 200]
          Length = 662

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PE    D P   VG
Sbjct: 16  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFKTPDSPSQRVG 62


>gi|314919398|gb|EFS83229.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL050PA1]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|307266289|ref|ZP_07547829.1| DNA ligase, NAD-dependent [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918667|gb|EFN48901.1| DNA ligase, NAD-dependent [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 662

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PE    D P   VG
Sbjct: 16  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFKTPDSPSQRVG 62


>gi|298369197|ref|ZP_06980515.1| DNA ligase, NAD-dependent [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283200|gb|EFI24687.1| DNA ligase, NAD-dependent [Neisseria sp. oral taxon 014 str. F0314]
          Length = 830

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++L  +   +   YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 8   IKHLTALLNRYAYEYYTLDAPSVPDAEYDKLFRELEALERNHPELKLPDSPTQRVG 63


>gi|289428790|ref|ZP_06430473.1| DNA ligase (NAD(+)) [Propionibacterium acnes J165]
 gi|289158188|gb|EFD06408.1| DNA ligase (NAD(+)) [Propionibacterium acnes J165]
          Length = 753

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 15  VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 74

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 75  EDDHPELRTPDSPTQRVG 92


>gi|289426325|ref|ZP_06428068.1| DNA ligase (NAD(+)) [Propionibacterium acnes SK187]
 gi|295131143|ref|YP_003581806.1| DNA ligase (NAD(+)) [Propionibacterium acnes SK137]
 gi|289153053|gb|EFD01771.1| DNA ligase (NAD(+)) [Propionibacterium acnes SK187]
 gi|291375741|gb|ADD99595.1| DNA ligase (NAD(+)) [Propionibacterium acnes SK137]
 gi|332676019|gb|AEE72835.1| DNA ligase [Propionibacterium acnes 266]
          Length = 753

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 15  VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 74

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 75  EDDHPELRTPDSPTQRVG 92


>gi|170079241|ref|YP_001735879.1| DNA ligase, NAD-dependent [Synechococcus sp. PCC 7002]
 gi|254781436|sp|B1XLV0|DNLJ_SYNP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169886910|gb|ACB00624.1| DNA ligase, NAD-dependent [Synechococcus sp. PCC 7002]
          Length = 678

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD++   L AL+   P+L   D P   +G
Sbjct: 23  YYVLDAPFMEDAVYDQLYRELVALETAHPQLITPDSPTQRIG 64


>gi|146301217|ref|YP_001195808.1| DNA ligase, NAD-dependent [Flavobacterium johnsoniae UW101]
 gi|190359257|sp|A5FE87|DNLJ_FLAJO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146155635|gb|ABQ06489.1| DNA ligase, NAD-dependent [Flavobacterium johnsoniae UW101]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LDN   +D  +D   + L  L+ + PE FDED P   VG
Sbjct: 16  QHNYNYYVLDNATISDYDFDIKLKELQDLENKHPEFFDEDSPTQRVG 62


>gi|149195296|ref|ZP_01872384.1| NAD-dependent DNA ligase LigA [Caminibacter mediatlanticus TB-2]
 gi|149134560|gb|EDM23048.1| NAD-dependent DNA ligase LigA [Caminibacter mediatlanticus TB-2]
          Length = 682

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +KW   YY LDNPL TD  YD++ + ++  ++  P+  D+  P   +G
Sbjct: 16  KKWAYYYYVLDNPLVTDEEYDKLYKEVEEYEKNHPDEVDKTSPTQRIG 63


>gi|217077826|ref|YP_002335544.1| DNA ligase, NAD-dependent [Thermosipho africanus TCF52B]
 gi|254781437|sp|B7IDX6|DNLJ_THEAB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|217037681|gb|ACJ76203.1| DNA ligase, NAD-dependent [Thermosipho africanus TCF52B]
          Length = 665

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+EY       H   YY L +P+ +D  YD++ ++L  L++++PE +    P   VG
Sbjct: 16  EIEY-------HNYRYYVLADPVISDEEYDKLLKKLIELEKKYPEFYSPTSPTQKVG 65


>gi|57241999|ref|ZP_00369939.1| DNA ligase, NAD-dependent [Campylobacter upsaliensis RM3195]
 gi|57017191|gb|EAL53972.1| DNA ligase, NAD-dependent [Campylobacter upsaliensis RM3195]
          Length = 644

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 64  EYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL K+AL +   + YY  D PL +D  YDR+   +   +++ P L   D P   + 
Sbjct: 3   EYLKKVALANLWMRAYYEEDEPLASDEEYDRLIREIKVFEKENPSLISPDSPTQKIA 59


>gi|227551668|ref|ZP_03981717.1| DNA ligase (NAD(+)) [Enterococcus faecium TX1330]
 gi|293377659|ref|ZP_06623848.1| DNA ligase (NAD(+)) [Enterococcus faecium PC4.1]
 gi|227179231|gb|EEI60203.1| DNA ligase (NAD(+)) [Enterococcus faecium TX1330]
 gi|292643659|gb|EFF61780.1| DNA ligase (NAD(+)) [Enterococcus faecium PC4.1]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|167624496|ref|YP_001674790.1| DNA ligase, NAD-dependent [Shewanella halifaxensis HAW-EB4]
 gi|190359286|sp|B0TKB2|DNLJ_SHEHH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|167354518|gb|ABZ77131.1| DNA ligase, NAD-dependent [Shewanella halifaxensis HAW-EB4]
          Length = 667

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L      H   YY  D+P   D  YDR+  RL AL+ + P+    D P   VG
Sbjct: 7   EIAQLTAELNQHNYRYYVDDSPSIPDSEYDRLLNRLKALETEHPQFCLADSPTQRVG 63


>gi|126174866|ref|YP_001051015.1| DNA ligase (NAD(+)) [Shewanella baltica OS155]
 gi|125998071|gb|ABN62146.1| DNA ligase (NAD(+)) [Shewanella baltica OS155]
          Length = 145

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P  TD  YDR+ +RL  L+  +P L   D P   VG
Sbjct: 33  HNIRYYVDDAPSITDSEYDRLMQRLLKLEALYPHLIVADSPTQRVG 78


>gi|317495223|ref|ZP_07953593.1| DNA ligase [Gemella moribillum M424]
 gi|316914645|gb|EFV36121.1| DNA ligase [Gemella moribillum M424]
          Length = 663

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  LV +   +   YY  DNP  +D  YD + ++L+ L++++PE   ++ P   VG
Sbjct: 7   EIFKLVALLNKYSYDYYVEDNPQISDTEYDTLYKQLEKLEQEYPEFILDNSPTQRVG 63


>gi|313125027|ref|YP_004035291.1| DNA ligase, NAD-dependent [Halogeometricum borinquense DSM 11551]
 gi|312291392|gb|ADQ65852.1| DNA ligase, NAD-dependent [Halogeometricum borinquense DSM 11551]
          Length = 694

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V SLS   A  E   L +    H   YY   +PL  D  YD +  RL  L++ F +L DE
Sbjct: 27  VESLSAEAAEREARLLREAVREHDHRYYVAADPLVADRTYDALFNRLQELEDAF-DLDDE 85

Query: 111 DHPWNTVG 118
             P   VG
Sbjct: 86  SSPTRRVG 93


>gi|300704237|ref|YP_003745840.1| DNA ligase [Ralstonia solanacearum CFBP2957]
 gi|299071901|emb|CBJ43230.1| DNA ligase [Ralstonia solanacearum CFBP2957]
          Length = 813

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L+AL+ + P L   D P   VG
Sbjct: 31  YYVLDQPSVPDAEYDRLYRELEALEAEHPALRTPDSPTLRVG 72


>gi|293571852|ref|ZP_06682868.1| DNA ligase, NAD-dependent [Enterococcus faecium E980]
 gi|291608106|gb|EFF37412.1| DNA ligase, NAD-dependent [Enterococcus faecium E980]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|269960659|ref|ZP_06175031.1| DNA ligase [Vibrio harveyi 1DA3]
 gi|269834736|gb|EEZ88823.1| DNA ligase [Vibrio harveyi 1DA3]
          Length = 670

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + PEL   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRMMRELLDIEAEHPELVTVDSPSQRVG 64


>gi|257895732|ref|ZP_05675385.1| NAD-dependent DNA ligase [Enterococcus faecium Com12]
 gi|257832297|gb|EEV58718.1| NAD-dependent DNA ligase [Enterococcus faecium Com12]
          Length = 678

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 26  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 69


>gi|313834239|gb|EFS71953.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL056PA1]
 gi|314924752|gb|EFS88583.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL036PA3]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|313793877|gb|EFS41901.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL110PA1]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|293557127|ref|ZP_06675681.1| DNA ligase, NAD-dependent [Enterococcus faecium E1039]
 gi|294614139|ref|ZP_06694060.1| DNA ligase, NAD-dependent [Enterococcus faecium E1636]
 gi|291592989|gb|EFF24577.1| DNA ligase, NAD-dependent [Enterococcus faecium E1636]
 gi|291600696|gb|EFF30994.1| DNA ligase, NAD-dependent [Enterococcus faecium E1039]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|205372454|ref|ZP_03225267.1| NAD-dependent DNA ligase LigA [Bacillus coahuilensis m4-4]
          Length = 635

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD   + L A++++FPEL   D P   +G
Sbjct: 24  YYVLDKPQVSDQEYDSKLQELIAIEQEFPELKTPDSPSERIG 65


>gi|195953269|ref|YP_002121559.1| DNA ligase, NAD-dependent [Hydrogenobaculum sp. Y04AAS1]
 gi|254781349|sp|B4U8X0|DNLJ_HYDS0 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|195932881|gb|ACG57581.1| DNA ligase, NAD-dependent [Hydrogenobaculum sp. Y04AAS1]
          Length = 700

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           LSK EA+  +  L ++  +H   YY L+ P+ +D  YD + + L ++++ +P+L   D
Sbjct: 28  LSKEEAIKIINTLRELINYHDYRYYVLNQPVISDAEYDAIYKFLKSIEDNYPDLITPD 85


>gi|42561289|ref|NP_975740.1| DNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1]
 gi|81400468|sp|Q6MSK8|DNLJ_MYCMS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|42492787|emb|CAE77382.1| DNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1]
 gi|301320499|gb|ADK69142.1| DNA ligase (NAD(+)) [Mycoplasma mycoides subsp. mycoides SC str.
           Gladysdale]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK +A++ +  L +      K YY  DNP   D  YD   + L +L+  +PEL   D P
Sbjct: 1   MSKDKALLRINQLKEQLNLWSKQYYVDDNPSVDDTEYDLALKELISLETLYPELITSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQKVG 65


>gi|332992914|gb|AEF02969.1| DNA ligase, NAD-dependent [Alteromonas sp. SN2]
          Length = 404

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR  + L ++++QFPEL     P   VG
Sbjct: 26  YYVLDAPTVPDAQYDRDMQELISIEKQFPELQSVSSPSQKVG 67


>gi|313822055|gb|EFS59769.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL036PA1]
 gi|313823710|gb|EFS61424.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL036PA2]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|313763487|gb|EFS34851.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL013PA1]
 gi|313773641|gb|EFS39607.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL074PA1]
 gi|313801268|gb|EFS42519.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL110PA2]
 gi|313808052|gb|EFS46533.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL087PA2]
 gi|313811476|gb|EFS49190.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL083PA1]
 gi|313813500|gb|EFS51214.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL025PA1]
 gi|313816668|gb|EFS54382.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL059PA1]
 gi|313819621|gb|EFS57335.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL046PA2]
 gi|313826033|gb|EFS63747.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL063PA1]
 gi|313829503|gb|EFS67217.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL063PA2]
 gi|313831217|gb|EFS68931.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL007PA1]
 gi|313840009|gb|EFS77723.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL086PA1]
 gi|314914784|gb|EFS78615.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL005PA4]
 gi|314920694|gb|EFS84525.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL050PA3]
 gi|314930573|gb|EFS94404.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL067PA1]
 gi|314954471|gb|EFS98877.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL027PA1]
 gi|314961961|gb|EFT06062.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL002PA2]
 gi|314963768|gb|EFT07868.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL082PA1]
 gi|314968405|gb|EFT12503.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL037PA1]
 gi|314974093|gb|EFT18189.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL053PA1]
 gi|314976617|gb|EFT20712.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL045PA1]
 gi|314978931|gb|EFT23025.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL072PA2]
 gi|314984280|gb|EFT28372.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL005PA1]
 gi|314986627|gb|EFT30719.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL005PA2]
 gi|314990983|gb|EFT35074.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL005PA3]
 gi|315079616|gb|EFT51609.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL053PA2]
 gi|315081153|gb|EFT53129.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL078PA1]
 gi|315087038|gb|EFT59014.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL002PA3]
 gi|315089213|gb|EFT61189.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL072PA1]
 gi|315095437|gb|EFT67413.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL038PA1]
 gi|315099114|gb|EFT71090.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL059PA2]
 gi|315100402|gb|EFT72378.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL046PA1]
 gi|315109094|gb|EFT81070.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL030PA2]
 gi|327328505|gb|EGE70267.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL096PA2]
 gi|327329632|gb|EGE71388.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL096PA3]
 gi|327334143|gb|EGE75857.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL097PA1]
 gi|327444292|gb|EGE90946.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL043PA2]
 gi|327444828|gb|EGE91482.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL043PA1]
 gi|327446317|gb|EGE92971.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL013PA2]
 gi|327452096|gb|EGE98750.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL092PA1]
 gi|327454866|gb|EGF01521.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL087PA3]
 gi|327457850|gb|EGF04505.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL083PA2]
 gi|328752459|gb|EGF66075.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL020PA1]
 gi|328755302|gb|EGF68918.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL087PA1]
 gi|328758217|gb|EGF71833.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL025PA2]
 gi|328759940|gb|EGF73524.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL099PA1]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|290580089|ref|YP_003484481.1| DNA ligase [Streptococcus mutans NN2025]
 gi|254996988|dbj|BAH87589.1| DNA ligase [Streptococcus mutans NN2025]
          Length = 652

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV++   + + YY  DNP  +D  YD++   L  L+++FPE    + P + VG
Sbjct: 8   LVQLLNQYAREYYTKDNPSVSDAEYDKLYRELVELEKEFPEDILSNSPTHRVG 60


>gi|296171259|ref|ZP_06852663.1| DNA ligase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894227|gb|EFG73984.1| DNA ligase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 693

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P+ +D  +D +   L AL++++PEL   D P   VG
Sbjct: 27  HQFRYYIKDAPIVSDAEFDTMFNDLLALEDRYPELRVPDSPTQLVG 72


>gi|257884412|ref|ZP_05664065.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,501]
 gi|257898303|ref|ZP_05677956.1| NAD-dependent DNA ligase [Enterococcus faecium Com15]
 gi|257820250|gb|EEV47398.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,501]
 gi|257836215|gb|EEV61289.1| NAD-dependent DNA ligase [Enterococcus faecium Com15]
          Length = 678

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 26  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 69


>gi|161621794|ref|YP_056321.2| NAD-dependent DNA ligase LigA [Propionibacterium acnes KPA171202]
 gi|315106904|gb|EFT78880.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL030PA1]
          Length = 740

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YDR+   L  +
Sbjct: 2   VDDSTQGGELEASEAGAEARHHWTELAQRILDAQDAYYARDAPTISDAEYDRLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRTPDSPTQRVG 79


>gi|332188479|ref|ZP_08390201.1| DNA ligase, NAD-dependent [Sphingomonas sp. S17]
 gi|332011491|gb|EGI53574.1| DNA ligase, NAD-dependent [Sphingomonas sp. S17]
          Length = 712

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH + Y+  D P  +D  YD +  R  A++  FP L   D P   VG
Sbjct: 27  HHNRLYHTEDAPEISDADYDALIRRNMAIEAAFPHLIRSDSPNRQVG 73


>gi|293569137|ref|ZP_06680444.1| DNA ligase, NAD-dependent [Enterococcus faecium E1071]
 gi|291588184|gb|EFF20025.1| DNA ligase, NAD-dependent [Enterococcus faecium E1071]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|257887196|ref|ZP_05666849.1| NAD-dependent DNA ligase [Enterococcus faecium 1,141,733]
 gi|257823250|gb|EEV50182.1| NAD-dependent DNA ligase [Enterococcus faecium 1,141,733]
          Length = 678

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 26  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 69


>gi|257882881|ref|ZP_05662534.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,502]
 gi|257818539|gb|EEV45867.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,502]
          Length = 674

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 22  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 65


>gi|69246831|ref|ZP_00604140.1| NAD-dependent DNA ligase [Enterococcus faecium DO]
 gi|260560049|ref|ZP_05832227.1| NAD-dependent DNA ligase [Enterococcus faecium C68]
 gi|293559999|ref|ZP_06676507.1| DNA ligase, NAD-dependent [Enterococcus faecium E1162]
 gi|294621040|ref|ZP_06700232.1| DNA ligase, NAD-dependent [Enterococcus faecium U0317]
 gi|314937827|ref|ZP_07845144.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133a04]
 gi|314941627|ref|ZP_07848507.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133C]
 gi|314948874|ref|ZP_07852243.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0082]
 gi|314951008|ref|ZP_07854075.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133A]
 gi|314993009|ref|ZP_07858405.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133B]
 gi|314996456|ref|ZP_07861499.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133a01]
 gi|68195064|gb|EAN09526.1| NAD-dependent DNA ligase [Enterococcus faecium DO]
 gi|260073884|gb|EEW62208.1| NAD-dependent DNA ligase [Enterococcus faecium C68]
 gi|291599354|gb|EFF30379.1| DNA ligase, NAD-dependent [Enterococcus faecium U0317]
 gi|291606087|gb|EFF35513.1| DNA ligase, NAD-dependent [Enterococcus faecium E1162]
 gi|313589438|gb|EFR68283.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133a01]
 gi|313592532|gb|EFR71377.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133B]
 gi|313596863|gb|EFR75708.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133A]
 gi|313599518|gb|EFR78361.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133C]
 gi|313642858|gb|EFS07438.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0133a04]
 gi|313644664|gb|EFS09244.1| DNA ligase, NAD-dependent [Enterococcus faecium TX0082]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|186476101|ref|YP_001857571.1| DNA ligase, NAD-dependent [Burkholderia phymatum STM815]
 gi|254781277|sp|B2JID1|DNLJ_BURP8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|184192560|gb|ACC70525.1| DNA ligase, NAD-dependent [Burkholderia phymatum STM815]
          Length = 683

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L  ++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDRLFKELQQIESEHPDLITPDSPTQRVG 73


>gi|257878462|ref|ZP_05658115.1| NAD-dependent DNA ligase [Enterococcus faecium 1,230,933]
 gi|257889341|ref|ZP_05668994.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,410]
 gi|257894353|ref|ZP_05674006.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,408]
 gi|258616016|ref|ZP_05713786.1| DNA ligase, NAD-dependent [Enterococcus faecium DO]
 gi|257812690|gb|EEV41448.1| NAD-dependent DNA ligase [Enterococcus faecium 1,230,933]
 gi|257825701|gb|EEV52327.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,410]
 gi|257830732|gb|EEV57339.1| NAD-dependent DNA ligase [Enterococcus faecium 1,231,408]
          Length = 678

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 26  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 69


>gi|197336238|ref|YP_002156719.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
 gi|254781450|sp|B5FGU7|DNLJ_VIBFM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|197317728|gb|ACH67175.1| DNA ligase, NAD-dependent [Vibrio fischeri MJ11]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P   D  YDR+ + L +++ + PEL   D P   VG
Sbjct: 16  YHAYRYYVEDSPELPDAEYDRMMQELLSIESEHPELVTVDSPSQRVG 62


>gi|261207462|ref|ZP_05922148.1| NAD-dependent DNA ligase [Enterococcus faecium TC 6]
 gi|289565873|ref|ZP_06446314.1| DNA ligase, NAD-dependent [Enterococcus faecium D344SRF]
 gi|294618097|ref|ZP_06697694.1| DNA ligase, NAD-dependent [Enterococcus faecium E1679]
 gi|260078353|gb|EEW66058.1| NAD-dependent DNA ligase [Enterococcus faecium TC 6]
 gi|289162333|gb|EFD10192.1| DNA ligase, NAD-dependent [Enterococcus faecium D344SRF]
 gi|291595669|gb|EFF26965.1| DNA ligase, NAD-dependent [Enterococcus faecium E1679]
          Length = 679

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + YY  D P   D +YD+    L A++EQ+P+L   D P   VG
Sbjct: 27  REYYVEDKPTVEDYVYDKEYAELVAIEEQYPDLITSDSPTQRVG 70


>gi|229137130|ref|ZP_04265749.1| DNA ligase [Bacillus cereus BDRD-ST26]
 gi|228646302|gb|EEL02517.1| DNA ligase [Bacillus cereus BDRD-ST26]
          Length = 74

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LDNP  +D  YDR  + L  L+ + PE   ED P   VG
Sbjct: 24  YHVLDNPSVSDAEYDRNMQELIKLEAENPEFMSEDSPSVRVG 65


>gi|291538763|emb|CBL11874.1| DNA ligase, NAD-dependent [Roseburia intestinalis XB6B4]
          Length = 671

 Score = 37.4 bits (85), Expect = 0.74,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P  +D  +D + ++L  L+++ PEL  +D P   VG
Sbjct: 16  YHSDRYYNQDSPEISDYEFDMLMQQLKKLEKEHPELVTKDSPTQHVG 62


>gi|291536367|emb|CBL09479.1| DNA ligase, NAD-dependent [Roseburia intestinalis M50/1]
          Length = 671

 Score = 37.4 bits (85), Expect = 0.74,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P  +D  +D + ++L  L+++ PEL  +D P   VG
Sbjct: 16  YHSDRYYNQDSPEISDYEFDMLMQQLKKLEKEHPELVTKDSPTQHVG 62


>gi|88810628|ref|ZP_01125885.1| DNA ligase, NAD-dependent [Nitrococcus mobilis Nb-231]
 gi|88792258|gb|EAR23368.1| DNA ligase, NAD-dependent [Nitrococcus mobilis Nb-231]
          Length = 672

 Score = 37.4 bits (85), Expect = 0.74,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD+P  +D  YD +   L AL+   P+L   D P   VG
Sbjct: 22  QHNYRYFVLDDPQVSDADYDVLMRELQALEADHPDLVSPDSPTQRVG 68


>gi|331015921|gb|EGH95977.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|330963250|gb|EGH63510.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|240145659|ref|ZP_04744260.1| DNA ligase, NAD-dependent [Roseburia intestinalis L1-82]
 gi|257202247|gb|EEV00532.1| DNA ligase, NAD-dependent [Roseburia intestinalis L1-82]
          Length = 671

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P  +D  +D + ++L  L+++ PEL  +D P   VG
Sbjct: 16  YHSDRYYNQDSPEISDYEFDMLMQQLKKLEKEHPELVTKDSPTQHVG 62


>gi|213968905|ref|ZP_03397045.1| DNA ligase, NAD-dependent [Pseudomonas syringae pv. tomato T1]
 gi|301385372|ref|ZP_07233790.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063632|ref|ZP_07255173.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. tomato K40]
 gi|302133897|ref|ZP_07259887.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926204|gb|EEB59759.1| DNA ligase, NAD-dependent [Pseudomonas syringae pv. tomato T1]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|28870811|ref|NP_793430.1| NAD-dependent DNA ligase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|81730313|sp|Q87YY6|DNLJ_PSESM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|28854060|gb|AAO57125.1| DNA ligase, NAD-dependent [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|87123447|ref|ZP_01079298.1| BRCT domain:NAD-dependent DNA ligase N-terminus [Synechococcus sp.
           RS9917]
 gi|86169167|gb|EAQ70423.1| BRCT domain:NAD-dependent DNA ligase N-terminus [Synechococcus sp.
           RS9917]
          Length = 694

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           GE   E+  L+  A H    YY LD P   D +YDR+   L  L++  P L   D P   
Sbjct: 6   GERARELRTLLNRAAHA---YYVLDAPEMEDPVYDRLYRELVELEQADPSLCSPDSPTQR 62

Query: 117 VG 118
           VG
Sbjct: 63  VG 64


>gi|330879146|gb|EGH13295.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDAEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|225377122|ref|ZP_03754343.1| hypothetical protein ROSEINA2194_02767 [Roseburia inulinivorans DSM
           16841]
 gi|225211027|gb|EEG93381.1| hypothetical protein ROSEINA2194_02767 [Roseburia inulinivorans DSM
           16841]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A   +  L K   +H   YY  D+P  +D  YD + + L  L+++ PEL   D P
Sbjct: 1   MKKMSAEERIAELKKTLEYHIDRYYNQDSPEISDYEYDMMMQELKNLEKEHPELVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|307637302|gb|ADN79752.1| NAD-dependent DNA ligase [Helicobacter pylori 908]
 gi|325995893|gb|ADZ51298.1| DNA ligase [Helicobacter pylori 2018]
 gi|325997488|gb|ADZ49696.1| NAD-dependent DNA ligase [Helicobacter pylori 2017]
          Length = 656

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD  + +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDESIVSDAVYDELYQELKAYEEENPNHIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|315180839|gb|ADT87753.1| DNA ligase [Vibrio furnissii NCTC 11218]
          Length = 669

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K  LH H   YY  D+P   D  YDR+   L  L+ + PEL   D P   VG
Sbjct: 11  LKDTLHYHAIRYYVEDDPTIPDAEYDRLMRELLDLEARHPELVTPDSPSQRVG 63


>gi|254479199|ref|ZP_05092546.1| NAD-dependent DNA ligase adenylation domain subfamily
           [Carboxydibrachium pacificum DSM 12653]
 gi|214034862|gb|EEB75589.1| NAD-dependent DNA ligase adenylation domain subfamily
           [Carboxydibrachium pacificum DSM 12653]
          Length = 271

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + EA   +E L +   +H   YY LD P  +D  YD +   L  L+E++PE    D P
Sbjct: 15  MDREEARKRIEELREKINYHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFKTPDSP 74

Query: 114 WNTVG 118
              VG
Sbjct: 75  SQRVG 79


>gi|198274661|ref|ZP_03207193.1| hypothetical protein BACPLE_00817 [Bacteroides plebeius DSM 17135]
 gi|198272108|gb|EDY96377.1| hypothetical protein BACPLE_00817 [Bacteroides plebeius DSM 17135]
          Length = 666

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH H   YY L+ P  +D  +DR+   L  L+ + PE +DE+ P   
Sbjct: 1   MTEIERIDQLREELHTHNHNYYILNAPTISDQEFDRLMRELQDLEAKHPEHYDENSPSVR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|224437677|ref|ZP_03658624.1| NAD-dependent DNA ligase LigA [Helicobacter cinaedi CCUG 18818]
 gi|313144124|ref|ZP_07806317.1| DNA ligase [Helicobacter cinaedi CCUG 18818]
 gi|313129155|gb|EFR46772.1| DNA ligase [Helicobacter cinaedi CCUG 18818]
          Length = 651

 Score = 37.0 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ E    ++ L K+A H    YY LD+P+ TD  YD +  ++   + Q P L   + P
Sbjct: 1   MTQQEYSSNIQKLTKMAYH----YYVLDDPIATDSQYDELYHQVLNFERQNPILISPNSP 56

Query: 114 WNTVG 118
              VG
Sbjct: 57  TQRVG 61


>gi|94310370|ref|YP_583580.1| DNA ligase, NAD-dependent [Cupriavidus metallidurans CH34]
 gi|123383876|sp|Q1LNG5|DNLJ_RALME RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|93354222|gb|ABF08311.1| DNA ligase, NAD(+)-dependent [Cupriavidus metallidurans CH34]
          Length = 721

 Score = 37.0 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 38  YYVLDAPTIPDADYDALFIELQALEAEHPELLTPDSPTQRVG 79


>gi|23013561|ref|ZP_00053441.1| COG0272: NAD-dependent DNA ligase (contains BRCT domain type II)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 696

 Score = 37.0 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           L+  EA IE   LV+  +   + Y+  D PL  D +YD    RL  ++ +FPEL
Sbjct: 11  LTPFEARIEHAELVEKLVSWDEAYHGQDAPLVPDDVYDGAKRRLSGIEARFPEL 64


>gi|312863154|ref|ZP_07723392.1| DNA ligase (NAD+) [Streptococcus vestibularis F0396]
 gi|322516268|ref|ZP_08069198.1| NAD-dependent DNA ligase LigA [Streptococcus vestibularis ATCC
           49124]
 gi|311100690|gb|EFQ58895.1| DNA ligase (NAD+) [Streptococcus vestibularis F0396]
 gi|322125241|gb|EFX96614.1| NAD-dependent DNA ligase LigA [Streptococcus vestibularis ATCC
           49124]
          Length = 652

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            + K YY  DNP  +D  YD++   L  L+ + PEL   D P + VG
Sbjct: 14  QYAKEYYTEDNPSVSDADYDKLYRELVDLEVEHPELVQADSPTHRVG 60


>gi|260363295|ref|ZP_05776162.1| DNA ligase (NAD+) [Vibrio parahaemolyticus K5030]
 gi|308113593|gb|EFO51133.1| DNA ligase (NAD+) [Vibrio parahaemolyticus K5030]
          Length = 655

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+   L  ++ Q P+L   D P   VG
Sbjct: 3   YHAVRYYVEDNPEIPDAEYDRLMRELLEIEAQHPDLVTVDSPSQRVG 49


>gi|237745525|ref|ZP_04576005.1| DNA ligase [Oxalobacter formigenes HOxBLS]
 gi|229376876|gb|EEO26967.1| DNA ligase [Oxalobacter formigenes HOxBLS]
          Length = 685

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P+  D  YDRV   L  L+  +PEL     P   VG
Sbjct: 33  YYVLDAPVVPDAEYDRVFRELQELEAAYPELVVPGSPTQRVG 74


>gi|289626390|ref|ZP_06459344.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|330866315|gb|EGH01024.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 787

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYYVLDEPSIPDVEYDRLFHELKALEVENPHLVTPDSPTQRVG 63


>gi|313891779|ref|ZP_07825384.1| DNA ligase (NAD+) [Dialister microaerophilus UPII 345-E]
 gi|313119773|gb|EFR42960.1| DNA ligase (NAD+) [Dialister microaerophilus UPII 345-E]
          Length = 666

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E + +V+ L +   +H   YY LD P  +D  +D++   L   + ++PEL   D P   V
Sbjct: 5   EIISKVKKLREELRYHSYLYYVLDKPEISDFEFDKMYRELVDFESKYPELITPDSPTQRV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|256852262|ref|ZP_05557648.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 27-2-CHN]
 gi|260661706|ref|ZP_05862617.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 115-3-CHN]
 gi|282934844|ref|ZP_06340077.1| DNA ligase (NAD(+)) [Lactobacillus jensenii 208-1]
 gi|297205571|ref|ZP_06922967.1| NAD-dependent DNA ligase LigA [Lactobacillus jensenii JV-V16]
 gi|256615308|gb|EEU20499.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 27-2-CHN]
 gi|260547453|gb|EEX23432.1| DNA ligase, NAD-dependent [Lactobacillus jensenii 115-3-CHN]
 gi|281301075|gb|EFA93386.1| DNA ligase (NAD(+)) [Lactobacillus jensenii 208-1]
 gi|297150149|gb|EFH30446.1| NAD-dependent DNA ligase LigA [Lactobacillus jensenii JV-V16]
          Length = 669

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L+K  A  E+E L K      + YY  D P   D +YD+  ++L  L++QFPEL   D  
Sbjct: 4   LNKKNAQEEIETLRKKLNTWAEQYYAQDAPSVEDAVYDQNYQKLVELEKQFPELVTPDSI 63

Query: 114 WNTVG 118
              VG
Sbjct: 64  TQRVG 68


>gi|261366975|ref|ZP_05979858.1| DNA ligase, NAD-dependent [Subdoligranulum variabile DSM 15176]
 gi|282571093|gb|EFB76628.1| DNA ligase, NAD-dependent [Subdoligranulum variabile DSM 15176]
          Length = 661

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A    E L  +   + + YY  D P   D  YD ++  L A++ +FP+L   + P
Sbjct: 1   MEREQAQKRAEELRAVIEKNNRLYYDQDAPELEDFEYDALTRELKAIETEFPDLVTPESP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQHVG 65


>gi|317401960|gb|EFV82562.1| DNA ligase [Achromobacter xylosoxidans C54]
          Length = 699

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D+P  +D  YDR+   L  L+   PEL   + P   VG
Sbjct: 22  QHNVRYYVYDDPSISDAEYDRLMRELQDLEAAHPELVTPESPTQRVG 68


>gi|88855225|ref|ZP_01129890.1| DNA ligase [marine actinobacterium PHSC20C1]
 gi|88815753|gb|EAR25610.1| DNA ligase [marine actinobacterium PHSC20C1]
          Length = 775

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EV  L    L  +  YY  D  L  D  YD + +RL+ L+ + PEL  +D P   VG
Sbjct: 32  EVGTLSTRILELRDAYYERDEVLVDDAEYDELIQRLERLEREHPELQSQDSPTLRVG 88


>gi|220912112|ref|YP_002487421.1| DNA ligase, NAD-dependent [Arthrobacter chlorophenolicus A6]
 gi|254778146|sp|B8HFJ3|DNLJ1_ARTCA RecName: Full=DNA ligase 1; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 1
 gi|219858990|gb|ACL39332.1| DNA ligase, NAD-dependent [Arthrobacter chlorophenolicus A6]
          Length = 770

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E L  +   ++  YY+ D PL +D  +D +  RL+ ++   PEL   D P   VG
Sbjct: 32  EYENLSDLIRKYRFAYYQDDAPLVSDAEFDTLFRRLEEIEALHPELVANDSPTQEVG 88


>gi|117926963|ref|YP_867580.1| Fis family transcriptional regulator [Magnetococcus sp. MC-1]
 gi|166215818|sp|A0LDY1|DNLJ_MAGSM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|117610719|gb|ABK46174.1| transcriptional regulator, Fis family [Magnetococcus sp. MC-1]
          Length = 768

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+   Y+ LD  L +D  YDR+   L +L+   P L   D P + VG
Sbjct: 15  HYAHSYHTLDTSLVSDAEYDRLFRELQSLEAADPTLISADSPTHRVG 61


>gi|330830678|ref|YP_004393630.1| NAD-dependent DNA ligase LigA [Aeromonas veronii B565]
 gi|328805814|gb|AEB51013.1| NAD-dependent DNA ligase LigA [Aeromonas veronii B565]
          Length = 787

 Score = 37.0 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LDNP   D  YDR+   L AL+   PEL     P   VG
Sbjct: 20  HQ--YYVLDNPTVPDAEYDRLMRELIALEADHPELKTPASPSVRVG 63


>gi|297202535|ref|ZP_06919932.1| DNA ligase, NAD-dependent [Streptomyces sviceus ATCC 29083]
 gi|197709937|gb|EDY53971.1| DNA ligase, NAD-dependent [Streptomyces sviceus ATCC 29083]
          Length = 730

 Score = 37.0 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D++   L+AL++++PEL   D P   V 
Sbjct: 29  HRFRYYVNDAPVVSDADFDKLLRSLEALEDEYPELRTPDSPTQKVA 74


>gi|325110927|ref|YP_004271995.1| DNA ligase [Planctomyces brasiliensis DSM 5305]
 gi|324971195|gb|ADY61973.1| DNA ligase [Planctomyces brasiliensis DSM 5305]
          Length = 675

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H + YY    P  TD  +DR+  RL  L++Q PE    D P   VG
Sbjct: 19  HNRLYYVEAQPEITDREFDRLLNRLIDLEQQHPEFQSPDSPTQKVG 64


>gi|326804258|ref|YP_004322076.1| DNA ligase (NAD+) [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651204|gb|AEA01387.1| DNA ligase (NAD+) [Aerococcus urinae ACS-120-V-Col10a]
          Length = 677

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD+   +L+ L+   P+L   D P   VG
Sbjct: 32  YYVLDQPSVSDDHYDKTYRQLEELEASHPDLIQSDSPTQRVG 73


>gi|312114833|ref|YP_004012429.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
 gi|311219962|gb|ADP71330.1| DNA ligase, NAD-dependent [Rhodomicrobium vannielii ATCC 17100]
          Length = 777

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 49  KKVTSLSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           K    LS  +A  E + L  +IA H     Y+   P  +D  YDR+  RL+AL+  FP L
Sbjct: 54  KHAEHLSAEDAKDEHDALAAEIARH--DLLYQDAAPEISDAEYDRLRLRLNALEAAFPSL 111

Query: 108 FDEDHPWNTVG 118
              + P  TVG
Sbjct: 112 ITPESPSQTVG 122


>gi|224372650|ref|YP_002607022.1| NAD-dependent DNA ligase LigA [Nautilia profundicola AmH]
 gi|254781379|sp|B9L8R4|DNLJ_NAUPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|223589900|gb|ACM93636.1| DNA ligase, NAD-dependent [Nautilia profundicola AmH]
          Length = 656

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +YY LDNPL TD  YD++   ++  +++ P+  D   P   VG
Sbjct: 21  YYYVLDNPLVTDEEYDKLYHEVEEYEKKHPDKIDPTSPTQRVG 63


>gi|161760708|ref|YP_062356.2| NAD-dependent DNA ligase LigA [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 755

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 32/62 (51%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
            +A  E + L    L  +  YY LD  L +D  YDR+  RL+ L+   PEL  +D P  T
Sbjct: 11  ADARAEAQGLTTRILELRDAYYELDTVLVSDEEYDRMLRRLEELERLHPELQSQDSPTQT 70

Query: 117 VG 118
           VG
Sbjct: 71  VG 72


>gi|291299865|ref|YP_003511143.1| DNA ligase NAD-dependent [Stackebrandtia nassauensis DSM 44728]
 gi|290569085|gb|ADD42050.1| DNA ligase, NAD-dependent [Stackebrandtia nassauensis DSM 44728]
          Length = 749

 Score = 37.0 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H++ Y+R D P  +D  YD +   L A++E  P L  +D P   VG
Sbjct: 32  HRQLYHRDDAPQISDAEYDALMRELLAIEEAHPVLATQDSPSQQVG 77


>gi|206890248|ref|YP_002249789.1| DNA ligase, NAD-dependent [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|254781443|sp|B5YIF8|DNLJ_THEYD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206742186|gb|ACI21243.1| DNA ligase, NAD-dependent [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 670

 Score = 37.0 bits (84), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E LVK   +H   YY LD+P+ +D  YD +  RL  L+E++  +   D P   VG
Sbjct: 11  EIEKLVKELNYHNYRYYVLDSPVISDEEYDMMLRRLKELEEKWGYILP-DSPTQRVG 66


>gi|281414409|ref|ZP_06246151.1| DNA ligase, NAD-dependent [Micrococcus luteus NCTC 2665]
          Length = 248

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E E LV+     +  YY+ D P  +D  YD +  RL+ L+   PEL   D P   VG
Sbjct: 24  EYEDLVERVRAARTAYYQRDAPEISDAEYDALYRRLEDLEALHPELVSNDSPTQEVG 80


>gi|218710253|ref|YP_002417874.1| NAD-dependent DNA ligase LigA [Vibrio splendidus LGP32]
 gi|254782307|sp|B7VIK3|DNLJ_VIBSL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218323272|emb|CAV19449.1| DNA ligase [Vibrio splendidus LGP32]
          Length = 670

 Score = 37.0 bits (84), Expect = 0.88,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K    + +E L +   +H   YY  D+P   D  YDR+ ++L  ++++ PEL   D P  
Sbjct: 2   KESIQVTLEQLRETLHYHAVRYYVEDSPEIPDVEYDRLMQQLLKIEDENPELVTVDSPSQ 61

Query: 116 TVG 118
            VG
Sbjct: 62  RVG 64


>gi|81390835|sp|Q6AEE5|DNLJ_LEIXX RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|50951550|gb|AAT89251.1| DNA ligase [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 747

 Score = 37.0 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 32/62 (51%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
            +A  E + L    L  +  YY LD  L +D  YDR+  RL+ L+   PEL  +D P  T
Sbjct: 3   ADARAEAQGLTTRILELRDAYYELDTVLVSDEEYDRMLRRLEELERLHPELQSQDSPTQT 62

Query: 117 VG 118
           VG
Sbjct: 63  VG 64


>gi|88703478|ref|ZP_01101194.1| DNA ligase [Congregibacter litoralis KT71]
 gi|88702192|gb|EAQ99295.1| DNA ligase [Congregibacter litoralis KT71]
          Length = 674

 Score = 37.0 bits (84), Expect = 0.90,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++W   YY LD+P   D  YD     L  L+E  PEL D   P   VG
Sbjct: 18  ERWNHEYYILDSPTVPDQEYDGALRELQTLEEAHPELRDASSPTQRVG 65


>gi|317127163|ref|YP_004093445.1| DNA ligase, NAD-dependent [Bacillus cellulosilyticus DSM 2522]
 gi|315472111|gb|ADU28714.1| DNA ligase, NAD-dependent [Bacillus cellulosilyticus DSM 2522]
          Length = 670

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++K +   E++ L  I   +   YY LD P  +D  YD++   L  L+E +PE   +D P
Sbjct: 1   MAKDDIKQEIDRLTNILNDYAYHYYVLDQPKVSDAEYDQLLHELTKLEEAYPEWKRDDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SERVG 65


>gi|171322051|ref|ZP_02910925.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MEX-5]
 gi|171092642|gb|EDT37943.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MEX-5]
          Length = 691

 Score = 37.0 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFGELQQLETDHPELVTPDSPTQRVG 72


>gi|134296034|ref|YP_001119769.1| DNA ligase [Burkholderia vietnamiensis G4]
 gi|166215568|sp|A4JF81|DNLJ_BURVG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|134139191|gb|ABO54934.1| DNA ligase, NAD-dependent [Burkholderia vietnamiensis G4]
          Length = 691

 Score = 37.0 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFGELQQLEADHPELVTPDSPTQRVG 72


>gi|172058707|ref|YP_001815167.1| ABC transporter related [Exiguobacterium sibiricum 255-15]
 gi|171991228|gb|ACB62150.1| ABC transporter related [Exiguobacterium sibiricum 255-15]
          Length = 288

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 6/52 (11%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSER 96
           LD+ ++VTSLSKG+A +   +L+++A         LD P  TDGL DR+++R
Sbjct: 118 LDRGRRVTSLSKGQAQL---FLLQLAFATNAPVLLLDEP--TDGL-DRINKR 163


>gi|117618613|ref|YP_855770.1| DNA ligase, NAD-dependent [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|166215386|sp|A0KHL9|DNLJ_AERHH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|117560020|gb|ABK36968.1| DNA ligase, NAD-dependent [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 668

 Score = 37.0 bits (84), Expect = 0.92,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L ++ + +   YY LDNP   D  YDR+   L  L+ + PEL     P   VG
Sbjct: 11  LCELLIEYGHQYYVLDNPTVPDAEYDRLMRELIVLEAEHPELKTPASPSVRVG 63


>gi|269219963|ref|ZP_06163817.1| DNA ligase, NAD-dependent [Actinomyces sp. oral taxon 848 str.
           F0332]
 gi|269210599|gb|EEZ76939.1| DNA ligase, NAD-dependent [Actinomyces sp. oral taxon 848 str.
           F0332]
          Length = 799

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 74  QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Q+ Y+  D P+ TD  YDR+   L  L+ + PEL  +  P  +VG
Sbjct: 29  QRAYHSGDEPIVTDEHYDRLVRELRRLEAEHPELAVDSSPAQSVG 73


>gi|318040766|ref|ZP_07972722.1| NAD-dependent DNA ligase LigA [Synechococcus sp. CB0101]
          Length = 690

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L+  A H    YY LD P   D +YDR+   L  L+   PEL   D P   VG
Sbjct: 19  ELRQLLNRAAHA---YYVLDAPEMEDPVYDRLYRELLDLETAHPELIAPDSPTQRVG 72


>gi|121594439|ref|YP_986335.1| DNA ligase [Acidovorax sp. JS42]
 gi|166215384|sp|A1W7N4|DNLJ_ACISJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|120606519|gb|ABM42259.1| DNA ligase, NAD-dependent [Acidovorax sp. JS42]
          Length = 731

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 56  KGEAMIEVEYLVKIALHHQ--KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           KG A++  +  +K AL  Q  +W   YY  D P   D  YDR  ++L AL+  +P+L   
Sbjct: 14  KGSALVATK--IK-ALREQLNRWAHEYYVQDTPSVPDAEYDRAFQQLQALEGAYPDLVTP 70

Query: 111 DHPWNTV 117
           D P   V
Sbjct: 71  DSPTQRV 77


>gi|254465633|ref|ZP_05079044.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium Y4I]
 gi|206686541|gb|EDZ47023.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium Y4I]
          Length = 750

 Score = 37.0 bits (84), Expect = 0.96,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 34/73 (46%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           +  K VT+L+  +A  E   L          Y++ D P  +D  YD + +R  AL E FP
Sbjct: 4   NSEKDVTALTAEDARAEFLALEDQLRAADLAYHQADAPEISDAEYDSLKQRYRALAEAFP 63

Query: 106 ELFDEDHPWNTVG 118
           +L D     + VG
Sbjct: 64  DLADAATHLDAVG 76


>gi|254252054|ref|ZP_04945372.1| NAD-dependent DNA ligase [Burkholderia dolosa AUO158]
 gi|124894663|gb|EAY68543.1| NAD-dependent DNA ligase [Burkholderia dolosa AUO158]
          Length = 691

 Score = 37.0 bits (84), Expect = 0.96,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFLELQQLEADHPELVTPDSPTQRVG 72


>gi|160902460|ref|YP_001568041.1| DNA ligase, NAD-dependent [Petrotoga mobilis SJ95]
 gi|190359269|sp|A9BJX5|DNLJ_PETMO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160360104|gb|ABX31718.1| DNA ligase, NAD-dependent [Petrotoga mobilis SJ95]
          Length = 668

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L +P+ +D  YD++ + L  L++++PEL   D P   +G
Sbjct: 21  HNYRYYVLADPIISDQEYDKLFKELVELEKKYPELKTPDSPTQRIG 66


>gi|222152820|ref|YP_002561997.1| NAD-dependent DNA ligase LigA [Streptococcus uberis 0140J]
 gi|254781430|sp|B9DRS2|DNLJ_STRU0 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|222113633|emb|CAR41520.1| DNA ligase [Streptococcus uberis 0140J]
          Length = 652

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            +++ YY  DNP  +D  YD++   L  L++++PE   +D P   VG
Sbjct: 14  QYRQEYYTNDNPSVSDQEYDKLYHELIDLEKEYPEYIQKDSPSQAVG 60


>gi|114563631|ref|YP_751144.1| DNA ligase, NAD-dependent [Shewanella frigidimarina NCIMB 400]
 gi|122299383|sp|Q080K9|DNLJ_SHEFN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|114334924|gb|ABI72306.1| DNA ligase, NAD-dependent [Shewanella frigidimarina NCIMB 400]
          Length = 670

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E++ L      H   YY  D P   D  YDR+ +RL  L+  +P+    D P   VG
Sbjct: 7   EMDQLTHTINQHNIRYYVDDAPSIPDAEYDRLIKRLTELEGDYPQFKSVDSPTQRVG 63


>gi|308233598|ref|ZP_07664335.1| DNA ligase, NAD-dependent [Atopobium vaginae DSM 15829]
 gi|328944216|ref|ZP_08241680.1| DNA ligase [Atopobium vaginae DSM 15829]
 gi|327491135|gb|EGF22910.1| DNA ligase [Atopobium vaginae DSM 15829]
          Length = 792

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           V  L K+  +H   YY LD PL TD  +D   + L  L++ +P L DE    + +G
Sbjct: 87  VRELRKLLEYHAYRYYALDAPLITDNQFDSYLQELLHLEKTYPYLDDEHSYTHRIG 142


>gi|261854791|ref|YP_003262074.1| DNA ligase, NAD-dependent [Halothiobacillus neapolitanus c2]
 gi|261835260|gb|ACX95027.1| DNA ligase, NAD-dependent [Halothiobacillus neapolitanus c2]
          Length = 685

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD+P  +D  +DR+   L  ++   PE    D P   VG
Sbjct: 31  HNFRYYVLDDPEISDAAFDRLMRELQQIESAHPEWITPDSPTQRVG 76


>gi|221198328|ref|ZP_03571374.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD2M]
 gi|221208267|ref|ZP_03581271.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD2]
 gi|221171915|gb|EEE04358.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD2]
 gi|221182260|gb|EEE14661.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD2M]
          Length = 691

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLESDHPDLVTPDSPTQRVG 72


>gi|227523032|ref|ZP_03953081.1| NAD-dependent DNA ligase [Lactobacillus hilgardii ATCC 8290]
 gi|227089850|gb|EEI25162.1| NAD-dependent DNA ligase [Lactobacillus hilgardii ATCC 8290]
          Length = 675

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D+P   D +YD+  ++L  L+  FP++   D P   VG
Sbjct: 24  KWADEYYTYDSPSVEDSVYDQTYQQLVDLETTFPQIVTPDSPTQKVG 70


>gi|157964864|ref|YP_001499688.1| NAD-dependent DNA ligase LigA [Rickettsia massiliae MTU5]
 gi|166216234|sp|A8F2K5|DNLJ_RICM5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157844640|gb|ABV85141.1| DNA ligase, NAD-dependent [Rickettsia massiliae MTU5]
          Length = 689

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEKEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|308271402|emb|CBX28010.1| DNA ligase [uncultured Desulfobacterium sp.]
          Length = 674

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +VE L      H   YY +D+P  +D  YD++ + L  L+ ++P L   D P   VG
Sbjct: 12  KVENLKSELQKHNYHYYVMDDPQISDTQYDKMMQELIELEAKYPMLSTPDSPSMKVG 68


>gi|221215451|ref|ZP_03588415.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD1]
 gi|221164635|gb|EED97117.1| DNA ligase, NAD-dependent [Burkholderia multivorans CGD1]
          Length = 691

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLESDHPDLVTPDSPTQRVG 72


>gi|161524425|ref|YP_001579437.1| DNA ligase, NAD-dependent [Burkholderia multivorans ATCC 17616]
 gi|189350820|ref|YP_001946448.1| NAD-dependent DNA ligase [Burkholderia multivorans ATCC 17616]
 gi|254781276|sp|A9AIK9|DNLJ_BURM1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|160341854|gb|ABX14940.1| DNA ligase, NAD-dependent [Burkholderia multivorans ATCC 17616]
 gi|189334842|dbj|BAG43912.1| NAD-dependent DNA ligase [Burkholderia multivorans ATCC 17616]
          Length = 691

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQLESDHPDLVTPDSPTQRVG 72


>gi|315638276|ref|ZP_07893457.1| NAD-dependent DNA ligase LigA [Campylobacter upsaliensis JV21]
 gi|315481623|gb|EFU72246.1| NAD-dependent DNA ligase LigA [Campylobacter upsaliensis JV21]
          Length = 644

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 64  EYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL K+ L +   + YY  D PL +D  YDR+   + A +++ P L   D P   + 
Sbjct: 3   EYLKKVELANLWMRAYYEEDEPLASDEEYDRLIREIKAFEKENPSLISPDSPTQKIA 59


>gi|320173862|gb|EFW49042.1| DNA ligase [Shigella dysenteriae CDC 74-1112]
          Length = 671

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YDR+   L  L+ +  EL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDAEYDRLMRELRELETKHLELITPDSPTQRVG 63


>gi|163788595|ref|ZP_02183040.1| putative DNA ligase [Flavobacteriales bacterium ALC-1]
 gi|159875832|gb|EDP69891.1| putative DNA ligase [Flavobacteriales bacterium ALC-1]
          Length = 664

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L +    H   YY LDN   +D  +D   + L AL+E  PE FD + P   VG
Sbjct: 7   IEILREELRQHNYNYYILDNATISDYEFDIKLKELQALEEANPEFFDPNSPTQRVG 62


>gi|260436246|ref|ZP_05790216.1| DNA ligase, NAD-dependent [Synechococcus sp. WH 8109]
 gi|260414120|gb|EEX07416.1| DNA ligase, NAD-dependent [Synechococcus sp. WH 8109]
          Length = 680

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   E+ +L+  A H    YY LD P+  D +YDR+   L  L++  P L   D P   V
Sbjct: 6   ERAAELRHLLNRAGHA---YYVLDAPVMEDAVYDRLYRELLELEQNDPGLQRPDSPTQRV 62

Query: 118 G 118
           G
Sbjct: 63  G 63


>gi|227512904|ref|ZP_03942953.1| NAD-dependent DNA ligase [Lactobacillus buchneri ATCC 11577]
 gi|227083904|gb|EEI19216.1| NAD-dependent DNA ligase [Lactobacillus buchneri ATCC 11577]
          Length = 675

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D+P   D +YD+  ++L  L+  FP++   D P   VG
Sbjct: 24  KWADEYYTYDSPSVEDSVYDQTYQQLVDLETTFPQIVTPDSPTQKVG 70


>gi|24379931|ref|NP_721886.1| NAD-dependent DNA ligase LigA [Streptococcus mutans UA159]
 gi|81451132|sp|Q8DT49|DNLJ_STRMU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|24377912|gb|AAN59192.1|AE014986_3 DNA ligase [Streptococcus mutans UA159]
          Length = 652

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV++   + + YY  DNP  +D  YD++   L  L+++FPE    + P + VG
Sbjct: 8   LVQLLNQYAREYYTKDNPSVSDAEYDKLYRELVELEKEFPEDILPNSPTHRVG 60


>gi|325127826|gb|EGC50734.1| DNA ligase, NAD-dependent [Neisseria meningitidis N1568]
          Length = 841

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 35/83 (42%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +      +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTDLTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PEL   D P   VG
Sbjct: 63  ELEALELNHPELKLPDSPTQRVG 85


>gi|285018504|ref|YP_003376215.1| NAD-dependent_DNA_ligase [Xanthomonas albilineans GPE PC73]
 gi|283473722|emb|CBA16225.1| putative nad-dependent_dna_ligase protein [Xanthomonas albilineans]
          Length = 838

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           +   +  + ++E+   ++ A H    YY L +P   D  YD +   L+AL+   P L  E
Sbjct: 2   IAKFTPQQRVVELRSQLEDANHR---YYVLADPAIPDAEYDALMRELEALESAHPALARE 58

Query: 111 DHPWNTVG 118
           D P  +VG
Sbjct: 59  DSPTRSVG 66


>gi|300781381|ref|ZP_07091235.1| NAD-dependent DNA ligase LigA [Corynebacterium genitalium ATCC
           33030]
 gi|300533088|gb|EFK54149.1| NAD-dependent DNA ligase LigA [Corynebacterium genitalium ATCC
           33030]
          Length = 674

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L K    H+  YY  D P+ TD  +D +  RL  L+E  PEL   D P   VG
Sbjct: 17  LAKEVRRHRDLYYNGD-PVITDAEFDEMFRRLQQLEEDHPELAVPDSPTKEVG 68


>gi|156407081|ref|XP_001641373.1| predicted protein [Nematostella vectensis]
 gi|156228511|gb|EDO49310.1| predicted protein [Nematostella vectensis]
          Length = 358

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 17  HNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKW 76
           HN  P +W   L  +A+    K A E  L+ A +     KGE +  + +   I    Q W
Sbjct: 228 HNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYKGENICRMSHHFDIGDALQIW 287

Query: 77  Y-----YRLDNPLF--TDGLYDRV 93
           Y     Y+ DNP F  T G + ++
Sbjct: 288 YNESESYQYDNPGFALTTGHFTQI 311


>gi|311104688|ref|YP_003977541.1| DNA ligase, NAD-dependent [Achromobacter xylosoxidans A8]
 gi|310759377|gb|ADP14826.1| DNA ligase, NAD-dependent [Achromobacter xylosoxidans A8]
          Length = 702

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D P  +D  YD +   L AL+ + PEL   + P   VG
Sbjct: 23  QHNVRYYVYDEPSISDAEYDGLMRELQALEAEHPELVTPESPTQRVG 69


>gi|330837729|ref|YP_004412370.1| DNA ligase [Spirochaeta coccoides DSM 17374]
 gi|329749632|gb|AEC02988.1| DNA ligase [Spirochaeta coccoides DSM 17374]
          Length = 716

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +I L  Q  YY L  P  +D  YD + + L AL+   P++ + D P   VG
Sbjct: 14  LSRILLDAQHEYYVLGRPSMSDKEYDTLMDELAALEAAHPDVKEADSPTQRVG 66


>gi|89896634|ref|YP_520121.1| hypothetical protein DSY3888 [Desulfitobacterium hafniense Y51]
 gi|122997178|sp|Q24QL5|DNLJ_DESHY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|89336082|dbj|BAE85677.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 659

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD + + L  L+++ PE    D P   VG
Sbjct: 22  YYGLDQPTLSDAEYDALLQELIRLEKEHPEFLTPDSPSQRVG 63


>gi|219667570|ref|YP_002458005.1| DNA ligase, NAD-dependent [Desulfitobacterium hafniense DCB-2]
 gi|254781313|sp|B8FP44|DNLJ_DESHD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219537830|gb|ACL19569.1| DNA ligase, NAD-dependent [Desulfitobacterium hafniense DCB-2]
          Length = 659

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD + + L  L+++ PE    D P   VG
Sbjct: 22  YYGLDQPTLSDAEYDALLQELIRLEKEHPEFLTPDSPSQRVG 63


>gi|325915467|ref|ZP_08177781.1| DNA ligase, NAD-dependent [Xanthomonas vesicatoria ATCC 35937]
 gi|325538349|gb|EGD10031.1| DNA ligase, NAD-dependent [Xanthomonas vesicatoria ATCC 35937]
          Length = 833

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           Y+ LD P   D  YDR+   L+AL+ + P L   D P   VG+
Sbjct: 25  YHVLDEPQMADVDYDRLMRELEALEAEHPALATADSPTQRVGH 67


>gi|325143946|gb|EGC66256.1| DNA ligase, NAD-dependent [Neisseria meningitidis M01-240013]
 gi|325206489|gb|ADZ01942.1| DNA ligase, NAD-dependent [Neisseria meningitidis M04-240196]
          Length = 841

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 36/83 (43%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PE    D P   VG
Sbjct: 63  ELEALELNHPEFKLPDSPTQRVG 85


>gi|33602779|ref|NP_890339.1| DNA ligase [Bordetella bronchiseptica RB50]
 gi|81429836|sp|Q7WCJ7|DNLJ_BORBR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33577221|emb|CAE35778.1| DNA ligase [Bordetella bronchiseptica RB50]
          Length = 696

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D+P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 21  QHNIRYYVHDDPSVPDAEYDALMRDLQALEAEHPELVTPDSPTQRVG 67


>gi|33597876|ref|NP_885519.1| DNA ligase [Bordetella parapertussis 12822]
 gi|81425567|sp|Q7W0T4|DNLJ_BORPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33574305|emb|CAE38638.1| DNA ligase [Bordetella parapertussis]
          Length = 696

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D+P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 21  QHNIRYYVHDDPSVPDAEYDALMRDLQALEAEHPELVTPDSPTQRVG 67


>gi|33594429|ref|NP_882073.1| DNA ligase [Bordetella pertussis Tohama I]
 gi|81424006|sp|Q7VRX7|DNLJ_BORPE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33564504|emb|CAE43819.1| DNA ligase [Bordetella pertussis Tohama I]
 gi|332383840|gb|AEE68687.1| DNA ligase [Bordetella pertussis CS]
          Length = 696

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY  D+P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 21  QHNIRYYVHDDPSVPDAEYDALMRDLQALEAEHPELVTPDSPTQRVG 67


>gi|323499974|ref|ZP_08104932.1| NAD-dependent DNA ligase LigA [Vibrio sinaloensis DSM 21326]
 gi|323314991|gb|EGA68044.1| NAD-dependent DNA ligase LigA [Vibrio sinaloensis DSM 21326]
          Length = 669

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P   D  YDR+   L  L+ Q P+L   D P   VG
Sbjct: 18  YHGVKYYVEDSPEIPDAEYDRLMRELMELESQHPDLMSLDSPSQRVG 64


>gi|122971128|sp|Q14L37|DNLJ_SPICI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|110005471|emb|CAK99793.1| dna ligase protein [Spiroplasma citri]
          Length = 667

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +KW   YY  DNP  +D  YDR  + L A+++Q+ EL   D P   V
Sbjct: 18  EKWNYEYYVNDNPSVSDQEYDRALQELIAIEQQYSELITIDSPTQRV 64


>gi|319943831|ref|ZP_08018112.1| DNA ligase [Lautropia mirabilis ATCC 51599]
 gi|319743064|gb|EFV95470.1| DNA ligase [Lautropia mirabilis ATCC 51599]
          Length = 779

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 23/48 (47%)

Query: 71  LHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L H + YY  D P   D +YD +   L  L+ ++P L   D P   VG
Sbjct: 35  LAHNRAYYEEDAPTVEDSVYDGLFLELQQLEARWPALLTPDSPTQRVG 82


>gi|317125504|ref|YP_004099616.1| DNA ligase, NAD-dependent [Intrasporangium calvum DSM 43043]
 gi|315589592|gb|ADU48889.1| DNA ligase, NAD-dependent [Intrasporangium calvum DSM 43043]
          Length = 715

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  RL+AL+ Q+P L   D P   VG
Sbjct: 36  YHVKDAPTISDAEYDGLIRRLNALEAQWPSLRTPDSPTQKVG 77


>gi|210134818|ref|YP_002301257.1| NAD-dependent DNA ligase LigA [Helicobacter pylori P12]
 gi|254781345|sp|B6JLJ9|DNLJ_HELP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|210132786|gb|ACJ07777.1| DNA ligase [Helicobacter pylori P12]
          Length = 656

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD  + +D +YD + + L A +E+ P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDESIVSDAVYDELYQELKAYEEKNPNDIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|56962859|ref|YP_174586.1| NAD-dependent DNA ligase LigA [Bacillus clausii KSM-K16]
 gi|81366743|sp|Q5WJ30|DNLJ_BACSK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56909098|dbj|BAD63625.1| DNA ligase [Bacillus clausii KSM-K16]
          Length = 671

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+  +P+L  ED P   +G
Sbjct: 24  YYVLDTPKVPDSEYDRLMNELLQLEADYPDLVTEDSPSVRIG 65


>gi|325133819|gb|EGC56475.1| DNA ligase, NAD-dependent [Neisseria meningitidis M13399]
          Length = 841

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 36/83 (43%)

Query: 36  PNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSE 95
           PN +   ++ +  K   S  K  A   + +L  +   +   YY LD P   D  YD++  
Sbjct: 3   PNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYYTLDAPSVPDAEYDKLFR 62

Query: 96  RLDALQEQFPELFDEDHPWNTVG 118
            L+AL+   PE    D P   VG
Sbjct: 63  ELEALELNHPEFKLPDSPTQRVG 85


>gi|323359739|ref|YP_004226135.1| NAD-dependent DNA ligase [Microbacterium testaceum StLB037]
 gi|323276110|dbj|BAJ76255.1| NAD-dependent DNA ligase [Microbacterium testaceum StLB037]
          Length = 810

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 34/69 (49%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFD 109
           ++  LS  +A  E   L +     ++ YY  D  L  D  YD    RL+AL+ + PEL  
Sbjct: 6   QLPDLSLDDARAEAIDLTQRITDAREAYYGRDAELVDDATYDGWMHRLEALERRHPELQG 65

Query: 110 EDHPWNTVG 118
           +D P  +VG
Sbjct: 66  QDSPTLSVG 74


>gi|226310273|ref|YP_002770167.1| NAD-dependent DNA ligase [Brevibacillus brevis NBRC 100599]
 gi|254781268|sp|C0Z4D6|DNLJ_BREBN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|226093221|dbj|BAH41663.1| NAD-dependent DNA ligase [Brevibacillus brevis NBRC 100599]
          Length = 671

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A  +++ L K    H + Y+  D P  +D  YD++   L  L+  FP+L   D P   VG
Sbjct: 6   AETKIKELAKRIERHNRLYHEEDRPEISDQEYDQLMRELRELETSFPDLQSPDSPSLRVG 65


>gi|295836378|ref|ZP_06823311.1| DNA ligase, NAD-dependent [Streptomyces sp. SPB74]
 gi|295825992|gb|EDY45591.2| DNA ligase, NAD-dependent [Streptomyces sp. SPB74]
          Length = 818

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D +  RL AL+E+ P+L   D P   V 
Sbjct: 66  HRYRYYVNDQPVVSDADFDALLRRLTALEEEHPQLRTPDSPTQKVA 111


>gi|52079149|ref|YP_077940.1| NAD-dependent DNA ligase LigA [Bacillus licheniformis ATCC 14580]
 gi|52784516|ref|YP_090345.1| NAD-dependent DNA ligase LigA [Bacillus licheniformis ATCC 14580]
 gi|319647076|ref|ZP_08001302.1| DNA ligase [Bacillus sp. BT1B_CT2]
 gi|81386291|sp|Q65MR2|DNLJ_BACLD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|52002360|gb|AAU22302.1| DNA ligase [Bacillus licheniformis ATCC 14580]
 gi|52347018|gb|AAU39652.1| LigA [Bacillus licheniformis ATCC 14580]
 gi|317390900|gb|EFV71701.1| DNA ligase [Bacillus sp. BT1B_CT2]
          Length = 667

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD+P   D  YD++ + L AL+E+ P+L   D P   VG
Sbjct: 24  YHTLDDPSVPDSEYDKLMKELIALEEEHPDLKTPDSPSQRVG 65


>gi|331703733|ref|YP_004400420.1| DNA ligase [Mycoplasma mycoides subsp. capri LC str. 95010]
 gi|328802288|emb|CBW54442.1| DNA ligase [Mycoplasma mycoides subsp. capri LC str. 95010]
          Length = 668

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK +A++ +  L +      K YY  DNP   D  YD   + L +L+  +PEL   D P
Sbjct: 1   MSKDKALLRINQLKEQLNLWSKQYYVDDNPSVDDIEYDLALKELISLETLYPELITSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQKVG 65


>gi|307132386|ref|YP_003884402.1| DNA ligase, NAD(+)-dependent [Dickeya dadantii 3937]
 gi|306529915|gb|ADM99845.1| DNA ligase, NAD(+)-dependent [Dickeya dadantii 3937]
          Length = 683

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 61  IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++E L     +H+  Y+  D P   D  YD++   L  L++  PEL   D P   VG
Sbjct: 17  VQIEALRAQLRYHEYKYHVEDAPEIPDAEYDKLMNALKTLEQAHPELVTPDSPTQRVG 74


>gi|255535523|ref|YP_003095894.1| DNA ligase [Flavobacteriaceae bacterium 3519-10]
 gi|255341719|gb|ACU07832.1| DNA ligase [Flavobacteriaceae bacterium 3519-10]
          Length = 667

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +++ L K    H   YY LD P  +D  +D   + L  L+ QFPE +D + P   VG
Sbjct: 8   KIDALRKEIHQHNYSYYSLDEPTISDFEFDLKLKELQDLELQFPEFYDNNSPTLRVG 64


>gi|238917130|ref|YP_002930647.1| DNA ligase (NAD+) [Eubacterium eligens ATCC 27750]
 gi|238872490|gb|ACR72200.1| DNA ligase (NAD+) [Eubacterium eligens ATCC 27750]
          Length = 669

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E   L K   +H   YY  D P  +D  YD++  RL  ++++ PE    D P   +G
Sbjct: 6   EYSELKKTIDYHMDRYYNQDEPEISDYEYDKLMIRLKEIEKEHPEWVTSDSPSQKIG 62


>gi|256383839|gb|ACU78409.1| DNA ligase, NAD-dependent [Mycoplasma mycoides subsp. capri str.
           GM12]
 gi|256384670|gb|ACU79239.1| DNA ligase, NAD-dependent [Mycoplasma mycoides subsp. capri str.
           GM12]
 gi|296455996|gb|ADH22231.1| DNA ligase, NAD-dependent [synthetic Mycoplasma mycoides
           JCVI-syn1.0]
          Length = 668

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK +A++ +  L +      K YY  DNP   D  YD   + L +L+  +PEL   D P
Sbjct: 1   MSKDKALLRINQLKEQLNLWSKQYYVDDNPSVDDIEYDLALKELISLETLYPELITSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQKVG 65


>gi|149928191|ref|ZP_01916436.1| DNA ligase (NAD+) [Limnobacter sp. MED105]
 gi|149823082|gb|EDM82322.1| DNA ligase (NAD+) [Limnobacter sp. MED105]
          Length = 597

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 47  KAKKVTSLSKGEA-MIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           K     S S+GE+  + +  L+ +    +  YY LD P   D  YD+V   L  ++   P
Sbjct: 10  KGSGDNSDSRGESPTVAMRRLIDLLNRWEYAYYVLDAPEVPDSEYDKVYRSLQQIENNHP 69

Query: 106 ELFDEDHPWNTVG 118
           EL   D P   VG
Sbjct: 70  ELIQNDSPTQRVG 82


>gi|194289797|ref|YP_002005704.1| DNA ligase [Cupriavidus taiwanensis LMG 19424]
 gi|254781303|sp|B3R2C2|DNLJ_CUPTR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193223632|emb|CAQ69639.1| DNA ligase [Cupriavidus taiwanensis LMG 19424]
          Length = 709

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P   D  YD +   L AL+ + PEL   D P   VG
Sbjct: 38  HNYQYYVLDAPTVPDAEYDALFSELMALELEHPELQTPDSPTQRVG 83


>gi|229542656|ref|ZP_04431716.1| DNA ligase, NAD-dependent [Bacillus coagulans 36D1]
 gi|229327076|gb|EEN92751.1| DNA ligase, NAD-dependent [Bacillus coagulans 36D1]
          Length = 668

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++   PEL   D P   VG
Sbjct: 24  YYVLDRPSVPDAEYDRLLRELQEIENAHPELITPDSPTQRVG 65


>gi|282861257|ref|ZP_06270322.1| DNA ligase, NAD-dependent [Streptomyces sp. ACTE]
 gi|282563915|gb|EFB69452.1| DNA ligase, NAD-dependent [Streptomyces sp. ACTE]
          Length = 732

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +A+++T +S  EA      L +    H+  YY  D P+ +D  +DR+   L+A++++ P+
Sbjct: 6   QARELTGVS-AEARERHALLSEQIEEHRFRYYVKDQPVVSDAEFDRLMRELEAVEDENPQ 64

Query: 107 LFDEDHPWNTVG 118
           L   D P   V 
Sbjct: 65  LRTPDSPTQKVA 76


>gi|332284990|ref|YP_004416901.1| DNA ligase [Pusillimonas sp. T7-7]
 gi|330428943|gb|AEC20277.1| DNA ligase [Pusillimonas sp. T7-7]
          Length = 698

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D P+ +D  YD++   L  L++  PEL   + P   VG
Sbjct: 25  HNHRYYVQDAPVVSDAAYDKLMTELIELEQTHPELITPESPTQRVG 70


>gi|330817444|ref|YP_004361149.1| DNA ligase [Burkholderia gladioli BSR3]
 gi|327369837|gb|AEA61193.1| DNA ligase [Burkholderia gladioli BSR3]
          Length = 691

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFRELQQIEAEHPDLITPDSPTQRVG 72


>gi|327541957|gb|EGF28460.1| NAD-dependent DNA ligase LigA [Rhodopirellula baltica WH47]
          Length = 754

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           V+ LV     H + YY    P  TD  YD++   L  L+ ++PEL   D P   VG
Sbjct: 64  VQQLVDEINRHNRLYYDDAAPEITDLQYDQLLAELTQLENEYPELRQPDSPTQLVG 119


>gi|86138407|ref|ZP_01056981.1| DNA ligase, NAD-dependent [Roseobacter sp. MED193]
 gi|85824932|gb|EAQ45133.1| DNA ligase, NAD-dependent [Roseobacter sp. MED193]
          Length = 752

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 52  TSLSKGEAMIE-VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + LS+ +A  E +E   ++A   Q  Y++ D P  +D  YD    R   L E FPEL D 
Sbjct: 10  SGLSQEQAQAEFLELQTQLAAADQA-YHQNDAPFLSDAAYDAAKRRYKVLAEAFPELKDI 68

Query: 111 DHPWNTVG 118
               ++VG
Sbjct: 69  ATQLDSVG 76


>gi|121998657|ref|YP_001003444.1| DNA ligase, NAD-dependent [Halorhodospira halophila SL1]
 gi|166215780|sp|A1WY80|DNLJ_HALHL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|121590062|gb|ABM62642.1| DNA ligase, NAD-dependent [Halorhodospira halophila SL1]
          Length = 711

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  +D  YD +   L  L+  +P+L   D P   V 
Sbjct: 25  HDYHYYVLDRPTISDAEYDALFRELQRLEAAYPDLVSSDSPTQRVA 70


>gi|283458551|ref|YP_003363181.1| NAD-dependent DNA ligase [Rothia mucilaginosa DY-18]
 gi|283134596|dbj|BAI65361.1| NAD-dependent DNA ligase [Rothia mucilaginosa DY-18]
          Length = 747

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 74  QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ YY  D P  +D  YD +  RL+ ++ + P L   D P   VG
Sbjct: 50  RRAYYNEDAPFLSDAEYDALYRRLEIIEAEHPHLIANDSPTQEVG 94


>gi|157828943|ref|YP_001495185.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933668|ref|YP_001650457.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. Iowa]
 gi|166216235|sp|A8GTF2|DNLJ_RICRS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359278|sp|B0BUZ1|DNLJ_RICRO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157801424|gb|ABV76677.1| NAD-dependent DNA ligase LigA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908755|gb|ABY73051.1| NAD-dependent DNA ligase [Rickettsia rickettsii str. Iowa]
          Length = 689

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEEEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|323495433|ref|ZP_08100510.1| NAD-dependent DNA ligase LigA [Vibrio brasiliensis LMG 20546]
 gi|323310356|gb|EGA63543.1| NAD-dependent DNA ligase LigA [Vibrio brasiliensis LMG 20546]
          Length = 669

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P   D  YDR+   L  ++ Q PEL   D P   VG
Sbjct: 18  YHGVKYYVEDSPEIPDAEYDRLMRELMEIEAQHPELVSLDSPSQRVG 64


>gi|297623824|ref|YP_003705258.1| DNA ligase, NAD-dependent [Truepera radiovictrix DSM 17093]
 gi|297165004|gb|ADI14715.1| DNA ligase, NAD-dependent [Truepera radiovictrix DSM 17093]
          Length = 681

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY L +P  +D  +DR+   L  L+E  PEL   D P   VG
Sbjct: 25  YYVLQDPELSDAEWDRLFHELKRLEETHPELRTPDSPTQRVG 66


>gi|159904348|ref|YP_001551692.1| NAD-dependent DNA ligase LigA [Prochlorococcus marinus str. MIT
           9211]
 gi|254781392|sp|A9BDC5|DNLJ_PROM4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|159889524|gb|ABX09738.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Prochlorococcus marinus str. MIT 9211]
          Length = 697

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL  D +YDR+   L  +++  P L   D P   +G
Sbjct: 26  YYVLDTPLMEDTVYDRLYRELLNIEKNHPSLITADSPSQRLG 67


>gi|313836700|gb|EFS74414.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL037PA2]
 gi|314929893|gb|EFS93724.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL044PA1]
 gi|314972321|gb|EFT16418.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL037PA3]
 gi|328907750|gb|EGG27514.1| NAD-dependent DNA ligase LigA [Propionibacterium sp. P08]
          Length = 740

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 45  LDKAKKVTSLSKGEAMIEVEY----LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDAL 100
           +D + +   L   EA  E  +    L +  L  Q  YY  D P  +D  YD++   L  +
Sbjct: 2   VDDSTRGGELEASEAGAEARHRWTELAQRILDAQDAYYANDAPTMSDAAYDQLMVELKKV 61

Query: 101 QEQFPELFDEDHPWNTVG 118
           ++  PEL   D P   VG
Sbjct: 62  EDDHPELRSPDSPTQRVG 79


>gi|295702476|ref|YP_003595551.1| DNA ligase, NAD-dependent [Bacillus megaterium DSM 319]
 gi|294800135|gb|ADF37201.1| DNA ligase, NAD-dependent [Bacillus megaterium DSM 319]
          Length = 668

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L  +++ FPEL   D P   +G
Sbjct: 24  YYVLDQPSVPDAEYDKLMNELIEIEDSFPELKTADSPTQRIG 65


>gi|222481049|ref|YP_002567286.1| DNA ligase, NAD-dependent [Halorubrum lacusprofundi ATCC 49239]
 gi|254781342|sp|B9LU22|DNLJ_HALLT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|222453951|gb|ACM58216.1| DNA ligase, NAD-dependent [Halorubrum lacusprofundi ATCC 49239]
          Length = 710

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V +LS+ EA  +   L      H   YY   +PL  D  YDR+  RL  L+ +F +L  +
Sbjct: 27  VGALSEDEATEQASLLRAAIREHDHRYYLEADPLIPDETYDRLFTRLQELENEF-DLPTQ 85

Query: 111 DHPWNTVG 118
           + P   VG
Sbjct: 86  NSPTRRVG 93


>gi|89075460|ref|ZP_01161871.1| DNA ligase [Photobacterium sp. SKA34]
 gi|89048732|gb|EAR54303.1| DNA ligase [Photobacterium sp. SKA34]
          Length = 670

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+ ++L  ++ + PE    D P   VG
Sbjct: 18  YHGHRYYVEDNPEIPDAEYDRMMQQLLKIEAEHPEWVTVDSPSQRVG 64


>gi|296270799|ref|YP_003653431.1| NAD-dependent DNA ligase [Thermobispora bispora DSM 43833]
 gi|296093586|gb|ADG89538.1| DNA ligase, NAD-dependent [Thermobispora bispora DSM 43833]
          Length = 732

 Score = 36.2 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P  +D  YD     +  L+E++P+L   D P   VG
Sbjct: 35  YYVLDSPTVSDAEYDAWMREIRELEERYPDLRTPDSPTQKVG 76


>gi|315083671|gb|EFT55647.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL027PA2]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 27  LAQRILDAQDAYYARDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 79


>gi|229587074|ref|YP_002845575.1| NAD-dependent DNA ligase LigA [Rickettsia africae ESF-5]
 gi|254781406|sp|C3PLJ2|DNLJ_RICAE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|228022124|gb|ACP53832.1| DNA ligase, NAD-dependent [Rickettsia africae ESF-5]
          Length = 689

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEEEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|15893019|ref|NP_360733.1| NAD-dependent DNA ligase LigA [Rickettsia conorii str. Malish 7]
 gi|81527939|sp|Q92GM7|DNLJ_RICCN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15620219|gb|AAL03634.1| DNA ligase [Rickettsia conorii str. Malish 7]
          Length = 689

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEEEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|84686905|ref|ZP_01014789.1| DNA ligase, NAD-dependent [Maritimibacter alkaliphilus HTCC2654]
 gi|84665102|gb|EAQ11582.1| DNA ligase, NAD-dependent [Rhodobacterales bacterium HTCC2654]
          Length = 710

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 30/68 (44%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L +  A  E+  L  +       Y+  D P  +D  YD    R   ++ +FPEL  +
Sbjct: 9   VEKLDEAGARAELARLADLLASANTAYHTEDAPEMSDAAYDAAKRRNAEIEARFPELKRD 68

Query: 111 DHPWNTVG 118
           D P + VG
Sbjct: 69  DSPTDQVG 76


>gi|294155884|ref|YP_003560268.1| DNA ligase (NAD(+)) [Mycoplasma crocodyli MP145]
 gi|291600422|gb|ADE19918.1| DNA ligase (NAD(+)) [Mycoplasma crocodyli MP145]
          Length = 657

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E + KI  ++ + YY LD P  +D  YD + + L  +++Q P++ ++D P   +G
Sbjct: 11  ELIAKIKQYNNE-YYNLDQPSVSDAEYDALYKELLEIEKQNPKIINQDSPSQIIG 64


>gi|222110866|ref|YP_002553130.1| NAD-dependent DNA ligase [Acidovorax ebreus TPSY]
 gi|254781316|sp|B9MIW4|DNLJ_DIAST RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221730310|gb|ACM33130.1| DNA ligase, NAD-dependent [Acidovorax ebreus TPSY]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 56  KGEAMIEVEYLVKIALHHQ--KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           KG A++  +  +K AL  Q  +W   YY  D P   D  YDR  + L AL+  +P+L   
Sbjct: 23  KGSALVAAK--IK-ALREQLNRWAHEYYVQDTPSVPDAEYDRAFQELQALEGAYPDLVTP 79

Query: 111 DHPWNTV 117
           D P   V
Sbjct: 80  DSPTQRV 86


>gi|238650378|ref|YP_002916230.1| NAD-dependent DNA ligase LigA [Rickettsia peacockii str. Rustic]
 gi|257096313|sp|C4K0T1|DNLJ_RICPU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|238624476|gb|ACR47182.1| NAD-dependent DNA ligase LigA [Rickettsia peacockii str. Rustic]
          Length = 689

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEEEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|90962320|ref|YP_536236.1| NAD-dependent DNA ligase [Lactobacillus salivarius UCC118]
 gi|123391334|sp|Q1WSH6|DNLJ_LACS1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|90821514|gb|ABE00153.1| NAD-dependent DNA ligase [Lactobacillus salivarius UCC118]
          Length = 672

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD+  +RL  L++  P+L   D P   VG
Sbjct: 24  YYVLDTPSVEDSVYDKHYQRLLELEQANPDLVTADSPSQRVG 65


>gi|34581289|ref|ZP_00142769.1| DNA ligase [Rickettsia sibirica 246]
 gi|28262674|gb|EAA26178.1| DNA ligase [Rickettsia sibirica 246]
          Length = 689

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 54  LSKGEAMIEVEYLV-KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           +S+ EA   +E L  KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ 
Sbjct: 7   ISEEEAQKLLEELADKIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLILENS 65

Query: 113 PWNTVG 118
           P   VG
Sbjct: 66  PSKKVG 71


>gi|283779823|ref|YP_003370578.1| DNA ligase, NAD-dependent [Pirellula staleyi DSM 6068]
 gi|283438276|gb|ADB16718.1| DNA ligase, NAD-dependent [Pirellula staleyi DSM 6068]
          Length = 676

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 28/61 (45%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E +  ++ L +    H   YY    P  +D  YDR+ + L  ++  FPEL   D P   V
Sbjct: 7   EILERLQALREAIRRHDYLYYVRAQPEISDLEYDRLMQDLTTIEASFPELVTPDSPTQRV 66

Query: 118 G 118
           G
Sbjct: 67  G 67


>gi|292657108|ref|YP_003537005.1| DNA ligase, NAD-dependent [Haloferax volcanii DS2]
 gi|291370943|gb|ADE03170.1| DNA ligase, NAD-dependent [Haloferax volcanii DS2]
          Length = 699

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SLS+  A  +   L +    H   YY   +PL +D  YD +  RL AL++ F +L   + 
Sbjct: 26  SLSREAAEGQAALLREAVREHDHRYYVAADPLVSDAAYDALFSRLVALEDAF-DLDTTNS 84

Query: 113 PWNTVG 118
           P N VG
Sbjct: 85  PTNRVG 90


>gi|227892258|ref|ZP_04010063.1| NAD-dependent DNA ligase [Lactobacillus salivarius ATCC 11741]
 gi|227865899|gb|EEJ73320.1| NAD-dependent DNA ligase [Lactobacillus salivarius ATCC 11741]
          Length = 672

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD+  +RL  L++  P+L   D P   VG
Sbjct: 24  YYVLDTPSVEDSVYDKHYQRLLELEQANPDLVTADSPSQRVG 65


>gi|314957538|gb|EFT01641.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL002PA1]
          Length = 724

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 11  LAQRILDAQDAYYARDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 63


>gi|300214970|gb|ADJ79386.1| DNA ligase(Polydeoxyribonucleotide synthase [NAD+]) [Lactobacillus
           salivarius CECT 5713]
          Length = 672

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD+  +RL  L++  P+L   D P   VG
Sbjct: 24  YYVLDTPSVEDSVYDKHYQRLLELEQANPDLVTADSPSQRVG 65


>gi|289450450|ref|YP_003474988.1| DNA ligase (NAD+) [Clostridiales genomosp. BVAB3 str. UPII9-5]
 gi|289184997|gb|ADC91422.1| DNA ligase (NAD+) [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 758

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY  D+P+ +D  YD +  RL+ L+   PE    D P   VG
Sbjct: 106 HNNLYYVEDSPIISDYSYDAMLRRLEELETAHPEYMTTDSPTVKVG 151


>gi|223936891|ref|ZP_03628800.1| DNA ligase, NAD-dependent [bacterium Ellin514]
 gi|223894460|gb|EEF60912.1| DNA ligase, NAD-dependent [bacterium Ellin514]
          Length = 680

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++  EA      LV+    H   YY    P  +D  YDR+   L  L+++FP+L   D P
Sbjct: 1   MTHNEAKTRHTQLVEEIRGHDNAYYVEAKPTISDQAYDRLYHELLDLEKKFPDLITSDSP 60


>gi|187251632|ref|YP_001876114.1| DNA ligase, NAD-dependent [Elusimicrobium minutum Pei191]
 gi|254781329|sp|B2KE31|DNLJ_ELUMP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|186971792|gb|ACC98777.1| DNA ligase, NAD-dependent [Elusimicrobium minutum Pei191]
          Length = 656

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+E L     +H   YY LDN   +D  YD +  RL  L+   P+  D   P   +G
Sbjct: 7   EIEDLRSKINYHNNLYYNLDNAEISDAEYDGLYARLKFLEAMNPDYADAASPTQKIG 63


>gi|311067136|ref|YP_003972059.1| NAD-dependent DNA ligase LigA [Bacillus atrophaeus 1942]
 gi|310867653|gb|ADP31128.1| NAD-dependent DNA ligase LigA [Bacillus atrophaeus 1942]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L  L+E+ P+L   D P   VG
Sbjct: 24  YYTLDEPSVPDSEYDKLMQELLDLEEEHPDLRTPDSPTQRVG 65


>gi|56696562|ref|YP_166919.1| DNA ligase, NAD-dependent [Ruegeria pomeroyi DSS-3]
 gi|81349987|sp|Q5LST6|DNLJ_SILPO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|56678299|gb|AAV94965.1| DNA ligase, NAD-dependent [Ruegeria pomeroyi DSS-3]
          Length = 739

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA  E+  L  +       Y+ LD P  +D  YD + +R   ++ +FP L   D P
Sbjct: 1   MTEAEAAQELARLAGLLAQANLAYHTLDAPEISDADYDALKQRNAEIEARFPHLKRPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SEQVG 65


>gi|258544861|ref|ZP_05705095.1| DNA ligase, NAD-dependent [Cardiobacterium hominis ATCC 15826]
 gi|258519884|gb|EEV88743.1| DNA ligase, NAD-dependent [Cardiobacterium hominis ATCC 15826]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDNPL  D  YD +   L AL+    E    D P   VG
Sbjct: 17  HDHAYYVLDNPLIADAEYDALLRELRALEAASGEPVPADSPSQRVG 62


>gi|315095035|gb|EFT67011.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL060PA1]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 27  LAQRILDAQDAYYASDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 79


>gi|119386790|ref|YP_917845.1| DNA ligase, NAD-dependent [Paracoccus denitrificans PD1222]
 gi|166216224|sp|A1B9F5|DNLJ_PARDP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119377385|gb|ABL72149.1| DNA ligase, NAD-dependent [Paracoccus denitrificans PD1222]
          Length = 765

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY+ D P  +D  YD    RL+ ++ +FP+L     P   VG
Sbjct: 51  YYQEDAPFISDAEYDASKRRLEEIEARFPDLAHSGSPTAQVG 92


>gi|282854737|ref|ZP_06264072.1| DNA ligase (NAD(+)) [Propionibacterium acnes J139]
 gi|282582319|gb|EFB87701.1| DNA ligase (NAD(+)) [Propionibacterium acnes J139]
 gi|314982008|gb|EFT26101.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL110PA3]
 gi|315090823|gb|EFT62799.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL110PA4]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 27  LAQRILDAQDAYYASDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 79


>gi|314966144|gb|EFT10243.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL082PA2]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 27  LAQRILDAQDAYYASDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 79


>gi|314923733|gb|EFS87564.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL001PA1]
 gi|315104373|gb|EFT76349.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL050PA2]
 gi|327328187|gb|EGE69956.1| DNA ligase, NAD-dependent [Propionibacterium acnes HL103PA1]
          Length = 740

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +  L  Q  YY  D P  +D  YDR+   L  +++  PEL   D P   VG
Sbjct: 27  LAQRILDAQDAYYASDAPTISDAEYDRLMVELKKVEDDHPELRTPDSPTQRVG 79


>gi|313668860|ref|YP_004049144.1| DNA ligase [Neisseria lactamica ST-640]
 gi|313006322|emb|CBN87785.1| putative DNA ligase [Neisseria lactamica 020-06]
          Length = 827

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 30  YYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 71


>gi|309378943|emb|CBX22396.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 827

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 30  YYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 71


>gi|291542878|emb|CBL15988.1| DNA ligase, NAD-dependent [Ruminococcus bromii L2-63]
          Length = 661

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L K   +H   YY  D P  +D  YD +   L+ ++++FP L     P N VG
Sbjct: 13  LTKQLEYHNNLYYNQDEPEISDYDYDMLMRELENIEKEFPSLKSPMSPTNRVG 65


>gi|301299742|ref|ZP_07205992.1| DNA ligase (NAD(+)) [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300852673|gb|EFK80307.1| DNA ligase (NAD(+)) [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 672

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD+  +RL  L++  P+L   D P   VG
Sbjct: 24  YYVLDTPSVEDSVYDKHYQRLLELEQANPDLVTADSPSQRVG 65


>gi|76787534|ref|YP_329595.1| NAD-dependent DNA ligase LigA [Streptococcus agalactiae A909]
 gi|123771969|sp|Q3K1K8|DNLJ_STRA1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|76562591|gb|ABA45175.1| DNA ligase, NAD-dependent [Streptococcus agalactiae A909]
          Length = 652

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L++Q PE    + P + VG
Sbjct: 8   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEKQHPENILPNSPTHRVG 60


>gi|325529285|gb|EGD06234.1| NAD-dependent DNA ligase [Burkholderia sp. TJI49]
          Length = 691

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 19/42 (45%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   PE    D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFAELQQLEADHPEFVTPDSPTQRVG 72


>gi|22537014|ref|NP_687865.1| NAD-dependent DNA ligase LigA [Streptococcus agalactiae 2603V/R]
 gi|81454504|sp|Q8E084|DNLJ_STRA5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|22533870|gb|AAM99737.1|AE014230_17 DNA ligase, NAD-dependent [Streptococcus agalactiae 2603V/R]
          Length = 652

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L++Q PE    + P + VG
Sbjct: 8   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEKQHPENILPNSPTHRVG 60


>gi|330445331|ref|ZP_08308983.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489522|dbj|GAA03480.1| DNA ligase, NAD-dependent [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 671

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+ ++L  ++ + PE    D P   VG
Sbjct: 18  YHGHRYYVEDNPEIPDAEYDRMMQQLLKIEAEHPEWVTVDSPSQRVG 64


>gi|253701546|ref|YP_003022735.1| DNA ligase, NAD-dependent [Geobacter sp. M21]
 gi|251776396|gb|ACT18977.1| DNA ligase, NAD-dependent [Geobacter sp. M21]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 28/65 (43%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A   +++L      H + YY  D P  TD  YD +   L  L+   P+L   D P
Sbjct: 1   MDKTAAAQRIKWLSSEIERHNRLYYEQDMPEITDAEYDALFRELKELEASHPDLALPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TGRVG 65


>gi|167619582|ref|ZP_02388213.1| DNA ligase, NAD-dependent [Burkholderia thailandensis Bt4]
          Length = 691

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFAELQQIEAEHPDLVTPDSPTQRVG 72


>gi|167581473|ref|ZP_02374347.1| DNA ligase, NAD-dependent [Burkholderia thailandensis TXDOH]
          Length = 691

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFAELQQIEAEHPDLVTPDSPTQRVG 72


>gi|296116447|ref|ZP_06835061.1| putative DNA ligase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977040|gb|EFG83804.1| putative DNA ligase [Gluconacetobacter hansenii ATCC 23769]
          Length = 709

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +S  +A  E+  L  +     + Y++ D P+ TD +YD +  R   L++  P    +D P
Sbjct: 24  MSASQAASELALLADVIAQLDRAYHQDDAPIVTDAVYDALRRRNSELEQAHPRERRDDSP 83

Query: 114 WNTVG 118
              VG
Sbjct: 84  DTRVG 88


>gi|210621776|ref|ZP_03292805.1| hypothetical protein CLOHIR_00750 [Clostridium hiranonis DSM 13275]
 gi|210154540|gb|EEA85546.1| hypothetical protein CLOHIR_00750 [Clostridium hiranonis DSM 13275]
          Length = 678

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K +  ++++ L+    +H   YY  D P  +D  YD + + L  L+ + PE    D P
Sbjct: 1   MGKEDIKLQIDNLIDKINYHSDKYYNQDTPEISDFEYDMLMKELIKLEAENPEFKRVDSP 60

Query: 114 WNTVG 118
            N VG
Sbjct: 61  SNRVG 65


>gi|187924439|ref|YP_001896081.1| DNA ligase, NAD-dependent [Burkholderia phytofirmans PsJN]
 gi|254781278|sp|B2T5K0|DNLJ_BURPP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|187715633|gb|ACD16857.1| DNA ligase, NAD-dependent [Burkholderia phytofirmans PsJN]
          Length = 688

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L++++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDKLFKELESIETEHPDLIVPDSPTQRVG 73


>gi|260063119|ref|YP_003196199.1| DNA ligase [Robiginitalea biformata HTCC2501]
 gi|88784688|gb|EAR15858.1| DNA ligase [Robiginitalea biformata HTCC2501]
          Length = 673

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P+ +D  +D   + L  L++Q PE +D   P   VG
Sbjct: 24  HNYRYYVLDEPVISDYDFDMKLKALQDLEKQHPEFYDPASPTQRVG 69


>gi|282851211|ref|ZP_06260576.1| DNA ligase (NAD(+)) [Lactobacillus gasseri 224-1]
 gi|282557179|gb|EFB62776.1| DNA ligase (NAD(+)) [Lactobacillus gasseri 224-1]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YD+  + L  L++QFP+L   D     VG
Sbjct: 27  YYAKDAPVVEDAVYDKAYQELVELEKQFPDLVTSDSITQRVG 68


>gi|238854176|ref|ZP_04644523.1| DNA ligase, NAD-dependent [Lactobacillus gasseri 202-4]
 gi|238833252|gb|EEQ25542.1| DNA ligase, NAD-dependent [Lactobacillus gasseri 202-4]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YD+  + L  L++QFP+L   D     VG
Sbjct: 27  YYAKDAPVVEDAVYDKAYQELVELEKQFPDLVTSDSITQRVG 68


>gi|170692136|ref|ZP_02883299.1| DNA ligase, NAD-dependent [Burkholderia graminis C4D1M]
 gi|170142566|gb|EDT10731.1| DNA ligase, NAD-dependent [Burkholderia graminis C4D1M]
          Length = 693

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L++++ + P+L   D P   VG
Sbjct: 37  YYVLDQPDLPDAEYDKLFKELESIEAEHPDLIVPDSPTQRVG 78


>gi|163802586|ref|ZP_02196478.1| NAD-dependent DNA ligase LigA [Vibrio sp. AND4]
 gi|159173669|gb|EDP58488.1| NAD-dependent DNA ligase LigA [Vibrio sp. AND4]
          Length = 670

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 58  EAMIEVEYLVKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           E++++    +K +LH H   YY  DNP   D  YDR+   L  ++ + P+L   D P   
Sbjct: 3   ESVLQQLEELKESLHYHAVRYYVEDNPEIPDAEYDRMMRELLDIEAEHPDLVTVDSPSQR 62

Query: 117 VG 118
           VG
Sbjct: 63  VG 64


>gi|116630136|ref|YP_815308.1| NAD-dependent DNA ligase [Lactobacillus gasseri ATCC 33323]
 gi|122272927|sp|Q041K2|DNLJ_LACGA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116095718|gb|ABJ60870.1| NAD-dependent DNA ligase [Lactobacillus gasseri ATCC 33323]
          Length = 668

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YD+  + L  L++QFP+L   D     VG
Sbjct: 27  YYAKDAPVVEDAVYDKAYQELVELEKQFPDLVTSDSITQRVG 68


>gi|83720010|ref|YP_442546.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|257138755|ref|ZP_05587017.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
 gi|123753789|sp|Q2SX03|DNLJ_BURTA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|83653835|gb|ABC37898.1| DNA ligase, NAD-dependent [Burkholderia thailandensis E264]
          Length = 691

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFAELQQIEAEHPDLVTPDSPTQRVG 72


>gi|330973309|gb|EGH73375.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 670

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|92112835|ref|YP_572763.1| DNA ligase, NAD-dependent [Chromohalobacter salexigens DSM 3043]
 gi|122990589|sp|Q1QZP4|DNLJ_CHRSD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|91795925|gb|ABE58064.1| DNA ligase, NAD-dependent [Chromohalobacter salexigens DSM 3043]
          Length = 691

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P  TD  YD +   L +L+ + PEL   D P   VG
Sbjct: 26  YYVEDDPRITDAEYDALLRELQSLEAEHPELKTPDSPTQRVG 67


>gi|76798177|ref|ZP_00780429.1| DNA ligase, NAD-dependent [Streptococcus agalactiae 18RS21]
 gi|77405561|ref|ZP_00782652.1| DNA ligase, NAD-dependent [Streptococcus agalactiae H36B]
 gi|77410701|ref|ZP_00787060.1| DNA ligase, NAD-dependent [Streptococcus agalactiae CJB111]
 gi|76586485|gb|EAO62991.1| DNA ligase, NAD-dependent [Streptococcus agalactiae 18RS21]
 gi|77163237|gb|EAO74189.1| DNA ligase, NAD-dependent [Streptococcus agalactiae CJB111]
 gi|77175868|gb|EAO78646.1| DNA ligase, NAD-dependent [Streptococcus agalactiae H36B]
          Length = 648

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   + K YY  DNP  +D  YD++   L  L++Q PE    + P + VG
Sbjct: 4   LVSLLNQYAKEYYTQDNPTVSDSQYDQLYRELVELEKQHPENILPNSPTHRVG 56


>gi|325197886|gb|ADY93342.1| DNA ligase, NAD-dependent [Neisseria meningitidis G2136]
          Length = 841

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 44  YYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 85


>gi|85713360|ref|ZP_01044373.1| NAD-dependent DNA ligase [Idiomarina baltica OS145]
 gi|85692818|gb|EAQ30803.1| NAD-dependent DNA ligase [Idiomarina baltica OS145]
          Length = 449

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + K YY LD P   D  YD++   L  L+   PEL  +  P   VG
Sbjct: 21  YNKEYYELDEPTIPDSEYDKLFRELQTLEANNPELKSQHSPTEKVG 66


>gi|311744048|ref|ZP_07717854.1| NAD-dependent DNA ligase LigA [Aeromicrobium marinum DSM 15272]
 gi|311313178|gb|EFQ83089.1| NAD-dependent DNA ligase LigA [Aeromicrobium marinum DSM 15272]
          Length = 782

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA  EV  L++     ++ YY  D  L  D  YD    +L+A++ + PEL  +D P   V
Sbjct: 15  EARAEVTTLLERIAEAREAYYGQDASLVDDATYDGWLRQLEAVERRHPELQGQDSPTLNV 74

Query: 118 G 118
           G
Sbjct: 75  G 75


>gi|257869253|ref|ZP_05648906.1| NAD-dependent DNA ligase [Enterococcus gallinarum EG2]
 gi|257803417|gb|EEV32239.1| NAD-dependent DNA ligase [Enterococcus gallinarum EG2]
          Length = 676

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  L+  +P+L  ED P   VG
Sbjct: 26  YYVKDQPSVEDYVYDRLYKELVQLETDYPQLVTEDSPTQRVG 67


>gi|261377933|ref|ZP_05982506.1| DNA ligase, NAD-dependent [Neisseria cinerea ATCC 14685]
 gi|269145793|gb|EEZ72211.1| DNA ligase, NAD-dependent [Neisseria cinerea ATCC 14685]
          Length = 831

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 22  YYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 63


>gi|156973609|ref|YP_001444516.1| NAD-dependent DNA ligase LigA [Vibrio harveyi ATCC BAA-1116]
 gi|166216277|sp|A7MT54|DNLJ_VIBHB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|156525203|gb|ABU70289.1| hypothetical protein VIBHAR_01312 [Vibrio harveyi ATCC BAA-1116]
          Length = 670

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + PEL   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRMMRELLDIEAEHPELVTVDSPSLRVG 64


>gi|15676564|ref|NP_273708.1| DNA ligase [Neisseria meningitidis MC58]
 gi|161869603|ref|YP_001598770.1| DNA ligase [Neisseria meningitidis 053442]
 gi|304388085|ref|ZP_07370214.1| NAD-dependent DNA ligase LigA [Neisseria meningitidis ATCC 13091]
 gi|81784869|sp|Q9K0E3|DNLJ_NEIMB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|190359266|sp|A9M2U7|DNLJ_NEIM0 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|7225892|gb|AAF41084.1| DNA ligase [Neisseria meningitidis MC58]
 gi|161595156|gb|ABX72816.1| DNA ligase [Neisseria meningitidis 053442]
 gi|304337942|gb|EFM04082.1| NAD-dependent DNA ligase LigA [Neisseria meningitidis ATCC 13091]
 gi|316983632|gb|EFV62613.1| DNA ligase, NAD-dependent [Neisseria meningitidis H44/76]
 gi|325139885|gb|EGC62416.1| DNA ligase, NAD-dependent [Neisseria meningitidis CU385]
 gi|325200648|gb|ADY96103.1| DNA ligase, NAD-dependent [Neisseria meningitidis H44/76]
          Length = 841

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++   L+AL+   PEL   D P   VG
Sbjct: 44  YYTLDAPSVPDAEYDKLFRELEALELNHPELKLPDSPTQRVG 85


>gi|310826558|ref|YP_003958915.1| DNA ligase [Eubacterium limosum KIST612]
 gi|308738292|gb|ADO35952.1| DNA ligase [Eubacterium limosum KIST612]
          Length = 666

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D  YDR+ + L +L+  +P+    D P   VG
Sbjct: 26  YYDKDAPVIPDYAYDRMMQELISLETAYPQFLTSDSPSQRVG 67


>gi|229917963|ref|YP_002886609.1| DNA ligase, NAD-dependent [Exiguobacterium sp. AT1b]
 gi|229469392|gb|ACQ71164.1| DNA ligase, NAD-dependent [Exiguobacterium sp. AT1b]
          Length = 664

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++  +PEL   D P   VG
Sbjct: 21  YYVLDRPSVPDSEYDRLMNELIQIETDYPELRTPDSPTQRVG 62


>gi|330960233|gb|EGH60493.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 787

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|284166901|ref|YP_003405180.1| DNA ligase, NAD-dependent [Haloterrigena turkmenica DSM 5511]
 gi|284016556|gb|ADB62507.1| DNA ligase, NAD-dependent [Haloterrigena turkmenica DSM 5511]
          Length = 692

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  LS+ EA  +VE L +    H + YY   +P+  D  YD +  RL  L++ F  L   
Sbjct: 23  VGELSEDEAREQVELLREAIREHDRRYYVESDPVIADRTYDALFARLRDLEDAF-GLEHP 81

Query: 111 DHPWNTVG 118
           D P  +VG
Sbjct: 82  DSPTRSVG 89


>gi|295676829|ref|YP_003605353.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1002]
 gi|295436672|gb|ADG15842.1| DNA ligase, NAD-dependent [Burkholderia sp. CCGE1002]
          Length = 687

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 67  VKIALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++  L H  + YY LD P   D  YD++ + L+ ++ + P+L   D P   VG
Sbjct: 21  LRAELEHANYAYYVLDQPDLPDAEYDKLFKELERIEAEHPDLIVPDSPTQRVG 73


>gi|237799321|ref|ZP_04587782.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331022177|gb|EGI02234.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 703

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|209695779|ref|YP_002263709.1| NAD-dependent DNA ligase LigA [Aliivibrio salmonicida LFI1238]
 gi|254781250|sp|B6EJQ6|DNLJ_ALISL RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|208009732|emb|CAQ80037.1| NAD-dependent DNA ligase [Aliivibrio salmonicida LFI1238]
          Length = 669

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  D+P   D  YDR+ ++L  ++++ PE    D P   VG
Sbjct: 16  YHAYRYYVEDSPELPDAEYDRMMQQLLLIEKEHPEFMTVDSPSQRVG 62


>gi|66045063|ref|YP_234904.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. syringae
           B728a]
 gi|75502608|sp|Q4ZVF6|DNLJ_PSEU2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|63255770|gb|AAY36866.1| NAD-dependent DNA ligase [Pseudomonas syringae pv. syringae B728a]
          Length = 787

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|148986045|ref|ZP_01819066.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP3-BS71]
 gi|147921879|gb|EDK73005.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP3-BS71]
 gi|301800082|emb|CBW32679.1| DNA ligase [Streptococcus pneumoniae OXC141]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|15903068|ref|NP_358618.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae R6]
 gi|116516470|ref|YP_816476.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae D39]
 gi|81449679|sp|Q8DPS9|DNLJ_STRR6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|122278638|sp|Q04KH2|DNLJ_STRP2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|15458641|gb|AAK99828.1| DNA ligase [Streptococcus pneumoniae R6]
 gi|116077046|gb|ABJ54766.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae D39]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|257066474|ref|YP_003152730.1| NAD-dependent DNA ligase LigA [Anaerococcus prevotii DSM 20548]
 gi|256798354|gb|ACV29009.1| DNA ligase, NAD-dependent [Anaerococcus prevotii DSM 20548]
          Length = 666

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL +DG YD++ + L  L+E+   + D D P   VG
Sbjct: 21  YYTLDEPLVSDGEYDQIYDELRKLEEETGYVRD-DSPTQVVG 61


>gi|169834268|ref|YP_001694538.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae
           Hungary19A-6]
 gi|254781426|sp|B1IBQ3|DNLJ_STRPI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|168996770|gb|ACA37382.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae Hungary19A-6]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|149006206|ref|ZP_01829918.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP18-BS74]
 gi|225856757|ref|YP_002738268.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae P1031]
 gi|307127352|ref|YP_003879383.1| NAD-dependent DNA ligase [Streptococcus pneumoniae 670-6B]
 gi|254781432|sp|C1CKI0|DNLJ_STRZP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147761983|gb|EDK68945.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP18-BS74]
 gi|225725530|gb|ACO21382.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae P1031]
 gi|306484414|gb|ADM91283.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae 670-6B]
 gi|332075451|gb|EGI85920.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA41301]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|148998387|ref|ZP_01825829.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP11-BS70]
 gi|168576158|ref|ZP_02722052.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae MLV-016]
 gi|194398076|ref|YP_002037745.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae G54]
 gi|225861080|ref|YP_002742589.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298230922|ref|ZP_06964603.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254162|ref|ZP_06977748.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502866|ref|YP_003724806.1| DNA ligase (NAD(+)) [Streptococcus pneumoniae TCH8431/19A]
 gi|254781424|sp|B5E4M9|DNLJ_STRP4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781433|sp|C1CRL7|DNLJ_STRZT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147755784|gb|EDK62829.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP11-BS70]
 gi|183577935|gb|EDT98463.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae MLV-016]
 gi|194357743|gb|ACF56191.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae G54]
 gi|225727034|gb|ACO22885.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238461|gb|ADI69592.1| DNA ligase (NAD(+)) [Streptococcus pneumoniae TCH8431/19A]
 gi|327389325|gb|EGE87670.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA04375]
 gi|332075071|gb|EGI85542.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA17545]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|111658008|ref|ZP_01408712.1| hypothetical protein SpneT_02000805 [Streptococcus pneumoniae
           TIGR4]
          Length = 648

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 56


>gi|330981936|gb|EGH80039.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 787

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|329667842|gb|AEB93790.1| NAD-dependent DNA ligase [Lactobacillus johnsonii DPC 6026]
          Length = 668

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D P+  D +YD+  + L  L+EQFP+L   +     VG
Sbjct: 22  KWADDYYAKDAPVVEDAVYDKTYQELVELEEQFPDLVTANSITQRVG 68


>gi|90579891|ref|ZP_01235699.1| DNA ligase [Vibrio angustum S14]
 gi|90438776|gb|EAS63959.1| DNA ligase [Vibrio angustum S14]
          Length = 670

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+ ++L  ++   PE    D P   VG
Sbjct: 18  YHGHRYYVEDNPEIPDAEYDRMMQQLIKIEADHPEWITVDSPSQRVG 64


>gi|168486469|ref|ZP_02710977.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC1087-00]
 gi|183570508|gb|EDT91036.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC1087-00]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|149024919|ref|ZP_01836320.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP23-BS72]
 gi|303259779|ref|ZP_07345754.1| DNA ligase [Streptococcus pneumoniae SP-BS293]
 gi|303262954|ref|ZP_07348889.1| DNA ligase [Streptococcus pneumoniae SP14-BS292]
 gi|303264916|ref|ZP_07350832.1| DNA ligase [Streptococcus pneumoniae BS397]
 gi|303266897|ref|ZP_07352775.1| DNA ligase [Streptococcus pneumoniae BS457]
 gi|303268933|ref|ZP_07354718.1| DNA ligase [Streptococcus pneumoniae BS458]
 gi|147929542|gb|EDK80536.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP23-BS72]
 gi|301794230|emb|CBW36650.1| DNA ligase [Streptococcus pneumoniae INV104]
 gi|302635931|gb|EFL66431.1| DNA ligase [Streptococcus pneumoniae SP14-BS292]
 gi|302638984|gb|EFL69444.1| DNA ligase [Streptococcus pneumoniae SP-BS293]
 gi|302641551|gb|EFL71913.1| DNA ligase [Streptococcus pneumoniae BS458]
 gi|302643595|gb|EFL73864.1| DNA ligase [Streptococcus pneumoniae BS457]
 gi|302645604|gb|EFL75835.1| DNA ligase [Streptococcus pneumoniae BS397]
 gi|332202976|gb|EGJ17044.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA47901]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|332200505|gb|EGJ14577.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA41317]
          Length = 648

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 56


>gi|294776463|ref|ZP_06741938.1| DNA ligase (NAD(+)) [Bacteroides vulgatus PC510]
 gi|294449660|gb|EFG18185.1| DNA ligase (NAD(+)) [Bacteroides vulgatus PC510]
          Length = 665

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|254882009|ref|ZP_05254719.1| polydeoxyribonucleotide synthase [Bacteroides sp. 4_3_47FAA]
 gi|254834802|gb|EET15111.1| polydeoxyribonucleotide synthase [Bacteroides sp. 4_3_47FAA]
          Length = 665

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|225858927|ref|YP_002740437.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae 70585]
 gi|254781425|sp|C1C7B1|DNLJ_STRP7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225720821|gb|ACO16675.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae 70585]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|150005810|ref|YP_001300554.1| DNA ligase [Bacteroides vulgatus ATCC 8482]
 gi|237725408|ref|ZP_04555889.1| DNA ligase [Bacteroides sp. D4]
 gi|319640984|ref|ZP_07995691.1| DNA ligase [Bacteroides sp. 3_1_40A]
 gi|166215396|sp|A6L5G8|DNLJ_BACV8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|149934234|gb|ABR40932.1| DNA ligase [Bacteroides vulgatus ATCC 8482]
 gi|229436095|gb|EEO46172.1| DNA ligase [Bacteroides dorei 5_1_36/D4]
 gi|317387362|gb|EFV68234.1| DNA ligase [Bacteroides sp. 3_1_40A]
          Length = 665

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|149012887|ref|ZP_01833800.1| DNA ligase [Streptococcus pneumoniae SP19-BS75]
 gi|182684133|ref|YP_001835880.1| DNA ligase [Streptococcus pneumoniae CGSP14]
 gi|254781428|sp|B2IPZ1|DNLJ_STRPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|147763176|gb|EDK70116.1| DNA ligase [Streptococcus pneumoniae SP19-BS75]
 gi|182629467|gb|ACB90415.1| DNA ligase [Streptococcus pneumoniae CGSP14]
 gi|301801994|emb|CBW34723.1| DNA ligase [Streptococcus pneumoniae INV200]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|15900984|ref|NP_345588.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae TIGR4]
 gi|81531953|sp|Q97QT2|DNLJ_STRPN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|14972593|gb|AAK75228.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae TIGR4]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|148994566|ref|ZP_01823725.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP9-BS68]
 gi|168488962|ref|ZP_02713161.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP195]
 gi|147927160|gb|EDK78197.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP9-BS68]
 gi|183572496|gb|EDT93024.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP195]
 gi|332073479|gb|EGI83958.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA17570]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|149003762|ref|ZP_01828594.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP14-BS69]
 gi|237650785|ref|ZP_04525037.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae CCRI 1974]
 gi|237822373|ref|ZP_04598218.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae CCRI
           1974M2]
 gi|147758208|gb|EDK65210.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae SP14-BS69]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|227509971|ref|ZP_03940020.1| NAD-dependent DNA ligase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190577|gb|EEI70644.1| NAD-dependent DNA ligase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 675

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D+P   D +YD+  ++L  L+  FP++   D P   VG
Sbjct: 24  KWADEYYTYDSPSVEDSVYDQTYQQLVDLETTFPQIVTPDSPTQKVG 70


>gi|208434535|ref|YP_002266201.1| DNA ligase [Helicobacter pylori G27]
 gi|254781346|sp|B5Z6Y6|DNLJ_HELPG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|208432464|gb|ACI27335.1| DNA ligase [Helicobacter pylori G27]
          Length = 658

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD  + +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDESIVSDAVYDELYQELKAYEEKNPNDIQANSPTQKVG 63


>gi|110679832|ref|YP_682839.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
 gi|123172419|sp|Q166E0|DNLJ_ROSDO RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|109455948|gb|ABG32153.1| DNA ligase, NAD-dependent [Roseobacter denitrificans OCh 114]
          Length = 705

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%)

Query: 53  SLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDH 112
           SL++  A  E+  L  +       Y+  D P+ +D  +D    R  A++E+FP L   D 
Sbjct: 8   SLTEKAAKKELSKLADLLDQANTAYHANDAPIISDADFDAYKRRNLAIEERFPHLKRADS 67

Query: 113 PWNTVG 118
           P + VG
Sbjct: 68  PTDRVG 73


>gi|330897709|gb|EGH29128.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 657

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|307067701|ref|YP_003876667.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Streptococcus pneumoniae AP200]
 gi|306409238|gb|ADM84665.1| NAD-dependent DNA ligase (contains BRCT domain type II)
           [Streptococcus pneumoniae AP200]
          Length = 648

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 56


>gi|119356312|ref|YP_910956.1| DNA ligase, NAD-dependent [Chlorobium phaeobacteroides DSM 266]
 gi|166215573|sp|A1BDQ5|DNLJ_CHLPD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|119353661|gb|ABL64532.1| DNA ligase, NAD-dependent [Chlorobium phaeobacteroides DSM 266]
          Length = 676

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L +    H   YY    P  +D  +DR+ ERL  L++ FP+    D P + VG
Sbjct: 11  IEELRREINRHNTLYYVDARPEISDYEFDRLMERLIELEKAFPDFVTPDSPSHRVG 66


>gi|325267489|ref|ZP_08134142.1| NAD-dependent DNA ligase LigA [Kingella denitrificans ATCC 33394]
 gi|324981014|gb|EGC16673.1| NAD-dependent DNA ligase LigA [Kingella denitrificans ATCC 33394]
          Length = 804

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV+    +   YY LD P   D  YDR+   L+ L+ ++P+    + P   VG
Sbjct: 32  IRTLVQTLNRYAHEYYTLDAPSVPDAEYDRLYRELETLEAEYPQFRLPESPTQRVG 87


>gi|311029281|ref|ZP_07707371.1| NAD-dependent DNA ligase LigA [Bacillus sp. m3-13]
          Length = 668

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P  +D  YD + + L  L+++ PEL  ED P   VG
Sbjct: 24  YHVLDKPSVSDAEYDSLLQELLTLEKEHPELQTEDSPTQRVG 65


>gi|295394422|ref|ZP_06804646.1| NAD-dependent DNA ligase LigA [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972774|gb|EFG48625.1| NAD-dependent DNA ligase LigA [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 740

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H++ YY  D P  +D  +D +   L+ L+  +PEL  +D P   VG
Sbjct: 36  HREAYYVHDAPKISDKEFDELVHALEDLESAYPELARDDSPTQKVG 81


>gi|332359434|gb|EGJ37254.1| NAD-dependent DNA ligase LigA [Streptococcus sanguinis SK355]
          Length = 652

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LVK+   +   YY  D P  +D  YDR+   L  L+E++P     D P + VG
Sbjct: 8   LVKLLNRYAHEYYTADRPSVSDSEYDRLYRELAELEEKYPTDILPDSPTHRVG 60


>gi|163782033|ref|ZP_02177032.1| D-tyrosyl-tRNA deacylase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882565|gb|EDP76070.1| D-tyrosyl-tRNA deacylase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 715

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 31  EAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLY 90
           E + +   R L S L++ +K     K EA   V+ L ++  +H   YY   +P+ +D  Y
Sbjct: 7   ERELIELTRKLLSELERIRKA---GKEEAQEYVQELREVINYHDYKYYVQASPVISDYEY 63

Query: 91  DRVSERLDALQEQFPELFDEDHPWNTV 117
           D++   L  L++++PEL   D P   V
Sbjct: 64  DQLFRALRDLEKKYPELITPDSPTQRV 90


>gi|160945211|ref|ZP_02092437.1| hypothetical protein FAEPRAM212_02730 [Faecalibacterium prausnitzii
           M21/2]
 gi|158442942|gb|EDP19947.1| hypothetical protein FAEPRAM212_02730 [Faecalibacterium prausnitzii
           M21/2]
          Length = 671

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 28/61 (45%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A   V+ L  I   + + YY  D P   D  YD ++  L  L+ QFP+L     P   V
Sbjct: 8   QAKKRVKELRAIIEKNNRLYYDQDAPELEDFEYDALTRELKELEAQFPQLVTAASPTQKV 67

Query: 118 G 118
           G
Sbjct: 68  G 68


>gi|33864448|ref|NP_896008.1| NAD-dependent DNA ligase LigA [Prochlorococcus marinus str. MIT
           9313]
 gi|81576658|sp|Q7V3Z9|DNLJ_PROMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|33641228|emb|CAE22358.1| NAD-dependent DNA ligase [Prochlorococcus marinus str. MIT 9313]
          Length = 696

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           TS++  +   E+  L+  A H    YY LD P   D +YDR+   L  L+ +   L   D
Sbjct: 4   TSITPPKRAAELRQLLNQAAHS---YYVLDTPTMEDAVYDRLYRELLNLEAKDSSLLTPD 60

Query: 112 HPWNTVG 118
            P   +G
Sbjct: 61  SPTQRIG 67


>gi|77409440|ref|ZP_00786135.1| DNA ligase, NAD-dependent [Streptococcus agalactiae COH1]
 gi|77171952|gb|EAO75126.1| DNA ligase, NAD-dependent [Streptococcus agalactiae COH1]
          Length = 643

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           K YY  DNP  +D  YD++   L  L+EQ PE    + P + VG
Sbjct: 8   KEYYTQDNPTVSDSQYDQLYRELVELEEQHPENILPNSPTHRVG 51


>gi|283832193|ref|ZP_06351934.1| DNA ligase, NAD-dependent [Citrobacter youngae ATCC 29220]
 gi|291071830|gb|EFE09939.1| DNA ligase, NAD-dependent [Citrobacter youngae ATCC 29220]
          Length = 671

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH+  Y+ +D P   D  YD +  +L  L+   PEL   D P   VG
Sbjct: 17  HHEYLYHVMDAPEIPDVEYDLLMHKLQWLEALHPELITPDSPTQRVG 63


>gi|257439787|ref|ZP_05615542.1| DNA ligase, NAD-dependent [Faecalibacterium prausnitzii A2-165]
 gi|257197807|gb|EEU96091.1| DNA ligase, NAD-dependent [Faecalibacterium prausnitzii A2-165]
          Length = 209

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +A    E L  I   + + YY  D P   D  YD ++  L AL+ +FP+L   + P   V
Sbjct: 5   QARKRAEELRVIIERNNRLYYDQDAPELEDFEYDALTRELKALEAEFPQLVTANSPTQKV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|167586849|ref|ZP_02379237.1| DNA ligase, NAD-dependent [Burkholderia ubonensis Bu]
          Length = 691

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++   PEL   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFLELQQIEADHPELVTPDSPTQRVG 72


>gi|326776439|ref|ZP_08235704.1| DNA ligase, NAD-dependent [Streptomyces cf. griseus XylebKG-1]
 gi|326656772|gb|EGE41618.1| DNA ligase, NAD-dependent [Streptomyces cf. griseus XylebKG-1]
          Length = 743

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +DR    L+AL+E+ P L   D P   V 
Sbjct: 31  HRFRYYVKDQPVVSDADFDRQLRSLEALEEEHPSLRTPDSPTQKVA 76


>gi|254779395|ref|YP_003057500.1| NAD-dependent DNA ligase LigA [Helicobacter pylori B38]
 gi|254001306|emb|CAX29287.1| DNA ligase (NAD(+)) [Helicobacter pylori B38]
          Length = 656

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 64  EYLVKIAL-----HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL +IA      HH   YY LD  + +D +YD + + L A +E+ P     + P   VG
Sbjct: 7   EYLERIAYLNTLSHH---YYNLDESIVSDAVYDELYQELKAYEEENPNDIQANSPTQKVG 63


>gi|331013366|gb|EGH93422.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|330939980|gb|EGH43181.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 731

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 17  QHNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|182435814|ref|YP_001823533.1| NAD-dependent DNA ligase LigA [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|254778153|sp|B1VZW1|DNLJ2_STRGG RecName: Full=DNA ligase 2; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+] 2
 gi|178464330|dbj|BAG18850.1| putative DNA ligase [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 743

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +DR    L+AL+E+ P L   D P   V 
Sbjct: 31  HRFRYYVKDQPVVSDADFDRQLRSLEALEEEHPSLRTPDSPTQKVA 76


>gi|293363574|ref|ZP_06610330.1| DNA ligase (NAD(+)) [Mycoplasma alligatoris A21JP2]
 gi|292552923|gb|EFF41677.1| DNA ligase (NAD(+)) [Mycoplasma alligatoris A21JP2]
          Length = 660

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            KW   YY LD P  TD +YD+  + L  ++  +PE   E+ P   +G
Sbjct: 17  NKWNNEYYNLDTPSVTDEVYDQEYQELLEIESMYPEAILENSPSQIIG 64


>gi|255327262|ref|ZP_05368336.1| DNA ligase, NAD-dependent [Rothia mucilaginosa ATCC 25296]
 gi|255295542|gb|EET74885.1| DNA ligase, NAD-dependent [Rothia mucilaginosa ATCC 25296]
          Length = 735

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 74  QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ YY  D P  +D  YD++  RL+ ++ + P +   D P   VG
Sbjct: 38  RRAYYNEDAPFLSDAEYDKLYRRLEIIEAEHPLIIANDSPTQEVG 82


>gi|146296740|ref|YP_001180511.1| DNA ligase, NAD-dependent [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166215569|sp|A4XK85|DNLJ_CALS8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145410316|gb|ABP67320.1| DNA ligase, NAD-dependent [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 673

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYIFPDSPTQRVG 64


>gi|303239321|ref|ZP_07325849.1| DNA ligase, NAD-dependent [Acetivibrio cellulolyticus CD2]
 gi|302593107|gb|EFL62827.1| DNA ligase, NAD-dependent [Acetivibrio cellulolyticus CD2]
          Length = 663

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E L K   +H   YY  D+   +D  YD++S  L  L+++ PEL   + P   VG
Sbjct: 7   IEELRKTIEYHNDRYYNQDDAEISDYEYDQLSLELRKLEQEHPELALTNSPTQKVG 62


>gi|265753576|ref|ZP_06088931.1| DNA ligase, NAD-dependent [Bacteroides sp. 3_1_33FAA]
 gi|263235290|gb|EEZ20814.1| DNA ligase, NAD-dependent [Bacteroides sp. 3_1_33FAA]
          Length = 665

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|148989161|ref|ZP_01820551.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae SP6-BS73]
 gi|147925384|gb|EDK76462.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae SP6-BS73]
          Length = 374

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG 56


>gi|307269776|ref|ZP_07551106.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX4248]
 gi|306513886|gb|EFM82488.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX4248]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|256959858|ref|ZP_05564029.1| NAD-dependent DNA ligase [Enterococcus faecalis Merz96]
 gi|293385046|ref|ZP_06630880.1| DNA ligase, NAD-dependent [Enterococcus faecalis R712]
 gi|293389317|ref|ZP_06633778.1| DNA ligase, NAD-dependent [Enterococcus faecalis S613]
 gi|312906035|ref|ZP_07765048.1| DNA ligase, NAD-dependent [Enterococcus faecalis DAPTO 512]
 gi|312909381|ref|ZP_07768237.1| DNA ligase, NAD-dependent [Enterococcus faecalis DAPTO 516]
 gi|256950354|gb|EEU66986.1| NAD-dependent DNA ligase [Enterococcus faecalis Merz96]
 gi|291077724|gb|EFE15088.1| DNA ligase, NAD-dependent [Enterococcus faecalis R712]
 gi|291081339|gb|EFE18302.1| DNA ligase, NAD-dependent [Enterococcus faecalis S613]
 gi|310628030|gb|EFQ11313.1| DNA ligase, NAD-dependent [Enterococcus faecalis DAPTO 512]
 gi|311290405|gb|EFQ68961.1| DNA ligase, NAD-dependent [Enterococcus faecalis DAPTO 516]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|255971181|ref|ZP_05421767.1| NAD-dependent DNA ligase [Enterococcus faecalis T1]
 gi|255962199|gb|EET94675.1| NAD-dependent DNA ligase [Enterococcus faecalis T1]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|237757130|ref|ZP_04585563.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237690707|gb|EEP59882.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 490

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L+K EA   VE L ++   H   YY L  P+ +D  YD++ + L  ++ ++PEL   D P
Sbjct: 25  LTKEEAKKIVEDLREVIRFHDWRYYILAQPVISDYEYDKLFKLLKDIENKYPELITPDSP 84

Query: 114 WNTV 117
              +
Sbjct: 85  TQRI 88


>gi|237709923|ref|ZP_04540404.1| DNA ligase [Bacteroides sp. 9_1_42FAA]
 gi|229456016|gb|EEO61737.1| DNA ligase [Bacteroides sp. 9_1_42FAA]
          Length = 665

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|229548668|ref|ZP_04437393.1| DNA ligase, NAD-dependent [Enterococcus faecalis ATCC 29200]
 gi|257420983|ref|ZP_05597973.1| DNA ligase [Enterococcus faecalis X98]
 gi|312953107|ref|ZP_07771956.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0102]
 gi|229306184|gb|EEN72180.1| DNA ligase, NAD-dependent [Enterococcus faecalis ATCC 29200]
 gi|257162807|gb|EEU92767.1| DNA ligase [Enterococcus faecalis X98]
 gi|310628941|gb|EFQ12224.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0102]
 gi|315153982|gb|EFT97998.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0031]
 gi|315156746|gb|EFU00763.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0043]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|260774893|ref|ZP_05883794.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609148|gb|EEX35306.1| DNA ligase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 669

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY  DNP   D  YDR+   L  L+ + P+L   D P   VG
Sbjct: 18  YHGVKYYVEDNPEVPDAEYDRLMRELLELEAEHPDLVSIDSPSQRVG 64


>gi|212693183|ref|ZP_03301311.1| hypothetical protein BACDOR_02690 [Bacteroides dorei DSM 17855]
 gi|212664288|gb|EEB24860.1| hypothetical protein BACDOR_02690 [Bacteroides dorei DSM 17855]
          Length = 665

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 60  MIEVEYLVKI--ALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNT 116
           M E+E + ++   LH   + YY L+ P  TD  +D++   L  L+E+ PE  DE+ P   
Sbjct: 1   MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR 60

Query: 117 VG 118
           VG
Sbjct: 61  VG 62


>gi|188527537|ref|YP_001910224.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Shi470]
 gi|254781347|sp|B2UTL2|DNLJ_HELPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|188143777|gb|ACD48194.1| NAD-dependent DNA ligase LigA [Helicobacter pylori Shi470]
          Length = 656

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  SKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPW 114
           S+ E +  +EYL  ++ HH   YY LD+ + +D +YD + + L A + + P     + P 
Sbjct: 4   SQKEYLERIEYLNTLS-HH---YYNLDDSIVSDAVYDELYQELKAYEGKNPNSIQANSPT 59

Query: 115 NTVG 118
             VG
Sbjct: 60  QKVG 63


>gi|330986172|gb|EGH84275.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|329576880|gb|EGG58365.1| DNA ligase [Enterococcus faecalis TX1467]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|320323491|gb|EFW79576.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|315145225|gb|EFT89241.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX2141]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|312900318|ref|ZP_07759629.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0470]
 gi|311292506|gb|EFQ71062.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0470]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|302185110|ref|ZP_07261783.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. syringae
           642]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|227517688|ref|ZP_03947737.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0104]
 gi|257083650|ref|ZP_05578011.1| NAD-dependent DNA ligase [Enterococcus faecalis Fly1]
 gi|227074843|gb|EEI12806.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0104]
 gi|256991680|gb|EEU78982.1| NAD-dependent DNA ligase [Enterococcus faecalis Fly1]
 gi|315146961|gb|EFT90977.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX4244]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|312135376|ref|YP_004002714.1| DNA ligase, nad-dependent [Caldicellulosiruptor owensensis OL]
 gi|311775427|gb|ADQ04914.1| DNA ligase, NAD-dependent [Caldicellulosiruptor owensensis OL]
          Length = 673

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVLPDSPTQRVG 64


>gi|256617609|ref|ZP_05474455.1| NAD-dependent DNA ligase [Enterococcus faecalis ATCC 4200]
 gi|257089149|ref|ZP_05583510.1| NAD-dependent DNA ligase [Enterococcus faecalis CH188]
 gi|312904259|ref|ZP_07763421.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0635]
 gi|256597136|gb|EEU16312.1| NAD-dependent DNA ligase [Enterococcus faecalis ATCC 4200]
 gi|256997961|gb|EEU84481.1| NAD-dependent DNA ligase [Enterococcus faecalis CH188]
 gi|310632355|gb|EFQ15638.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0635]
 gi|315578805|gb|EFU90996.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0630]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|229546559|ref|ZP_04435284.1| NAD-dependent DNA ligase [Enterococcus faecalis TX1322]
 gi|256854411|ref|ZP_05559775.1| DNA ligase [Enterococcus faecalis T8]
 gi|307274689|ref|ZP_07555861.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX2134]
 gi|307296388|ref|ZP_07576212.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0411]
 gi|229308304|gb|EEN74291.1| NAD-dependent DNA ligase [Enterococcus faecalis TX1322]
 gi|256709971|gb|EEU25015.1| DNA ligase [Enterococcus faecalis T8]
 gi|306496043|gb|EFM65628.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0411]
 gi|306508618|gb|EFM77716.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX2134]
 gi|315029103|gb|EFT41035.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX4000]
 gi|315157732|gb|EFU01749.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0312]
 gi|323479918|gb|ADX79357.1| DNA ligase, NAD-dependent [Enterococcus faecalis 62]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|29375318|ref|NP_814472.1| DNA ligase, NAD-dependent [Enterococcus faecalis V583]
 gi|227554838|ref|ZP_03984885.1| DNA ligase, NAD-dependent [Enterococcus faecalis HH22]
 gi|256761492|ref|ZP_05502072.1| NAD-dependent DNA ligase [Enterococcus faecalis T3]
 gi|257415292|ref|ZP_05592286.1| NAD-dependent DNA ligase [Enterococcus faecalis AR01/DG]
 gi|257418334|ref|ZP_05595328.1| NAD-dependent DNA ligase [Enterococcus faecalis T11]
 gi|81437298|sp|Q837V6|DNLJ_ENTFA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|29342778|gb|AAO80542.1| DNA ligase, NAD-dependent [Enterococcus faecalis V583]
 gi|227176007|gb|EEI56979.1| DNA ligase, NAD-dependent [Enterococcus faecalis HH22]
 gi|256682743|gb|EEU22438.1| NAD-dependent DNA ligase [Enterococcus faecalis T3]
 gi|257157120|gb|EEU87080.1| NAD-dependent DNA ligase [Enterococcus faecalis ARO1/DG]
 gi|257160162|gb|EEU90122.1| NAD-dependent DNA ligase [Enterococcus faecalis T11]
 gi|315031451|gb|EFT43383.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0017]
 gi|315166929|gb|EFU10946.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX1341]
 gi|315575350|gb|EFU87541.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0309B]
 gi|315581380|gb|EFU93571.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0309A]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|116074145|ref|ZP_01471407.1| DNA ligase [Synechococcus sp. RS9916]
 gi|116069450|gb|EAU75202.1| DNA ligase [Synechococcus sp. RS9916]
          Length = 691

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E+  L+  A H    YY LD P+  D +YDR+   L  L+   P L   D P   VG
Sbjct: 11  ELRGLLNTAAHA---YYVLDAPVMEDPVYDRLYRELLELESADPSLVTVDSPTQRVG 64


>gi|327475235|gb|AEA77212.1| DNA ligase [Exiguobacterium sp. EPVM]
          Length = 664

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++  +PEL   D P   VG
Sbjct: 21  YYVLDRPSVPDAEYDRLMNELIEIETDYPELRSPDSPTQRVG 62


>gi|326392616|ref|ZP_08213952.1| DNA ligase (NAD(+)) [Thermoanaerobacter ethanolicus JW 200]
 gi|325991342|gb|EGD49998.1| DNA ligase (NAD(+)) [Thermoanaerobacter ethanolicus JW 200]
          Length = 210

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +H   YY LD P  +D  YD +   L  L+E++PE    D P   VG
Sbjct: 21  YHNYRYYVLDQPEISDYEYDMLMRELIELEEKYPEFKTPDSPSQRVG 67


>gi|256957407|ref|ZP_05561578.1| NAD-dependent DNA ligase [Enterococcus faecalis DS5]
 gi|257077597|ref|ZP_05571958.1| NAD-dependent DNA ligase [Enterococcus faecalis JH1]
 gi|294779927|ref|ZP_06745308.1| DNA ligase (NAD(+)) [Enterococcus faecalis PC1.1]
 gi|256947903|gb|EEU64535.1| NAD-dependent DNA ligase [Enterococcus faecalis DS5]
 gi|256985627|gb|EEU72929.1| NAD-dependent DNA ligase [Enterococcus faecalis JH1]
 gi|294452976|gb|EFG21397.1| DNA ligase (NAD(+)) [Enterococcus faecalis PC1.1]
 gi|295114065|emb|CBL32702.1| DNA ligase, NAD-dependent [Enterococcus sp. 7L76]
 gi|315036101|gb|EFT48033.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0027]
 gi|315172192|gb|EFU16209.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX1346]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|255973805|ref|ZP_05424391.1| NAD-dependent DNA ligase [Enterococcus faecalis T2]
 gi|256964440|ref|ZP_05568611.1| NAD-dependent DNA ligase [Enterococcus faecalis HIP11704]
 gi|257080988|ref|ZP_05575349.1| NAD-dependent DNA ligase [Enterococcus faecalis E1Sol]
 gi|307272536|ref|ZP_07553789.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0855]
 gi|307284516|ref|ZP_07564678.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0860]
 gi|255966677|gb|EET97299.1| NAD-dependent DNA ligase [Enterococcus faecalis T2]
 gi|256954936|gb|EEU71568.1| NAD-dependent DNA ligase [Enterococcus faecalis HIP11704]
 gi|256989018|gb|EEU76320.1| NAD-dependent DNA ligase [Enterococcus faecalis E1Sol]
 gi|306503193|gb|EFM72447.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0860]
 gi|306510821|gb|EFM79838.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0855]
 gi|315151576|gb|EFT95592.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0012]
 gi|315170712|gb|EFU14729.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX1342]
 gi|327534312|gb|AEA93146.1| NAD-dependent DNA ligase LigA [Enterococcus faecalis OG1RF]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|257086082|ref|ZP_05580443.1| NAD-dependent DNA ligase [Enterococcus faecalis D6]
 gi|256994112|gb|EEU81414.1| NAD-dependent DNA ligase [Enterococcus faecalis D6]
 gi|315025779|gb|EFT37711.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX2137]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|300861866|ref|ZP_07107946.1| DNA ligase (NAD(+)) [Enterococcus faecalis TUSoD Ef11]
 gi|300848391|gb|EFK76148.1| DNA ligase (NAD(+)) [Enterococcus faecalis TUSoD Ef11]
          Length = 676

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|225025741|ref|ZP_03714933.1| hypothetical protein EIKCOROL_02645 [Eikenella corrodens ATCC
           23834]
 gi|224941522|gb|EEG22731.1| hypothetical protein EIKCOROL_02645 [Eikenella corrodens ATCC
           23834]
          Length = 778

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV+    +   YY LD P   D  YDR+   L+AL+ + P+    + P   VG
Sbjct: 8   IRTLVQTLNRYAHEYYTLDAPSVPDAEYDRLYRELEALEAEHPQFRLPESPTQRVG 63


>gi|71737941|ref|YP_274013.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123775130|sp|Q48KR2|DNLJ_PSE14 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71558494|gb|AAZ37705.1| DNA ligase, NAD-dependent [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320329466|gb|EFW85458.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|269836970|ref|YP_003319198.1| DNA ligase, NAD-dependent [Sphaerobacter thermophilus DSM 20745]
 gi|269786233|gb|ACZ38376.1| DNA ligase, NAD-dependent [Sphaerobacter thermophilus DSM 20745]
          Length = 680

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD +   L  L+   PEL   D P   VG
Sbjct: 24  YYVLDQPSVSDAEYDALMNELRELEAAHPELITPDSPTQRVG 65


>gi|115352108|ref|YP_773947.1| DNA ligase [Burkholderia ambifaria AMMD]
 gi|122322835|sp|Q0BE10|DNLJ_BURCM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|115282096|gb|ABI87613.1| DNA ligase, NAD-dependent [Burkholderia ambifaria AMMD]
          Length = 691

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFGELQQLETDHPDLVTPDSPTQRVG 72


>gi|260911472|ref|ZP_05918061.1| DNA ligase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260634401|gb|EEX52502.1| DNA ligase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 666

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH   YY  ++P  +D  +D +   L  L+ + PE++D + P   VG
Sbjct: 16  HHNYLYYVQNSPTLSDQEFDHLMRELQDLEAKHPEVYDPNSPTQRVG 62


>gi|82523924|emb|CAI78646.1| NAD-dependent DNA ligase [uncultured delta proteobacterium]
          Length = 670

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +I  +H K YY+ D P  +D  YD +   L  L+ QFP+      P   VG
Sbjct: 14  LRQIIEYHNKRYYQQDAPEISDAEYDLLMRELHNLEAQFPDDELASSPTQRVG 66


>gi|330889906|gb|EGH22567.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. mori str.
           301020]
          Length = 787

 Score = 35.8 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEAENPHLVTPDSPTQRVG 63


>gi|312796238|ref|YP_004029160.1| NAD-dependent DNA ligase [Burkholderia rhizoxinica HKI 454]
 gi|312168013|emb|CBW75016.1| NAD-dependent DNA ligase (EC 6.5.1.2) [Burkholderia rhizoxinica HKI
           454]
          Length = 681

 Score = 35.8 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L+ ++   P+L   D P   VG
Sbjct: 31  YYVLDRPEIPDAEYDKLFKELEQIEADHPDLITPDSPTQRVG 72


>gi|325681379|ref|ZP_08160905.1| DNA ligase (NAD+) [Ruminococcus albus 8]
 gi|324106869|gb|EGC01159.1| DNA ligase (NAD+) [Ruminococcus albus 8]
          Length = 665

 Score = 35.8 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 27/63 (42%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K  A   ++ LV    +H   YY  D    +D  YD +   L  L+ Q+PE    D P  
Sbjct: 10  KDNAKKRIDELVATLNYHAHLYYVEDRNEISDYDYDMMQNELKKLEAQYPEFIRPDSPTQ 69

Query: 116 TVG 118
            VG
Sbjct: 70  RVG 72


>gi|332291077|ref|YP_004429686.1| DNA ligase, NAD-dependent [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169163|gb|AEE18418.1| DNA ligase, NAD-dependent [Krokinobacter diaphorus 4H-3-7-5]
          Length = 664

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LD P  +D  +D+  ++L+AL+   PE  D + P + VG
Sbjct: 17  HNHSYYVLDTPTISDFDFDQKLKQLEALEAAHPEFDDPNSPTHRVG 62


>gi|317056400|ref|YP_004104867.1| DNA ligase, NAD-dependent [Ruminococcus albus 7]
 gi|315448669|gb|ADU22233.1| DNA ligase, NAD-dependent [Ruminococcus albus 7]
          Length = 659

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 30/63 (47%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           K  A   ++ LV+I  +H + YY  D    +D  YD +   L  L+   P+L  +D P  
Sbjct: 4   KESAKKRIDELVEILNYHSRLYYVEDRNEISDYEYDMLQNELKKLEAANPDLIRKDSPTQ 63

Query: 116 TVG 118
            VG
Sbjct: 64  RVG 66


>gi|294140434|ref|YP_003556412.1| DNA ligase, NAD-dependent [Shewanella violacea DSS12]
 gi|293326903|dbj|BAJ01634.1| DNA ligase, NAD-dependent [Shewanella violacea DSS12]
          Length = 683

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 30/73 (41%)

Query: 46  DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFP 105
           DK +   S +      E+  L  I   H   YY  D P   D  YDR+ ++L  L+   P
Sbjct: 4   DKIQDHASFNIQAVAQEIAELTDILNGHNYCYYVDDAPSIPDAEYDRLLKQLKVLETAHP 63

Query: 106 ELFDEDHPWNTVG 118
           E    D P   VG
Sbjct: 64  EYCFPDSPTQRVG 76


>gi|290967938|ref|ZP_06559488.1| DNA ligase (NAD(+)) [Megasphaera genomosp. type_1 str. 28L]
 gi|290782077|gb|EFD94655.1| DNA ligase (NAD(+)) [Megasphaera genomosp. type_1 str. 28L]
          Length = 668

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YD +   L+ L++++P+    D P   +G
Sbjct: 26  YYTLDAPTVSDYEYDMLYRELETLEKKYPQWVTPDSPTQRIG 67


>gi|121611375|ref|YP_999182.1| DNA ligase [Verminephrobacter eiseniae EF01-2]
 gi|166216275|sp|A1WRA7|DNLJ_VEREI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|121556015|gb|ABM60164.1| DNA ligase, NAD-dependent [Verminephrobacter eiseniae EF01-2]
          Length = 693

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 28/69 (40%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           LD       +   +A   +  L +  +H    Y+ LD P   D  YDR  + L AL+   
Sbjct: 5   LDHCPDPAQMDPAQADARIRALREQLVHWAHQYHVLDAPSVPDAEYDRAFQALQALEAAH 64

Query: 105 PELFDEDHP 113
           P L   D P
Sbjct: 65  PALITPDSP 73


>gi|229823252|ref|ZP_04449321.1| hypothetical protein GCWU000282_00550 [Catonella morbi ATCC 51271]
 gi|229787418|gb|EEP23532.1| hypothetical protein GCWU000282_00550 [Catonella morbi ATCC 51271]
          Length = 671

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EV++L+    +H   YY LD  L +D  YD +   L+ ++   PE    D P   VG
Sbjct: 14  EVKHLLNDYAYH---YYVLDQSLVSDASYDALYRELEEIEAAHPEWITPDSPTQRVG 67


>gi|218961271|ref|YP_001741046.1| DNA ligase, NAD-dependent [Candidatus Cloacamonas acidaminovorans]
 gi|167729928|emb|CAO80840.1| DNA ligase, NAD-dependent [Candidatus Cloacamonas acidaminovorans]
          Length = 667

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HH + YY L  P  +D  YD + + L  L+ Q+ E   E+ P   VG
Sbjct: 19  HHNRLYYTLAKPEISDYEYDMLVKELQELEAQYAEGAVEESPTQKVG 65


>gi|172060972|ref|YP_001808624.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MC40-6]
 gi|254781273|sp|B1YSH2|DNLJ_BURA4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|171993489|gb|ACB64408.1| DNA ligase, NAD-dependent [Burkholderia ambifaria MC40-6]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFGELQQLETDHPDLVTPDSPTQRVG 72


>gi|308176651|ref|YP_003916057.1| DNA ligase [Arthrobacter arilaitensis Re117]
 gi|307744114|emb|CBT75086.1| DNA ligase [Arthrobacter arilaitensis Re117]
          Length = 767

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + LV+    H+  YY+ D PL +D  YD +   L  L+  +P L  +D P   VG
Sbjct: 33  DQLVEQIRAHRDAYYQNDAPLVSDVEYDALFHELQLLEATYPILAGQDSPTQEVG 87


>gi|167837047|ref|ZP_02463930.1| DNA ligase, NAD-dependent [Burkholderia thailandensis MSMB43]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQQIEAEHPDLVTPDSPTQRVG 72


>gi|307720805|ref|YP_003891945.1| DNA ligase, NAD-dependent [Sulfurimonas autotrophica DSM 16294]
 gi|306978898|gb|ADN08933.1| DNA ligase, NAD-dependent [Sulfurimonas autotrophica DSM 16294]
          Length = 650

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P+ TD +YD++ + ++  +E  PE   ++ P   VG
Sbjct: 20  YYVLDDPIMTDEVYDKLYKEVEQYEEAHPEDILKNSPTQRVG 61


>gi|312878358|ref|ZP_07738269.1| DNA ligase (NAD(+)) [Caldicellulosiruptor lactoaceticus 6A]
 gi|311794859|gb|EFR11277.1| DNA ligase (NAD(+)) [Caldicellulosiruptor lactoaceticus 6A]
          Length = 259

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|302871618|ref|YP_003840254.1| DNA ligase, NAD-dependent [Caldicellulosiruptor obsidiansis OB47]
 gi|302574477|gb|ADL42268.1| DNA ligase, NAD-dependent [Caldicellulosiruptor obsidiansis OB47]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVLPDSPTQRVG 64


>gi|254514186|ref|ZP_05126247.1| DNA ligase, NAD-dependent [gamma proteobacterium NOR5-3]
 gi|219676429|gb|EED32794.1| DNA ligase, NAD-dependent [gamma proteobacterium NOR5-3]
          Length = 675

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 5/55 (9%)

Query: 69  IALHHQ--KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +AL  Q  +W   YY LD P   D  YD     L  L+ + PEL D   P   VG
Sbjct: 12  VALREQLERWNHQYYVLDEPTVPDQDYDAALRELQKLETEHPELQDPSSPTQRVG 66


>gi|6179416|emb|CAB59902.1| DNA ligase [Campylobacter jejuni]
          Length = 245

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 60  MIEVEYLVKIALHHQ--KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           M + EYL K+AL     + YY  D PL +D  YD +   L A +EQ  +   +D P   +
Sbjct: 1   MTKKEYLEKVALAASWMRAYYEKDEPLASDEEYDALIRELRAFEEQNKDEISKDSPTQKI 60

Query: 118 G 118
            
Sbjct: 61  A 61


>gi|170703080|ref|ZP_02893902.1| DNA ligase, NAD-dependent [Burkholderia ambifaria IOP40-10]
 gi|170132009|gb|EDT00515.1| DNA ligase, NAD-dependent [Burkholderia ambifaria IOP40-10]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  L+   P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFGELQQLETDHPDLVTPDSPTQRVG 72


>gi|291454298|ref|ZP_06593688.1| NAD-dependent DNA ligase LigA [Streptomyces albus J1074]
 gi|291357247|gb|EFE84149.1| NAD-dependent DNA ligase LigA [Streptomyces albus J1074]
          Length = 736

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++L +    H+  YY  D P+ +D  +DR    L  L+EQ+P L   D P   V 
Sbjct: 27  KHLAEQVEEHRFRYYVNDQPVVSDAEFDRQLRALTQLEEQYPPLRTPDSPTQKVA 81


>gi|222529603|ref|YP_002573485.1| DNA ligase, NAD-dependent [Caldicellulosiruptor bescii DSM 6725]
 gi|254781543|sp|B9MK54|DNLJ_ANATD RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|222456450|gb|ACM60712.1| DNA ligase, NAD-dependent [Caldicellulosiruptor bescii DSM 6725]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 9   IRELVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|219681449|ref|YP_002467834.1| DNA ligase (NAD+) [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|257471124|ref|ZP_05635123.1| DNA ligase (NAD+) [Buchnera aphidicola str. LSR1 (Acyrthosiphon
           pisum)]
 gi|254781271|sp|B8D8M5|DNLJ_BUCA5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219624292|gb|ACL30447.1| DNA ligase (NAD+) [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
          Length = 675

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L KI L ++ +Y+ L+  + +D  YD +  +L  L+ +  EL   D P   VG
Sbjct: 7   KIEKLRKILLKYEYFYHTLNQSIISDAEYDYLFRQLYELELKHKELIPSDSPTQKVG 63


>gi|329767007|ref|ZP_08258535.1| DNA ligase [Gemella haemolysans M341]
 gi|328837732|gb|EGF87357.1| DNA ligase [Gemella haemolysans M341]
          Length = 663

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  DNP  +D  YD + ++L+ L+E  PE   E+ P   VG
Sbjct: 22  YYVEDNPQISDTEYDTLYKQLEKLEENHPEYILENSPTQRVG 63


>gi|239982451|ref|ZP_04704975.1| NAD-dependent DNA ligase LigA [Streptomyces albus J1074]
          Length = 728

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++L +    H+  YY  D P+ +D  +DR    L  L+EQ+P L   D P   V 
Sbjct: 19  KHLAEQVEEHRFRYYVNDQPVVSDAEFDRQLRALTQLEEQYPPLRTPDSPTQKVA 73


>gi|91225892|ref|ZP_01260861.1| DNA ligase [Vibrio alginolyticus 12G01]
 gi|91189542|gb|EAS75818.1| DNA ligase [Vibrio alginolyticus 12G01]
          Length = 670

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 12  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITVDSPSQRVG 64


>gi|260889570|ref|ZP_05900833.1| DNA ligase, NAD-dependent [Leptotrichia hofstadii F0254]
 gi|260860981|gb|EEX75481.1| DNA ligase, NAD-dependent [Leptotrichia hofstadii F0254]
          Length = 702

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF-----DEDHPWNTVG 118
           +H   YY  D PL +D  YD +   L  L++++PEL       E  P   +G
Sbjct: 39  YHNNLYYNEDKPLISDMEYDALMRELKQLEQKYPELLKNEENGESSPTEKIG 90


>gi|153003607|ref|YP_001377932.1| DNA ligase, NAD-dependent [Anaeromyxobacter sp. Fw109-5]
 gi|166215389|sp|A7H8A2|DNLJ_ANADF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|152027180|gb|ABS24948.1| DNA ligase, NAD-dependent [Anaeromyxobacter sp. Fw109-5]
          Length = 699

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P+  D  YDR+   L  ++   PEL   D P   V
Sbjct: 28  YYVLDRPVLADAEYDRLVRELAEIEAAHPELATSDSPTQRV 68


>gi|312877316|ref|ZP_07737282.1| DNA ligase, NAD-dependent [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795879|gb|EFR12242.1| DNA ligase, NAD-dependent [Caldicellulosiruptor lactoaceticus 6A]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|312793814|ref|YP_004026737.1| DNA ligase, nad-dependent [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180954|gb|ADQ41124.1| DNA ligase, NAD-dependent [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|237753058|ref|ZP_04583538.1| NAD-dependent DNA ligase LigA [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375325|gb|EEO25416.1| NAD-dependent DNA ligase LigA [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 666

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 75  KWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           K YY LD+P+ +D  YD +  ++ A + Q P+   +D P   VG
Sbjct: 18  KHYYVLDDPIASDEEYDLLYHKVLAYEAQNPQFIAQDSPTQRVG 61


>gi|71082725|ref|YP_265444.1| DNA ligase [Candidatus Pelagibacter ubique HTCC1062]
 gi|123775550|sp|Q4FPL3|DNLJ_PELUB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71061838|gb|AAZ20841.1| DNA ligase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 676

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 61  IEVEYLVKIAL--HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E+EYL KI L   H K YY  + P+ +D  +D + + +  L+ ++  L  E  P  ++G
Sbjct: 6   LEIEYLKKIDLFQRHNKHYYDKNKPIVSDQEFDLLKKDIIDLERKYKFLKSEYSPTKSIG 65

Query: 119 Y 119
           +
Sbjct: 66  F 66


>gi|225849186|ref|YP_002729350.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium azorense Az-Fu1]
 gi|254781434|sp|C1DW63|DNLJ_SULAA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|225644062|gb|ACN99112.1| DNA ligase, NAD-dependent [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 701

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 35/67 (52%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           + S+ + +A   +E L ++   H   YY L  P+ +D  YD++ + L  ++ ++P+L   
Sbjct: 22  IKSIDRKKAESIIEDLREVIRFHDWRYYVLAQPVISDYEYDKLFKLLKDIESKYPDLITP 81

Query: 111 DHPWNTV 117
           D P   V
Sbjct: 82  DSPTQRV 88


>gi|89097084|ref|ZP_01169975.1| DNA ligase [Bacillus sp. NRRL B-14911]
 gi|89088464|gb|EAR67574.1| DNA ligase [Bacillus sp. NRRL B-14911]
          Length = 668

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+ + L  L+ + P+L   D P   VG
Sbjct: 24  YYVLDKPSVPDSEYDRLLKELMELENEHPQLKTADSPTQRVG 65


>gi|168483195|ref|ZP_02708147.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC1873-00]
 gi|168492012|ref|ZP_02716155.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC0288-04]
 gi|221231854|ref|YP_002511006.1| DNA ligase [Streptococcus pneumoniae ATCC 700669]
 gi|225854613|ref|YP_002736125.1| NAD-dependent DNA ligase LigA [Streptococcus pneumoniae JJA]
 gi|254781427|sp|B8ZPV9|DNLJ_STRPJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781431|sp|C1CEA4|DNLJ_STRZJ RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|172043461|gb|EDT51507.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC1873-00]
 gi|183573785|gb|EDT94313.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC0288-04]
 gi|220674314|emb|CAR68857.1| DNA ligase [Streptococcus pneumoniae ATCC 700669]
 gi|225722247|gb|ACO18100.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae JJA]
 gi|332201605|gb|EGJ15675.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae GA47368]
          Length = 652

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP   D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVADSEYDRLYRELVELETAYPEQVLADSPTHRVG 60


>gi|312622179|ref|YP_004023792.1| DNA ligase, nad-dependent [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202646|gb|ADQ45973.1| DNA ligase, NAD-dependent [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 12  LVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|255533202|ref|YP_003093574.1| DNA ligase, NAD-dependent [Pedobacter heparinus DSM 2366]
 gi|255346186|gb|ACU05512.1| DNA ligase, NAD-dependent [Pedobacter heparinus DSM 2366]
          Length = 670

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +S  E    ++ LVK    H   YY L  P   D  +D+  E L  L+  +PE  D + P
Sbjct: 1   MSGSEVKTNMDALVKELNQHSYNYYVLAMPTIADYTFDKKLEELAQLELAYPEFADPNSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TRKVG 65


>gi|124024594|ref|YP_001018901.1| NAD-dependent DNA ligase LigA [Prochlorococcus marinus str. MIT
           9303]
 gi|166216228|sp|A2CDS6|DNLJ_PROM3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|123964880|gb|ABM79636.1| NAD-dependent DNA ligase [Prochlorococcus marinus str. MIT 9303]
          Length = 696

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 52  TSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDED 111
           TS +  E   E+  L+  A H    YY LD P   D +YDR+   L  L+ +   L   D
Sbjct: 4   TSRTPPERAAELRQLLNQAAHS---YYVLDTPTMEDAVYDRLYRELLDLEVKDSSLLTPD 60

Query: 112 HPWNTVG 118
            P   +G
Sbjct: 61  SPTQRIG 67


>gi|307326508|ref|ZP_07605703.1| DNA ligase, NAD-dependent [Streptomyces violaceusniger Tu 4113]
 gi|306887916|gb|EFN18907.1| DNA ligase, NAD-dependent [Streptomyces violaceusniger Tu 4113]
          Length = 732

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+ +D  +D++   L+AL+E+ P L   D P   V 
Sbjct: 27  HRFRYYVKDAPVVSDAEFDKLMRELEALEEETPALRTPDSPTQKVA 72


>gi|88803633|ref|ZP_01119157.1| putative DNA ligase [Polaribacter irgensii 23-P]
 gi|88780366|gb|EAR11547.1| putative DNA ligase [Polaribacter irgensii 23-P]
          Length = 665

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY LDN + +D  +D   ++L+ L+++ P LFD + P   VG
Sbjct: 17  HNYNYYVLDNGMISDFDFDVKLKKLEQLEKENPLLFDANSPTQRVG 62


>gi|254440003|ref|ZP_05053497.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
 gi|198255449|gb|EDY79763.1| DNA ligase, NAD-dependent [Octadecabacter antarcticus 307]
          Length = 706

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 33/74 (44%)

Query: 45  LDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQF 104
           +     + +L+K EA  E+  L  +       Y++ D P   D  YD +  R   ++ +F
Sbjct: 1   MSATTSIENLTKDEAAQELARLSALLAQANAEYHQADAPRIPDADYDALKLRNAMIEARF 60

Query: 105 PELFDEDHPWNTVG 118
            +L   D P  TVG
Sbjct: 61  SDLKRRDSPSETVG 74


>gi|67458584|ref|YP_246208.1| NAD-dependent DNA ligase LigA [Rickettsia felis URRWXCal2]
 gi|67004117|gb|AAY61043.1| DNA ligase, NAD-dependent [Rickettsia felis URRWXCal2]
          Length = 706

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ P   +G
Sbjct: 39  KIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLVLENSPSKKIG 88


>gi|312127350|ref|YP_003992224.1| DNA ligase, nad-dependent [Caldicellulosiruptor hydrothermalis 108]
 gi|311777369|gb|ADQ06855.1| DNA ligase, NAD-dependent [Caldicellulosiruptor hydrothermalis 108]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  LV +  +H   YY  DNP  +D  YD +   L  L++Q+PE    D P   VG
Sbjct: 9   IRELVDLINYHDYKYYVEDNPEISDYEYDMLYRELVELEKQYPEYVFPDSPTQRVG 64


>gi|215918993|ref|NP_819574.2| NAD-dependent DNA ligase [Coxiella burnetii RSA 493]
 gi|218512010|sp|Q83DZ6|DNLJ_COXBU RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|206583878|gb|AAO90088.2| NAD-dependent DNA ligase [Coxiella burnetii RSA 493]
          Length = 673

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L+ L++++PE      P   VG
Sbjct: 24  HNYRYYVLSQPTIPDSVYDELFHELEKLEKKYPETITPSSPTQRVG 69


>gi|183603490|ref|ZP_02717204.2| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC3059-06]
 gi|183576581|gb|EDT97109.1| DNA ligase, NAD-dependent [Streptococcus pneumoniae CDC3059-06]
          Length = 648

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP   D  YDR+   L  L+  +PE    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVADSEYDRLYRELVELETAYPEQVLADSPTHRVG 56


>gi|269968476|ref|ZP_06182487.1| DNA ligase [Vibrio alginolyticus 40B]
 gi|269826910|gb|EEZ81233.1| DNA ligase [Vibrio alginolyticus 40B]
          Length = 690

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 32  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITVDSPSQRVG 84


>gi|189485424|ref|YP_001956365.1| DNA ligase (NAD+) [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|254781446|sp|B1H072|DNLJ_UNCTG RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|170287383|dbj|BAG13904.1| DNA ligase (NAD+) [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 674

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 57  GEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           G     ++YL K  + H   YY  +NP  +D  YD +++ L+ ++++ P     D P
Sbjct: 4   GNIQNRIDYLRKELIRHNGLYYESNNPEISDSEYDNLAKELEQIEKENPLFALPDSP 60


>gi|170727191|ref|YP_001761217.1| DNA ligase, NAD-dependent [Shewanella woodyi ATCC 51908]
 gi|254781418|sp|B1KJT5|DNLJ_SHEWM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|169812538|gb|ACA87122.1| DNA ligase, NAD-dependent [Shewanella woodyi ATCC 51908]
          Length = 670

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 28/60 (46%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A+ E++ L +    H   YY  D+P   D  YDR+  RL  L+ + P L     P   VG
Sbjct: 3   AIEEIKQLTETINEHNHSYYVEDSPSVPDAEYDRLINRLKQLEGENPHLCLPTSPTQRVG 62


>gi|134034096|sp|Q4UN15|DNLJ_RICFE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 689

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 68  KIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KIA ++  +Y   DNPL +D  YD++      L+++FP L  E+ P   +G
Sbjct: 22  KIAAYNHAYYIE-DNPLVSDSEYDQLFNTNLKLEQKFPHLVLENSPSKKIG 71


>gi|238026897|ref|YP_002911128.1| DNA ligase, NAD-dependent [Burkholderia glumae BGR1]
 gi|237876091|gb|ACR28424.1| DNA ligase, NAD-dependent [Burkholderia glumae BGR1]
          Length = 747

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+    D P   VG
Sbjct: 32  YYVLDQPELLDAEYDRLFRELQQIEAEHPDFITPDSPTQRVG 73


>gi|53719773|ref|YP_108759.1| DNA ligase [Burkholderia pseudomallei K96243]
 gi|167816389|ref|ZP_02448069.1| DNA ligase [Burkholderia pseudomallei 91]
 gi|81379503|sp|Q63T07|DNLJ_BURPS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|52210187|emb|CAH36166.1| DNA ligase [Burkholderia pseudomallei K96243]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQRIEAEHPDLVTPDSPTQRVG 72


>gi|161831535|ref|YP_001596473.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 331]
 gi|190359249|sp|A9NC33|DNLJ_COXBR RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|161763402|gb|ABX79044.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 331]
          Length = 670

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L+ L++++PE      P   VG
Sbjct: 21  HNYRYYVLSQPTIPDSVYDELFHELEKLEKKYPETITPSSPTQRVG 66


>gi|262394922|ref|YP_003286776.1| DNA ligase [Vibrio sp. Ex25]
 gi|262338516|gb|ACY52311.1| DNA ligase [Vibrio sp. Ex25]
          Length = 690

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 32  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITVDSPSQRVG 84


>gi|76810783|ref|YP_333980.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1710b]
 gi|167720173|ref|ZP_02403409.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei DM98]
 gi|167911510|ref|ZP_02498601.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 112]
 gi|254189298|ref|ZP_04895809.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei Pasteur 52237]
 gi|254259109|ref|ZP_04950163.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1710a]
 gi|254297202|ref|ZP_04964655.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 406e]
 gi|123771899|sp|Q3JR23|DNLJ_BURP1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|76580236|gb|ABA49711.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1710b]
 gi|157807762|gb|EDO84932.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 406e]
 gi|157936977|gb|EDO92647.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei Pasteur 52237]
 gi|254217798|gb|EET07182.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1710a]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQRIEAEHPDLVTPDSPTQRVG 72


>gi|126453906|ref|YP_001066758.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1106a]
 gi|134277579|ref|ZP_01764294.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 305]
 gi|167739178|ref|ZP_02411952.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 14]
 gi|167824768|ref|ZP_02456239.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 9]
 gi|167846299|ref|ZP_02471807.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei B7210]
 gi|167894881|ref|ZP_02482283.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 7894]
 gi|167903270|ref|ZP_02490475.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei NCTC 13177]
 gi|167919520|ref|ZP_02506611.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei BCC215]
 gi|217421846|ref|ZP_03453350.1| DNA ligase (NAD(+)) [Burkholderia pseudomallei 576]
 gi|226198948|ref|ZP_03794511.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei Pakistan 9]
 gi|237812814|ref|YP_002897265.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei MSHR346]
 gi|242317106|ref|ZP_04816122.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1106b]
 gi|254179316|ref|ZP_04885915.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1655]
 gi|254198094|ref|ZP_04904516.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei S13]
 gi|166215566|sp|A3NWN7|DNLJ_BURP0 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126227548|gb|ABN91088.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1106a]
 gi|134251229|gb|EBA51308.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 305]
 gi|169654835|gb|EDS87528.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei S13]
 gi|184209856|gb|EDU06899.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1655]
 gi|217395588|gb|EEC35606.1| DNA ligase (NAD(+)) [Burkholderia pseudomallei 576]
 gi|225929048|gb|EEH25072.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei Pakistan 9]
 gi|237506455|gb|ACQ98773.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei MSHR346]
 gi|242140345|gb|EES26747.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 1106b]
          Length = 691

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQRIEAEHPDLVTPDSPTQRVG 72


>gi|259047691|ref|ZP_05738092.1| DNA ligase, NAD-dependent [Granulicatella adiacens ATCC 49175]
 gi|259035882|gb|EEW37137.1| DNA ligase, NAD-dependent [Granulicatella adiacens ATCC 49175]
          Length = 668

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P  TD  YD+    L AL+++ PE    D P   VG
Sbjct: 25  YYVEDKPTATDAEYDKAYHELLALEKEHPEFVTADSPTQRVG 66


>gi|126441747|ref|YP_001059474.1| DNA ligase, NAD-dependent [Burkholderia pseudomallei 668]
 gi|166215567|sp|A3NAV3|DNLJ_BURP6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|126221240|gb|ABN84746.1| DNA ligase (NAD(+)) [Burkholderia pseudomallei 668]
          Length = 691

 Score = 35.4 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQRIEAEHPDLVTPDSPTQRVG 72


>gi|53723744|ref|YP_103200.1| DNA ligase, NAD-dependent [Burkholderia mallei ATCC 23344]
 gi|67639492|ref|ZP_00438344.1| DNA ligase, NAD-dependent [Burkholderia mallei GB8 horse 4]
 gi|121600643|ref|YP_993378.1| DNA ligase, NAD-dependent [Burkholderia mallei SAVP1]
 gi|124385135|ref|YP_001029185.1| DNA ligase, NAD-dependent [Burkholderia mallei NCTC 10229]
 gi|126450807|ref|YP_001080885.1| DNA ligase, NAD-dependent [Burkholderia mallei NCTC 10247]
 gi|167004074|ref|ZP_02269848.1| DNA ligase, NAD-dependent [Burkholderia mallei PRL-20]
 gi|254178005|ref|ZP_04884660.1| DNA ligase, NAD-dependent [Burkholderia mallei ATCC 10399]
 gi|254206491|ref|ZP_04912843.1| DNA ligase, NAD-dependent [Burkholderia mallei JHU]
 gi|254358100|ref|ZP_04974373.1| DNA ligase, NAD-dependent [Burkholderia mallei 2002721280]
 gi|81604820|sp|Q62JB9|DNLJ_BURMA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215563|sp|A3MKU9|DNLJ_BURM7 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215564|sp|A2SB66|DNLJ_BURM9 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|166215565|sp|A1V575|DNLJ_BURMS RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|52427167|gb|AAU47760.1| DNA ligase, NAD-dependent [Burkholderia mallei ATCC 23344]
 gi|121229453|gb|ABM51971.1| DNA ligase, NAD-dependent [Burkholderia mallei SAVP1]
 gi|124293155|gb|ABN02424.1| DNA ligase (NAD(+)) [Burkholderia mallei NCTC 10229]
 gi|126243677|gb|ABO06770.1| DNA ligase (NAD(+)) [Burkholderia mallei NCTC 10247]
 gi|147753934|gb|EDK60999.1| DNA ligase, NAD-dependent [Burkholderia mallei JHU]
 gi|148027227|gb|EDK85248.1| DNA ligase, NAD-dependent [Burkholderia mallei 2002721280]
 gi|160699044|gb|EDP89014.1| DNA ligase, NAD-dependent [Burkholderia mallei ATCC 10399]
 gi|238520039|gb|EEP83503.1| DNA ligase, NAD-dependent [Burkholderia mallei GB8 horse 4]
 gi|243060513|gb|EES42699.1| DNA ligase, NAD-dependent [Burkholderia mallei PRL-20]
          Length = 691

 Score = 35.4 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 31  YYVLDQPDLPDAEYDRLFVELQRIEAEHPDLVTPDSPTQRVG 72


>gi|322385709|ref|ZP_08059353.1| NAD-dependent DNA ligase LigA [Streptococcus cristatus ATCC 51100]
 gi|321270447|gb|EFX53363.1| NAD-dependent DNA ligase LigA [Streptococcus cristatus ATCC 51100]
          Length = 652

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LVK+   +   YY  D P  +D  YDR+   L  L+E++P     D P + VG
Sbjct: 8   LVKLLNRYAHEYYTADRPSVSDSEYDRLYRELVELEEKYPTDILPDSPTHRVG 60


>gi|240142614|ref|YP_002967127.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
 gi|240012561|gb|ACS43786.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
          Length = 712

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 30/72 (41%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           +A  V  LS  +A IE   L      H + Y+  D P+ TD  YD +  R   ++   P 
Sbjct: 8   RAVPVAELSNEDARIEHAALASEIAEHDERYHGQDAPIVTDAEYDALRRRAAEIEAAHPA 67

Query: 107 LFDEDHPWNTVG 118
           L  E      VG
Sbjct: 68  LAAESEVAKKVG 79


>gi|209522379|ref|ZP_03270993.1| DNA ligase, NAD-dependent [Burkholderia sp. H160]
 gi|209497185|gb|EDZ97426.1| DNA ligase, NAD-dependent [Burkholderia sp. H160]
          Length = 688

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D  YD++ + L+ ++ + P+L   D P   VG
Sbjct: 32  YYVLDQPDLPDAEYDKLFKELERIEAEHPDLIVPDSPTQRVG 73


>gi|255009394|ref|ZP_05281520.1| putative DNA ligase [Bacteroides fragilis 3_1_12]
 gi|313147153|ref|ZP_07809346.1| DNA ligase [Bacteroides fragilis 3_1_12]
 gi|313135920|gb|EFR53280.1| DNA ligase [Bacteroides fragilis 3_1_12]
          Length = 665

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 67  VKIALHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++I LH   + YY L+ P  +D  +D +   L  L+++ PE  DE+ P   VG
Sbjct: 10  LRIQLHQHNYNYYVLNAPEISDKEFDDLMRELQTLEQEHPEYKDENSPTMRVG 62


>gi|251788438|ref|YP_003003159.1| NAD-dependent DNA ligase LigA [Dickeya zeae Ech1591]
 gi|247537059|gb|ACT05680.1| DNA ligase, NAD-dependent [Dickeya zeae Ech1591]
          Length = 682

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 38  KRALESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERL 97
           KRA +  +D A++         + E+  L++   HH   Y+  D+P   D  YD +   L
Sbjct: 4   KRANQQNVDTARR--------RIKELRILIR---HHDIKYHSEDDPEILDSEYDLLKREL 52

Query: 98  DALQEQFPELFDEDHPWNTVG 118
             L+ Q P L   D P   VG
Sbjct: 53  SELEIQHPFLVTSDSPTQRVG 73


>gi|254796855|ref|YP_003081692.1| DNA ligase, NAD-dependent [Neorickettsia risticii str. Illinois]
 gi|254590064|gb|ACT69426.1| DNA ligase, NAD-dependent [Neorickettsia risticii str. Illinois]
          Length = 670

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           +A  E++ L +  L H K YY+ D+P  TD  YD +  R   L E  P L
Sbjct: 2   KAKKEIQELYEKLLRHNKKYYQDDSPEITDAEYDSIKGRYLKLLEANPSL 51


>gi|227485017|ref|ZP_03915333.1| DNA ligase (NAD(+)) [Anaerococcus lactolyticus ATCC 51172]
 gi|227237014|gb|EEI87029.1| DNA ligase (NAD(+)) [Anaerococcus lactolyticus ATCC 51172]
          Length = 667

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL +DG YD++  +L  LQ+       E+ P N VG
Sbjct: 21  YYTLDKPLVSDGEYDKLYNQLIKLQKNLA-YVPENSPTNRVG 61


>gi|116493340|ref|YP_805075.1| NAD-dependent DNA ligase [Pediococcus pentosaceus ATCC 25745]
 gi|122265196|sp|Q03DT9|DNLJ_PEDPA RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116103490|gb|ABJ68633.1| NAD-dependent DNA ligase [Pediococcus pentosaceus ATCC 25745]
          Length = 675

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 31/70 (44%)

Query: 49  KKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELF 108
           KK+  +   EA    + L +I     K YY  D P   D  YD     L AL+E FPE+ 
Sbjct: 5   KKLEEMQVEEASKLAQNLREILDRWSKLYYTKDAPEVEDYEYDEKYADLVALEEAFPEII 64

Query: 109 DEDHPWNTVG 118
            +D     VG
Sbjct: 65  TQDSITQRVG 74


>gi|327475237|gb|AEA77213.1| DNA ligase [Bacillus aquimaris]
          Length = 668

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+ LD P   D  YD++   L  L++QFP+L   D P   VG
Sbjct: 24  YHVLDKPSVPDSEYDQLLRELIELEDQFPDLKTSDSPSERVG 65


>gi|325002847|ref|ZP_08123959.1| NAD-dependent DNA ligase LigA [Pseudonocardia sp. P1]
          Length = 615

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY LD P+ +DG +D +   L  L++  P L     P   VG
Sbjct: 23  HQFRYYVLDAPVVSDGQFDELWHELLGLEDAHPGLATPQSPTQKVG 68


>gi|289649545|ref|ZP_06480888.1| NAD-dependent DNA ligase LigA [Pseudomonas syringae pv. aesculi
           str. 2250]
          Length = 787

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   Y+ LD P   D  YDR+   L AL+ + P L   D P   VG
Sbjct: 18  HNYRYHVLDEPSIPDVEYDRLFHELKALEVENPHLVTPDSPTQRVG 63


>gi|91762853|ref|ZP_01264818.1| DNA ligase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718655|gb|EAS85305.1| DNA ligase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 676

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 61  IEVEYLVKIAL--HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +E+EYL KI L   H K YY  + P+ +D  +D + + +  L+ ++  L  E  P  ++G
Sbjct: 6   LEIEYLKKIDLFQTHNKHYYDKNKPIVSDQEFDLLKKDIIDLESKYKFLKSEYSPTKSIG 65

Query: 119 Y 119
           +
Sbjct: 66  F 66


>gi|329116783|ref|ZP_08245500.1| DNA ligase (NAD+) [Streptococcus parauberis NCFD 2020]
 gi|326907188|gb|EGE54102.1| DNA ligase (NAD+) [Streptococcus parauberis NCFD 2020]
          Length = 654

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P  +D  YDR+   L  L+E++PE   +D P   VG
Sbjct: 19  YYTNDSPSVSDQDYDRLYHELVQLEEEYPEYALKDSPTQAVG 60


>gi|315161924|gb|EFU05941.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0645]
          Length = 676

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|222086432|ref|YP_002544966.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
 gi|254781247|sp|B9JH39|DNLJ_AGRRK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221723880|gb|ACM27036.1| DNA ligase, NAD-dependent [Agrobacterium radiobacter K84]
          Length = 717

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  R DA++ +FP L   D P   VG
Sbjct: 34  YHGNDAPEISDAEYDALKRRNDAIEARFPALVRADSPSRRVG 75


>gi|307289585|ref|ZP_07569529.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0109]
 gi|306499399|gb|EFM68772.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX0109]
 gi|315164584|gb|EFU08601.1| DNA ligase, NAD-dependent [Enterococcus faecalis TX1302]
          Length = 676

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|241764431|ref|ZP_04762455.1| DNA ligase, NAD-dependent [Acidovorax delafieldii 2AN]
 gi|241366173|gb|EER60750.1| DNA ligase, NAD-dependent [Acidovorax delafieldii 2AN]
          Length = 697

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           HQ  YY +D P   D  YD V   L AL+   P+L   D P   V
Sbjct: 28  HQ--YYVMDEPTVPDAEYDSVFRELQALETAHPDLITPDSPTQRV 70


>gi|330995784|ref|ZP_08319681.1| DNA ligase [Paraprevotella xylaniphila YIT 11841]
 gi|329574514|gb|EGG56079.1| DNA ligase [Paraprevotella xylaniphila YIT 11841]
          Length = 669

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 27/61 (44%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   ++E L      H   YY L+ P  +D  +DR+   L  L+   PE  D D P   V
Sbjct: 4   EVKEQIERLRSELHRHNYNYYVLNAPEISDQEFDRMMRELQDLEAAHPEFDDPDSPTRRV 63

Query: 118 G 118
           G
Sbjct: 64  G 64


>gi|153956079|ref|YP_001396844.1| LigA1 [Clostridium kluyveri DSM 555]
 gi|219856414|ref|YP_002473536.1| hypothetical protein CKR_3071 [Clostridium kluyveri NBRC 12016]
 gi|190359246|sp|A5N2X7|DNLJ_CLOK5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|254781297|sp|B9DWM9|DNLJ_CLOK1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|146348937|gb|EDK35473.1| LigA1 [Clostridium kluyveri DSM 555]
 gi|219570138|dbj|BAH08122.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 663

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++ L KI  +H   YY  D+P  TD  YD++   L  L+   PE   +  P   VG
Sbjct: 7   IDELRKIIEYHNDKYYNQDDPEITDYEYDKLYVELRNLENSHPEYKIQSSPTQKVG 62


>gi|322411466|gb|EFY02374.1| NAD-dependent DNA ligase LigA [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 652

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            +++ YY  D+P  +D  YD++   L  L+ Q+PE   +D P   VG
Sbjct: 14  RYRQEYYTNDSPSVSDSEYDKLYRELVELENQYPEHVLQDSPTQNVG 60


>gi|322387936|ref|ZP_08061543.1| NAD-dependent DNA ligase LigA [Streptococcus infantis ATCC 700779]
 gi|321141209|gb|EFX36707.1| NAD-dependent DNA ligase LigA [Streptococcus infantis ATCC 700779]
          Length = 652

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV++   +   YY  DNP  +D  YDR+   L  L+  +PE    D P + VG
Sbjct: 8   LVELLNRYATEYYTSDNPSVSDSEYDRLYRELVELEIAYPEQVLPDSPTHRVG 60


>gi|189219712|ref|YP_001940353.1| NAD-dependent DNA ligase [Methylacidiphilum infernorum V4]
 gi|254781365|sp|B3DWU2|DNLJ_METI4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189186570|gb|ACD83755.1| NAD-dependent DNA ligase [Methylacidiphilum infernorum V4]
          Length = 689

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 47  KAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPE 106
           KA  + SL   E     + LVK+   +   YY   +PL +D  YD +   L+ L++  PE
Sbjct: 18  KAPSLDSLGYEEIKKRHDELVKLIRKYDYAYYVEAHPLVSDQEYDNLYHELETLEKLHPE 77

Query: 107 LFDEDHPWNTVG 118
           L   D P   +G
Sbjct: 78  LITPDSPTQRIG 89


>gi|312898543|ref|ZP_07757933.1| DNA ligase, NAD-dependent [Megasphaera micronuciformis F0359]
 gi|310620462|gb|EFQ04032.1| DNA ligase, NAD-dependent [Megasphaera micronuciformis F0359]
          Length = 672

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 21/43 (48%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           YY LD P  TD  YD +   L+ ++   PE    D P   VG+
Sbjct: 24  YYTLDKPTITDYDYDMLYRELETIEGAHPEWVTADSPTQRVGH 66


>gi|255660255|ref|ZP_05405664.1| DNA ligase, NAD-dependent [Mycoplasma genitalium G37]
          Length = 658

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +  ++++ LV +  ++   YY L  PL  D  YD + + L  L++  P+L   D P   V
Sbjct: 2   DVKLKIQQLVNLIKNYDYHYYVLSEPLIDDFEYDMLYKSLQQLEKDHPDLIQIDSPTQRV 61

Query: 118 G 118
           G
Sbjct: 62  G 62


>gi|91204173|emb|CAJ71826.1| strongly similar to DNA ligase [Candidatus Kuenenia
           stuttgartiensis]
          Length = 674

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 27/57 (47%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L  I  +H   YY  +NP  +D  YD++   L  L+   PEL   D P   V 
Sbjct: 8   KIEQLRCIIRYHDYKYYVENNPEISDYEYDQLLRELQNLESAHPELITPDSPTQRVA 64


>gi|167041226|gb|ABZ05983.1| putative NAD-dependent DNA ligase adenylation domain protein
           [uncultured marine microorganism HF4000_001N02]
          Length = 727

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 25/54 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           + +G     +E L ++  HH   YY    P+ TD  YD + + L  L    P+L
Sbjct: 6   IEEGAQSARIEELAQLLAHHSDLYYNEAAPVITDAEYDLLFDELKRLDPTHPQL 59


>gi|12045108|ref|NP_072919.1| DNA ligase, NAD-dependent [Mycoplasma genitalium G37]
 gi|1352291|sp|P47496|DNLJ_MYCGE RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|3844852|gb|AAC71474.1| DNA ligase, NAD-dependent [Mycoplasma genitalium G37]
 gi|166078824|gb|ABY79442.1| DNA ligase, NAD-dependent [synthetic Mycoplasma genitalium
           JCVI-1.0]
          Length = 659

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           +  ++++ LV +  ++   YY L  PL  D  YD + + L  L++  P+L   D P   V
Sbjct: 3   DVKLKIQQLVNLIKNYDYHYYVLSEPLIDDFEYDMLYKSLQQLEKDHPDLIQIDSPTQRV 62

Query: 118 G 118
           G
Sbjct: 63  G 63


>gi|319956399|ref|YP_004167662.1| DNA ligase, nad-dependent [Nitratifractor salsuginis DSM 16511]
 gi|319418803|gb|ADV45913.1| DNA ligase, NAD-dependent [Nitratifractor salsuginis DSM 16511]
          Length = 657

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  DNP  TD +YDR+   ++A ++  P+  D   P   VG
Sbjct: 22  YYVEDNPEVTDEVYDRLYREVEAYEKAHPDEIDPTSPTQRVG 63


>gi|188584367|ref|YP_001927812.1| DNA ligase, NAD-dependent [Methylobacterium populi BJ001]
 gi|254781367|sp|B1Z9P1|DNLJ_METPB RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|179347865|gb|ACB83277.1| DNA ligase, NAD-dependent [Methylobacterium populi BJ001]
          Length = 814

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 27/57 (47%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V SLS+  A      L +        YY  D P  TD  YD + + L+A++ +FP L
Sbjct: 10  VESLSEDAAQARHAELSRAIERANHLYYNEDAPELTDAEYDALRQELEAIEARFPAL 66


>gi|83312957|ref|YP_423221.1| NAD-dependent DNA ligase [Magnetospirillum magneticum AMB-1]
 gi|123726860|sp|Q2W0G3|DNLJ_MAGMM RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|82947798|dbj|BAE52662.1| NAD-dependent DNA ligase [Magnetospirillum magneticum AMB-1]
          Length = 698

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V +L+  EA IE   LV+      + Y+  D P   D +YD    RL  ++ +FPEL
Sbjct: 4   VEALTPFEARIEHAELVETIARWDEAYHAKDAPEVPDDVYDGAKRRLARIEGRFPEL 60


>gi|332686164|ref|YP_004455938.1| DNA ligase [Melissococcus plutonius ATCC 35311]
 gi|332370173|dbj|BAK21129.1| DNA ligase [Melissococcus plutonius ATCC 35311]
          Length = 678

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++  +P+L   D P   VG
Sbjct: 30  YYVQDKPSVEDYVYDRLYKELSEIETAYPDLITSDSPTQRVG 71


>gi|205355436|ref|ZP_03222207.1| DNA ligase [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346670|gb|EDZ33302.1| DNA ligase [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 647

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 64  EYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL K+AL +   + YY  D PL +D  YD +   L A +EQ  +   +D P   + 
Sbjct: 5   EYLEKVALANLWMRAYYEKDEPLASDEEYDALIRELRAFEEQNKDEISKDSPTQKIA 61


>gi|254229733|ref|ZP_04923142.1| DNA ligase [Vibrio sp. Ex25]
 gi|151937778|gb|EDN56627.1| DNA ligase [Vibrio sp. Ex25]
          Length = 287

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 67  VKIALH-HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +K +LH H   YY  DNP   D  YDR+   L  ++ + P+L   D P   VG
Sbjct: 32  LKESLHYHAVRYYVEDNPEIPDAEYDRLMRELLDIEAENPDLITVDSPSQRVG 84


>gi|268319976|ref|YP_003293632.1| DNA ligase, NAD-dependent [Lactobacillus johnsonii FI9785]
 gi|262398351|emb|CAX67365.1| DNA ligase, NAD-dependent [Lactobacillus johnsonii FI9785]
          Length = 668

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D P+  D +YD+  + L  L+++FP+L   D     VG
Sbjct: 22  KWADDYYAKDAPVVEDAVYDKTYQELVELEQKFPDLVTADSITQRVG 68


>gi|193213809|ref|YP_001995008.1| NAD-dependentDNA ligase [Chloroherpeton thalassium ATCC 35110]
 gi|254781288|sp|B3QSH0|DNLJ_CHLT3 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|193087286|gb|ACF12561.1| DNA ligase, NAD-dependent [Chloroherpeton thalassium ATCC 35110]
          Length = 684

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           ++K EA  ++  L +    H   YY L  P  +D  +D +   L  L+ ++P+L   D P
Sbjct: 1   MNKSEAEAKIRALRREINEHNYNYYNLAKPKISDYDFDALLRTLAELEAKYPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|157414868|ref|YP_001482124.1| NAD-dependent DNA ligase LigA [Campylobacter jejuni subsp. jejuni
           81116]
 gi|190359240|sp|A8FL10|DNLJ_CAMJ8 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|157385832|gb|ABV52147.1| DNA ligase [Campylobacter jejuni subsp. jejuni 81116]
 gi|315931784|gb|EFV10739.1| DNA ligase, NAD-dependent [Campylobacter jejuni subsp. jejuni 327]
          Length = 647

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 64  EYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL K+AL +   + YY  D PL +D  YD +   L A +EQ  +   +D P   + 
Sbjct: 5   EYLEKVALANLWMRAYYEKDEPLASDEEYDALIRELRAFEEQNKDEISKDSPTQKIA 61


>gi|144899097|emb|CAM75961.1| NAD-dependent DNA ligase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 693

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 30/58 (51%)

Query: 50  KVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           ++ +L+  EA IE   L +  +     Y++ D P   D  YD    RL A++ +FPEL
Sbjct: 4   EIDALTPFEARIEASALREKLIRWDLAYHQADAPEVDDATYDAAKLRLLAIEARFPEL 61


>gi|163784741|ref|ZP_02179548.1| DNA ligase (NAD dependent) [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879989|gb|EDP73686.1| DNA ligase (NAD dependent) [Hydrogenivirga sp. 128-5-R1-1]
          Length = 414

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           L ++  +H   YY L NP+ +D  YD++   L ++++++PEL   D P   V
Sbjct: 38  LREVIKYHDWKYYVLANPVISDYEYDKLFHLLVSIEKKYPELITADSPTQRV 89


>gi|325479535|gb|EGC82631.1| DNA ligase (NAD+) [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 669

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD PL +DG YD + +RL  L+++     +E+ P   VG
Sbjct: 21  YYTLDEPLVSDGEYDEIYDRLVKLEDK-SGYINENSPTQKVG 61


>gi|302336117|ref|YP_003801324.1| DNA ligase, NAD-dependent [Olsenella uli DSM 7084]
 gi|301319957|gb|ADK68444.1| DNA ligase, NAD-dependent [Olsenella uli DSM 7084]
          Length = 747

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD+P  TD  +DR+   L AL+   PEL   +     +G
Sbjct: 62  YYALDDPEMTDAEFDRLLVELQALESAHPELVSPESYTQRIG 103


>gi|227889453|ref|ZP_04007258.1| NAD-dependent DNA ligase [Lactobacillus johnsonii ATCC 33200]
 gi|227849931|gb|EEJ60017.1| NAD-dependent DNA ligase [Lactobacillus johnsonii ATCC 33200]
          Length = 668

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 75  KW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           KW   YY  D P+  D +YD+  + L  L+++FP+L   D     VG
Sbjct: 22  KWADDYYAKDAPVVEDAVYDKTYQELVELEQKFPDLVTADSITQRVG 68


>gi|307747505|gb|ADN90775.1| DNA ligase [Campylobacter jejuni subsp. jejuni M1]
          Length = 647

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 64  EYLVKIALHH--QKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           EYL K+AL +   + YY  D PL +D  YD +   L A +EQ  +   +D P   + 
Sbjct: 5   EYLEKVALANLWMRAYYEKDEPLASDEEYDALIRELRAFEEQNKDEISKDSPTQKIA 61


>gi|171914081|ref|ZP_02929551.1| DNA ligase, NAD-dependent [Verrucomicrobium spinosum DSM 4136]
          Length = 669

 Score = 35.0 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 59  AMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           A + V +L +   HH + YY+   P  +D  +D +   L  L++  P L   D P   VG
Sbjct: 10  ASLRVAHLREEIEHHNRLYYQNAAPEISDQAFDALLRELQDLEKAHPSLITPDSPTQRVG 69


>gi|320450863|ref|YP_004202959.1| DNA ligase, NAD-dependent [Thermus scotoductus SA-01]
 gi|320151032|gb|ADW22410.1| DNA ligase, NAD-dependent [Thermus scotoductus SA-01]
          Length = 674

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 31/61 (50%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           EA   +  L  +  +H   YY LD P  +D  YDR+   L  L+E+FPEL   D P   V
Sbjct: 5   EARKRINELRDLIRYHNYRYYVLDAPEISDAEYDRLLRELKELEERFPELKSPDSPTEQV 64

Query: 118 G 118
           G
Sbjct: 65  G 65


>gi|254283004|ref|ZP_04957972.1| DNA ligase, NAD-dependent [gamma proteobacterium NOR51-B]
 gi|219679207|gb|EED35556.1| DNA ligase, NAD-dependent [gamma proteobacterium NOR51-B]
          Length = 675

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 74  QKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++W   YY+ D P   D  YD    RL  L+   PEL   D P   VG
Sbjct: 17  KRWALEYYQQDAPSVPDADYDAAFRRLHELESAHPELASPDSPTRRVG 64


>gi|222055066|ref|YP_002537428.1| DNA ligase, NAD-dependent [Geobacter sp. FRC-32]
 gi|254781339|sp|B9M861|DNLJ_GEOSF RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|221564355|gb|ACM20327.1| DNA ligase, NAD-dependent [Geobacter sp. FRC-32]
          Length = 669

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  A + ++ L +    H   YY  D P  TD  YD +   L  L+++FP+L   D P
Sbjct: 1   MDRTAAQLRIQELHREINRHNYLYYVEDRPEITDAEYDLLLRELQQLEKEFPDLVTADSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TQRVG 65


>gi|332880187|ref|ZP_08447868.1| DNA ligase [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332681836|gb|EGJ54752.1| DNA ligase [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 670

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 27/61 (44%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           E   ++E L      H   YY L+ P  +D  +DR+   L  L+   PE  D D P   V
Sbjct: 4   EVKEQIERLRNELHRHNYNYYVLNAPEISDQEFDRMMRELQDLEAAHPEFDDPDSPTRRV 63

Query: 118 G 118
           G
Sbjct: 64  G 64


>gi|219682005|ref|YP_002468389.1| DNA ligase (NAD+) [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|254781272|sp|B8D6X9|DNLJ_BUCAT RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|219621738|gb|ACL29894.1| DNA ligase (NAD+) [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|311085811|gb|ADP65893.1| DNA ligase (NAD+) [Buchnera aphidicola str. LL01 (Acyrthosiphon
           pisum)]
 gi|311086384|gb|ADP66465.1| DNA ligase (NAD+) [Buchnera aphidicola str. TLW03 (Acyrthosiphon
           pisum)]
          Length = 676

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L KI L ++ +Y+ L+  + +D  YD +  +L  L+ +  EL   D P   VG
Sbjct: 7   KIEKLRKILLKYEYFYHTLNQSIISDAEYDYLFRQLYELELKNKELIPSDSPTQKVG 63


>gi|120434999|ref|YP_860685.1| DNA ligase [Gramella forsetii KT0803]
 gi|166215777|sp|A0LZ23|DNLJ_GRAFK RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|117577149|emb|CAL65618.1| DNA ligase [Gramella forsetii KT0803]
          Length = 664

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 72  HHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            H   YY LD P  +D  +D   + L  L+E++PE  D++ P   VG
Sbjct: 16  QHNYNYYVLDKPQISDYEFDIKLKELQELEEKYPEFEDDNSPTRRVG 62


>gi|15616692|ref|NP_239904.1| DNA ligase (NAD+) [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|11132251|sp|P57172|DNLJ_BUCAI RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|25294009|pir||F84937 DNA ligase (NAD) (EC 6.5.1.2) [imported] - Buchnera sp.  (strain
           APS)
 gi|10038755|dbj|BAB12790.1| DNA ligase (NAD+) [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
          Length = 675

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L KI L ++ +Y+ L+  + +D  YD +  +L  L+ +  EL   D P   VG
Sbjct: 7   KIEKLRKILLKYEYFYHTLNQSIISDAEYDYLFRQLYELELKNKELIPSDSPTQKVG 63


>gi|269794376|ref|YP_003313831.1| DNA ligase, NAD-dependent [Sanguibacter keddieii DSM 10542]
 gi|269096561|gb|ACZ20997.1| DNA ligase, NAD-dependent [Sanguibacter keddieii DSM 10542]
          Length = 871

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           HQ  YY  D P  +D  YD +   L  ++E  P+L   D P   VG
Sbjct: 58  HQFAYYVRDAPTVSDAEYDTLLRELGDIEEAHPQLRTPDSPTQRVG 103


>gi|123774771|sp|Q47SC6|DNLJ_THEFY RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|71914739|gb|AAZ54641.1| NAD-dependent DNA ligase [Thermobifida fusca YX]
          Length = 745

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + Y L +P+ +D  YD++   L  L+ Q+P L   D P   VG
Sbjct: 46  YRYYLGSPIISDAEYDQLMAELRDLEAQYPSLVTPDSPTQKVG 88


>gi|254564006|ref|YP_003071101.1| DNA ligase [Methylobacterium extorquens DM4]
 gi|254271284|emb|CAX27296.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens DM4]
          Length = 814

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V +LS+  A      L +      + YY  D P  TD  YD + + L+A++ +FP L
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPAL 66


>gi|94676849|ref|YP_588544.1| DNA ligase, NAD-dependent [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123260587|sp|Q1LU20|DNLJ_BAUCH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|94219999|gb|ABF14158.1| DNA ligase, NAD-dependent [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 671

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 64  EYLVKIALHHQKW---YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           +Y+ ++    + W   YY  D P  +D  YD +  +L  L+ Q+P+L   D P   +GY
Sbjct: 6   QYIEQLRQQLRYWNFLYYAKDAPEVSDVEYDWLMMKLRELERQWPDLKTADSPTQHIGY 64


>gi|320008426|gb|ADW03276.1| DNA ligase, NAD-dependent [Streptomyces flavogriseus ATCC 33331]
          Length = 731

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H+  YY  D P+  D  +DR    L+A++ + PEL   D P   V 
Sbjct: 31  HRFRYYVKDQPVVDDAEFDRQMRALEAIEHEHPELRTPDSPTQKVA 76


>gi|332884007|gb|EGK04287.1| DNA ligase [Dysgonomonas mossii DSM 22836]
          Length = 665

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P  +D  +D+  + L  L+ Q+PE FD + P   VG
Sbjct: 18  HNYDYYVLSAPTISDFEFDKKLKELTDLETQYPEYFDPNSPSQRVG 63


>gi|270292770|ref|ZP_06198981.1| DNA ligase, NAD-dependent [Streptococcus sp. M143]
 gi|270278749|gb|EFA24595.1| DNA ligase, NAD-dependent [Streptococcus sp. M143]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 8   LVALLNRYASEYYTSDNPSVSDSEYDRLYRELVELEAAYPDQVLADSPTHRVG 60


>gi|271501855|ref|YP_003334881.1| DNA ligase [Dickeya dadantii Ech586]
 gi|270345410|gb|ACZ78175.1| DNA ligase, NAD-dependent [Dickeya dadantii Ech586]
          Length = 683

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +VE L     +H+  Y+  D P   D  YD +   L  L++  PEL   D P   VG
Sbjct: 18  QVEALRAQLRYHEYKYHVEDAPEIPDAEYDTLMNTLKVLEQAHPELVTPDSPTQRVG 74


>gi|325278944|ref|YP_004251486.1| DNA ligase [Odoribacter splanchnicus DSM 20712]
 gi|324310753|gb|ADY31306.1| DNA ligase [Odoribacter splanchnicus DSM 20712]
          Length = 829

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 70  ALHHQKWYYRLDN-PLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           AL +  + Y ++N P  +D  +D +   L+ L+E++PE++D + P   VG
Sbjct: 14  ALEYHNYKYYIENAPEISDREFDGLMHDLEKLEEKYPEMYDPNSPTQRVG 63


>gi|311086964|gb|ADP67044.1| DNA ligase (NAD+) [Buchnera aphidicola str. JF99 (Acyrthosiphon
           pisum)]
          Length = 678

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           ++E L KI L ++ +Y+ L+  + +D  YD +  +L  L+ +  EL   D P   VG
Sbjct: 7   KIEKLRKILLKYEYFYHTLNQSIISDAEYDYLFRQLYELELKNKELIPSDSPTQKVG 63


>gi|161723110|ref|YP_288664.2| NAD-dependent DNA ligase LigA [Thermobifida fusca YX]
          Length = 731

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 76  WYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           + Y L +P+ +D  YD++   L  L+ Q+P L   D P   VG
Sbjct: 32  YRYYLGSPIISDAEYDQLMAELRDLEAQYPSLVTPDSPTQKVG 74


>gi|125973550|ref|YP_001037460.1| DNA ligase, NAD-dependent [Clostridium thermocellum ATCC 27405]
 gi|256003369|ref|ZP_05428360.1| DNA ligase, NAD-dependent [Clostridium thermocellum DSM 2360]
 gi|281417755|ref|ZP_06248775.1| DNA ligase, NAD-dependent [Clostridium thermocellum JW20]
 gi|166215580|sp|A3DE88|DNLJ_CLOTH RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|125713775|gb|ABN52267.1| DNA ligase, NAD-dependent [Clostridium thermocellum ATCC 27405]
 gi|255992659|gb|EEU02750.1| DNA ligase, NAD-dependent [Clostridium thermocellum DSM 2360]
 gi|281409157|gb|EFB39415.1| DNA ligase, NAD-dependent [Clostridium thermocellum JW20]
 gi|316940208|gb|ADU74242.1| DNA ligase, NAD-dependent [Clostridium thermocellum DSM 1313]
          Length = 663

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           L +I  +H   YY  D P  +D  YD +   L+ L+++ P+L   D P   +G
Sbjct: 10  LREILNYHSHKYYVEDAPEISDFEYDELYRELEKLEQERPDLITPDSPTQRIG 62


>gi|313665597|ref|YP_004047468.1| DNA ligase (NAD(+)) [Mycoplasma leachii PG50]
 gi|312949194|gb|ADR23790.1| DNA ligase (NAD(+)) [Mycoplasma leachii PG50]
          Length = 668

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +SK + ++ +  L +      K YY  DNP   D  YD   + L +L+  +PE    D P
Sbjct: 1   MSKEQVLLRINQLKEQLNLWSKQYYVDDNPSVDDTEYDLALKELISLENLYPEFITSDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQKVG 65


>gi|307709253|ref|ZP_07645711.1| DNA ligase, NAD-dependent [Streptococcus mitis SK564]
 gi|307619836|gb|EFN98954.1| DNA ligase, NAD-dependent [Streptococcus mitis SK564]
          Length = 648

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 4   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELESAYPDQVLADSPTHRVG 56


>gi|300361107|ref|ZP_07057284.1| NAD-dependent DNA ligase LigA [Lactobacillus gasseri JV-V03]
 gi|300353726|gb|EFJ69597.1| NAD-dependent DNA ligase LigA [Lactobacillus gasseri JV-V03]
          Length = 668

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D +YD+  + L  L+++FP+L   D     VG
Sbjct: 27  YYAKDAPIVEDAVYDKAYQELVELEKRFPDLVTSDSITQRVG 68


>gi|218532981|ref|YP_002423797.1| DNA ligase, NAD-dependent [Methylobacterium chloromethanicum CM4]
 gi|254781363|sp|B7KU78|DNLJ_METC4 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|218525284|gb|ACK85869.1| DNA ligase, NAD-dependent [Methylobacterium chloromethanicum CM4]
          Length = 814

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V +LS+  A      L +      + YY  D P  TD  YD + + L+A++ +FP L
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPAL 66


>gi|189347498|ref|YP_001944027.1| DNA ligase, NAD-dependent [Chlorobium limicola DSM 245]
 gi|254781283|sp|B3EFT6|DNLJ_CHLL2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|189341645|gb|ACD91048.1| DNA ligase, NAD-dependent [Chlorobium limicola DSM 245]
          Length = 673

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + +  A  E+  L K    H   YY    P+ +D  +DR+ E+L AL+   P+L   D P
Sbjct: 1   MDRAMAADEIARLRKEIERHNYLYYVEAEPVISDYEFDRLLEQLIALERLHPDLVTPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SLRVG 65


>gi|315641089|ref|ZP_07896168.1| NAD-dependent DNA ligase LigA [Enterococcus italicus DSM 15952]
 gi|315483097|gb|EFU73614.1| NAD-dependent DNA ligase LigA [Enterococcus italicus DSM 15952]
          Length = 671

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P+  D  YD++ ++L AL+   PE    D P   VG
Sbjct: 23  YYVKDQPVVDDAYYDQLYQQLVALETAHPEYQTSDSPTQRVG 64


>gi|240141492|ref|YP_002965972.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
 gi|240011469|gb|ACS42695.1| DNA ligase, NAD(+)-dependent [Methylobacterium extorquens AM1]
          Length = 814

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V +LS+  A      L +      + YY  D P  TD  YD + + L+A++ +FP L
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPAL 66


>gi|212212963|ref|YP_002303899.1| NAD-dependent DNA ligase [Coxiella burnetii CbuG_Q212]
 gi|254781302|sp|B6J1C6|DNLJ_COXB2 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212011373|gb|ACJ18754.1| NAD-dependent DNA ligase [Coxiella burnetii CbuG_Q212]
          Length = 677

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 24  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 69


>gi|209364099|ref|YP_001424866.2| NAD-dependent DNA ligase [Coxiella burnetii Dugway 5J108-111]
 gi|207082032|gb|ABS76887.2| NAD-dependent DNA ligase [Coxiella burnetii Dugway 5J108-111]
          Length = 673

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 24  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 69


>gi|253996456|ref|YP_003048520.1| DNA ligase, NAD-dependent [Methylotenera mobilis JLW8]
 gi|253983135|gb|ACT47993.1| DNA ligase, NAD-dependent [Methylotenera mobilis JLW8]
          Length = 677

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           YY LD P   D  YD++   L  L++ +P L   D P   V
Sbjct: 27  YYVLDAPSVPDSEYDKIYRELQTLEQAYPSLVVADSPTQRV 67


>gi|116873191|ref|YP_849972.1| NAD-dependent DNA ligase LigA [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123466434|sp|A0AJL1|DNLJ_LISW6 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|116742069|emb|CAK21193.1| DNA ligase [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 670

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 64  EYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           E L+ I   +   YY +DNP   D  YD+  + L  ++E  PE    D P   VG
Sbjct: 8   EELINILDQYSYDYYVIDNPTVEDAEYDQKMQELLKIEEAHPEWVTPDSPSKRVG 62


>gi|212218835|ref|YP_002305622.1| NAD-dependent DNA ligase [Coxiella burnetii CbuK_Q154]
 gi|254781301|sp|B6J878|DNLJ_COXB1 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|212013097|gb|ACJ20477.1| NAD-dependent DNA ligase [Coxiella burnetii CbuK_Q154]
          Length = 673

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 24  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 69


>gi|190359248|sp|A9KCS0|DNLJ_COXBN RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
          Length = 670

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 21  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 66


>gi|251782129|ref|YP_002996431.1| NAD-dependent DNA ligase LigA [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390758|dbj|BAH81217.1| NAD-dependent DNA ligase [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  L ++   +++ YY  D+P  +D  YD++   L  L+ Q+PE   +D P   VG
Sbjct: 5   IRELTELLNRYRQEYYTNDSPSVSDSEYDKLYRELVDLENQYPEHVLQDSPTQNVG 60


>gi|194016164|ref|ZP_03054779.1| DNA ligase, NAD-dependent [Bacillus pumilus ATCC 7061]
 gi|194012519|gb|EDW22086.1| DNA ligase, NAD-dependent [Bacillus pumilus ATCC 7061]
          Length = 668

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + K  A   +E L +I   +   Y+ LD P   D  YD     L +L+E+ P+L   D P
Sbjct: 1   MDKEAAKRRIEELHQILNQYNYEYHTLDRPSVPDAEYDARMRELISLEEEHPDLKAADSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  SQRVG 65


>gi|56966057|pdb|1TA8|A Chain A, Structural Rearrangement Accompanying Nad+ Synthesis
           Within A Bacterial Dna Ligase Crystal
          Length = 332

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D P   D +YDR+ + L  ++ +FP+L   D P   VG
Sbjct: 29  YYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVG 70


>gi|332665881|ref|YP_004448669.1| DNA ligase [Haliscomenobacter hydrossis DSM 1100]
 gi|332334695|gb|AEE51796.1| DNA ligase [Haliscomenobacter hydrossis DSM 1100]
          Length = 711

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117
           L  + ++H+  YY  ++P+ +D  YD++ + L+ L+E  PEL   D P   V
Sbjct: 36  LCGLIIYHEWRYYIQNDPVLSDYEYDQLFKLLERLEEVHPELVSADSPSQRV 87


>gi|332653279|ref|ZP_08419024.1| DNA ligase, NAD-dependent [Ruminococcaceae bacterium D16]
 gi|332518425|gb|EGJ48028.1| DNA ligase, NAD-dependent [Ruminococcaceae bacterium D16]
          Length = 657

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY  D+P  +D  YD    RL+ L+   PEL   D P   VG
Sbjct: 21  YYVKDDPTMSDYDYDHKLRRLEELEGAHPELITPDSPTQRVG 62


>gi|306829554|ref|ZP_07462744.1| NAD-dependent DNA ligase LigA [Streptococcus mitis ATCC 6249]
 gi|304428640|gb|EFM31730.1| NAD-dependent DNA ligase LigA [Streptococcus mitis ATCC 6249]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 8   LVALLNRYASEYYTSDNPSVSDSEYDRLYRELVELEAAYPDQVLADSPTHRVG 60


>gi|323126984|gb|ADX24281.1| NAD-dependent DNA ligase LigA [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 63  VEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           +  L ++   +++ YY  D+P  +D  YD++   L  L+ Q+PE   +D P   VG
Sbjct: 5   IRELTELLNRYRQEYYTNDSPSVSDSEYDKLYRELVDLENQYPEHVLQDSPTQNVG 60


>gi|260433791|ref|ZP_05787762.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417619|gb|EEX10878.1| DNA ligase, NAD-dependent [Silicibacter lacuscaerulensis ITI-1157]
          Length = 708

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 31/68 (45%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDE 110
           V  L++ +A  E+  L    L   + Y+  D P  +D  YD +  R   ++ +FP L   
Sbjct: 7   VQELTEDQAKEELARLASALLRANELYHGQDAPEISDAEYDALKRRNLEIEARFPHLKRP 66

Query: 111 DHPWNTVG 118
           D P   VG
Sbjct: 67  DSPTEQVG 74


>gi|163854038|ref|YP_001642081.1| DNA ligase, NAD-dependent [Methylobacterium extorquens PA1]
 gi|254781364|sp|A9VWA4|DNLJ_METEP RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|163665643|gb|ABY33010.1| DNA ligase, NAD-dependent [Methylobacterium extorquens PA1]
          Length = 814

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 51  VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPEL 107
           V +LS+  A      L +      + YY  D P  TD  YD + + L+A++ +FP L
Sbjct: 10  VEALSEDAAQARHAELSRAIERANQLYYNEDAPELTDAEYDALRQELEAIEARFPAL 66


>gi|309777086|ref|ZP_07672052.1| DNA ligase, NAD-dependent [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915156|gb|EFP60930.1| DNA ligase, NAD-dependent [Erysipelotrichaceae bacterium 3_1_53]
          Length = 665

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P  +D  YDR  + L AL+E++P+  D +     VG
Sbjct: 20  YYVLDQPSMSDQEYDRYYQELVALEEKYPQYRDPNSITQRVG 61


>gi|298245037|ref|ZP_06968843.1| DNA ligase, NAD-dependent [Ktedonobacter racemifer DSM 44963]
 gi|297552518|gb|EFH86383.1| DNA ligase, NAD-dependent [Ktedonobacter racemifer DSM 44963]
          Length = 700

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 42  ESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQ 101
           ES L+ A +       + + E+ + ++ A +    Y+ LDNP  +D  YD++   L  ++
Sbjct: 18  ESLLEHAGQTEEERLAKRVAELRHQIEEANYQ---YHVLDNPTLSDAEYDQLMIELQRIE 74

Query: 102 EQFPELFDEDHPWNTVG 118
            + PEL   + P   VG
Sbjct: 75  GEHPELVTPESPTQRVG 91


>gi|255283571|ref|ZP_05348126.1| DNA ligase, NAD-dependent [Bryantella formatexigens DSM 14469]
 gi|255265833|gb|EET59038.1| DNA ligase, NAD-dependent [Bryantella formatexigens DSM 14469]
          Length = 667

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           H+  YY L+ P  TD  YDR+ + L AL+++   +     P  TVGY
Sbjct: 18  HRNAYYNLNAPTITDQEYDRLYDELAALEKETGVILSYS-PTQTVGY 63


>gi|165923886|ref|ZP_02219718.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 334]
 gi|165916671|gb|EDR35275.1| DNA ligase, NAD-dependent [Coxiella burnetii RSA 334]
          Length = 670

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 21  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 66


>gi|307706499|ref|ZP_07643306.1| DNA ligase, NAD-dependent [Streptococcus mitis SK321]
 gi|307617954|gb|EFN97114.1| DNA ligase, NAD-dependent [Streptococcus mitis SK321]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPDQVLADSPTHRVG 60


>gi|153207803|ref|ZP_01946403.1| DNA ligase, NAD-dependent [Coxiella burnetii 'MSU Goat Q177']
 gi|120576355|gb|EAX32979.1| DNA ligase, NAD-dependent [Coxiella burnetii 'MSU Goat Q177']
          Length = 670

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 73  HQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           H   YY L  P   D +YD +   L  L++++PE      P   VG
Sbjct: 21  HNYRYYVLSQPTIPDSVYDELFHELQKLEKKYPETITPSSPTQRVG 66


>gi|315613211|ref|ZP_07888121.1| NAD-dependent DNA ligase LigA [Streptococcus sanguinis ATCC 49296]
 gi|315314773|gb|EFU62815.1| NAD-dependent DNA ligase LigA [Streptococcus sanguinis ATCC 49296]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELEAAYPDQVLADSPTHRVG 60


>gi|89069525|ref|ZP_01156869.1| DNA ligase, NAD-dependent [Oceanicola granulosus HTCC2516]
 gi|89044860|gb|EAR50950.1| DNA ligase, NAD-dependent [Oceanicola granulosus HTCC2516]
          Length = 739

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 83  PLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           P+  D  YD +  R  AL+ +FPEL   D P   VG
Sbjct: 30  PIMDDAAYDALKRRNAALEARFPELMRADSPTGQVG 65


>gi|307708748|ref|ZP_07645210.1| DNA ligase, NAD-dependent [Streptococcus mitis NCTC 12261]
 gi|307615114|gb|EFN94325.1| DNA ligase, NAD-dependent [Streptococcus mitis NCTC 12261]
          Length = 652

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 66  LVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LV +   +   YY  DNP  +D  YDR+   L  L+  +P+    D P + VG
Sbjct: 8   LVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPDQVLADSPTHRVG 60


>gi|323342976|ref|ZP_08083207.1| NAD-dependent DNA ligase LigA [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322463040|gb|EFY08235.1| NAD-dependent DNA ligase LigA [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 659

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 71  LHHQKW-YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           LH   + Y+ +D P   D  YD++   L+ L+ + PE FD + P   VG
Sbjct: 13  LHQYNYEYHVMDQPTIADVEYDQLLRELNELEVKHPEFFDINSPTQKVG 61


>gi|146277206|ref|YP_001167365.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17025]
 gi|166216230|sp|A4WRP6|DNLJ_RHOS5 RecName: Full=DNA ligase; AltName: Full=Polydeoxyribonucleotide
           synthase [NAD+]
 gi|145555447|gb|ABP70060.1| DNA ligase, NAD-dependent [Rhodobacter sphaeroides ATCC 17025]
          Length = 704

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           Y+  D P  +D  YD +  R  A++E+FP L   D P   VG
Sbjct: 33  YHTHDAPRISDADYDALKRRNRAIEERFPALRRSDSPSERVG 74


>gi|323490410|ref|ZP_08095622.1| DNA ligase [Planococcus donghaensis MPA1U2]
 gi|323395909|gb|EGA88743.1| DNA ligase [Planococcus donghaensis MPA1U2]
          Length = 668

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 77  YYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
           YY LD P   D +YD++   L  L+  +P+L   D P   VG
Sbjct: 24  YYVLDKPAVPDAIYDQLLNELIDLETLYPDLVFPDSPTQRVG 65


>gi|294340191|emb|CAZ88563.1| DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) [Thiomonas sp.
           3As]
          Length = 686

 Score = 34.7 bits (78), Expect = 5.0,